(data stored in ACNUC7421 zone)

EMBL: D50453

ID   D50453; SV 1; linear; genomic DNA; STD; PRO; 146191 BP.
XX
AC   D50453;
XX
DT   01-FEB-1997 (Rel. 50, Created)
DT   06-JUL-2007 (Rel. 92, Last updated, Version 4)
XX
DE   Bacillus subtilis DNA, 25-36 degree region.
XX
KW   .
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-146191
RA   Yamane K.;
RT   ;
RL   Submitted (28-APR-1995) to the INSDC.
RL   Kunio Yamane, University of Tsukuba, Institute of Biological Sciences;
RL   1-1-1 Ten-ohdai, Tsukuba, Ibaraki 305, Japan
RL   (E-mail:kyamane@sakura.cc.tsukuba.ac.jp, Tel:81-298-53-6680,
RL   Fax:81-298-53-6680)
XX
RN   [2]
RP   1-146191
RA   Yamane K., Kumano M., Kurita K.;
RT   "The 25 degree-36 degree region of the Bacillus subtilis chromosome:
RT   determination of the sequence of a 146kb segment and identification of 113
RT   genes";
RL   Microbiology 142:3047-3056(1996).
XX
DR   MD5; 13a69bc1172d8909f5547b9c7a697f18.
DR   EuropePMC; PMC103788; 10515943.
DR   EuropePMC; PMC523217; 15489457.
DR   EuropePMC; PMC93981; 10438764.
DR   EuropePMC; PMC94008; 10438791.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..146191
FT                   /organism="Bacillus subtilis"
FT                   /strain="168 trpC2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        220..1476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAA"
FT                   /product="glycine betain/L-proline transport ATPase"
FT                   /db_xref="GOA:P46920"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46920"
FT                   /protein_id="BAA08932.1"
FT                   /translation="MSVDEKPIKIKVEKVSKIFGKQTKKAVQMLANGKAKKEILKATGS
FT                   TVGVNQADFEVYDGEIFVIMGLSGSGKSTLVRMLNRLIEPTAGNIYIDGDMITNMSKDQ
FT                   LREVRRKKISMVFQKFALFPHRTILENTEYGLELQGVDKQERQQKALESLKLVGLEGFE
FT                   HQYPDQLSGGMQQRVGLARALTNDPDILLMDEAFSALDPLIRKDMQDELLDLHDNVGKT
FT                   IIFITHDLDEALRIGDRIVLMKDGNIVQIGTPEEILMNPSNEYVEKFVEDVDLSKVLTA
FT                   GHIMKRAETVRIDKGPRVALTLMKNLGISSIYAVDKQKKLLGVIYASDAKKAAESDLSL
FT                   QDILNTEFTTVPENTYLTEIFDVVSDANIPIAVVDEKQRMKGIVVRGALIGALAGNNEY
FT                   INAEGTNEQTQDPSAQEVK"
FT   CDS_pept        1478..2326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAB"
FT                   /product="glycine betain/L-proline transmembrane protein"
FT                   /db_xref="GOA:P46921"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46921"
FT                   /protein_id="BAA08933.1"
FT                   /translation="MDRLPRIPLADIIDRFVDWITMTFGGFFDGIANGLAAFVNGIVTG
FT                   LGFIPSILLTIIFAALAWWISTRGIALFTLIGFLLIDYLGYWDPMLQTLALVLTSVIIS
FT                   IVVGVPIGIWASQKETVRRIVTPILDLMQTMPAFVYLLPAIFFFNIGVVPGVVASVIFA
FT                   MPPTIRMTVLGIKQVPADLIEATEAFGSTTAQRLFKVQLPLATKTILAGINQSIMLALS
FT                   MVVIAAMVGAPGLGSEVYSAVTQLKTGVGVEAGIAIVIVAITLDRITQNIKVKKKSRGN
FT                   A"
FT   CDS_pept        2326..3207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAC"
FT                   /product="glycine betain-binding protein precursor"
FT                   /db_xref="GOA:P46922"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="PDB:2B4L"
FT                   /db_xref="PDB:2B4M"
FT                   /db_xref="PDB:3CHG"
FT                   /db_xref="PDB:5NXX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46922"
FT                   /protein_id="BAA08934.1"
FT                   /translation="MLKKIIGIGVSAMLALSLAACGSENDENASAAEQVNKTIIGIDPG
FT                   SGIMSLTDKAMKDYDLNDWTLISASSAAMTATLKKSYDRKKPIIITGWTPHWMFSRYKL
FT                   KYLDDPKQSYGSAEEIHTITRKGFSKEQPNAAKLLSQFKWTQDEMGEIMIKVEEGEKPA
FT                   KVAAEYVNKHKDQIAEWTKGVQKVKGDKINLAYVAWDSEIASTNVIGKVLEDLGYEVTL
FT                   TQVEAGPMWTAIATGSADASLSAWLPNTHKAYAAKYKGKYDDIGTSMTGVKMGLVVPQY
FT                   MKNVNSIEDLKK"
FT   CDS_pept        complement(3226..4395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amhX"
FT                   /product="amidohydrolase"
FT                   /db_xref="GOA:P54983"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="InterPro:IPR037484"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54983"
FT                   /protein_id="BAA08935.1"
FT                   /translation="MQKLSEEMKQTIMDIFEHLHANPEVSWKEYETTSFLKQKLEDLGC
FT                   RTRTFSDCTGVVGEIGSGSPVVAVRADIDALWQEVNGTFRANHSCGHDSHMTMALGTLM
FT                   LLKKQPELPKGTIRFIFQPAEEKGGGALKMIEEGVLDDIDYLYGVHVRPIQETQNGRCA
FT                   PSILHGSSQHIEGTIIGEEAHGARPHLGKNSIEIAAFLVHKLGLIHIDPQIPHTVKMTK
FT                   LQAGGESSNIIPGKASFSLDLRAQTNEAMEALIAETERACEAAAAAFGAKIELHKEHSL
FT                   PAATQNKEAEAIMAEAITEIIGAERLDDPLVTTGGEDFHFYAVKVPNLKTTMLGLGCGL
FT                   QPGLHHPHMTFDRNAMFTGIHILANACSKHFRRRNHLLPLTLLNAKKAA"
FT   CDS_pept        4787..5977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgA"
FT                   /note="homologue of hypothetical protein HI10594 of H.
FT                   influenzae"
FT                   /db_xref="GOA:P55908"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55908"
FT                   /protein_id="BAA08936.1"
FT                   /translation="MVGSAPIIFLILFTGGTIAILEKTGAINGLIYNVISKFRTKQLLC
FT                   ICIVGALFSILGTTGIVVNSVIGCIPIGLIVARSLKWDAVAGAAVIYIGCYAGFNSTIL
FT                   SPSPLGLSQSIAELPLFSGIGLRVVIYICFLLSSIIYIYLYTRKLKKSKDASVLGTDWF
FT                   PAAGMGEAGKEEDQSVPFTVRHKLILAVAGLSLVGFLYGALKLGWSDSQMAATFIFISV
FT                   LAGLIGGLAANDIAKTFITGCQSLVYGALIVGMARSISVILENGKLLDTVVNALASLLD
FT                   GFSPIAGAIGMYIASALLHFLISSGSGEAVVFIPILAPLADLMGITRQVAVEAVMLGEG
FT                   VVNCVNPTSGVLMAVLAASGIPYVKWLRFMVPLALIWFLIGLVFIVIGVMINWGPF"
FT   CDS_pept        6093..6674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgB"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55909"
FT                   /protein_id="BAA08937.1"
FT                   /translation="MNNLRNRLSGVNGKNKRVKEKEQKIWSENGMIAGAVALPDVIIRG
FT                   IMFEFPFKEWSASLVFLFIIILYYCIRAAASGMLMPRIDTKEELQKRVKQQRIESIACA
FT                   FAVVVLTMYDRGIPHTFFAWLKMILLFIVCGGVLFLLRYVIVKLAYRRAVKEEIKKKSS
FT                   FLFGKRGKRSQFRAAFFIGTLICIHSAKLF"
FT   CDS_pept        6823..8805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amyE"
FT                   /product="alpha-amylase"
FT                   /db_xref="GOA:P00691"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031319"
FT                   /db_xref="InterPro:IPR031965"
FT                   /db_xref="PDB:1BAG"
FT                   /db_xref="PDB:1UA7"
FT                   /db_xref="UniProtKB/Swiss-Prot:P00691"
FT                   /protein_id="BAA08938.1"
FT                   /translation="MFAKRFKTSLLPLFAGFLLLFHLVLAGPAAASAETANKSNELTAP
FT                   SIKSGTILHAWNWSFNTLKHNMKDIHDAGYTAIQTSPINQVKEGNQGDKSMSNWYWLYQ
FT                   PTSYQIGNRYLGTEQEFKEMCAAAEEYGIKVIVDAVINHTTSDYAAISNEVKSIPNWTH
FT                   GNTQIKNWSDRWDVTQNSLLGLYDWNTQNTQVQSYLKRFLDRALNDGADGFRFDAAKHI
FT                   ELPDDGSYGSQFWPNITNTSAEFQYGEILQDSASRDAAYANYMDVTASNYGHSIRSALK
FT                   NRNLGVSNISHYASDVSADKLVTWVESHDTYANDDEESTWMSDDDIRLGWAVIASRSGS
FT                   TPLFFSRPEGGGNGVRFPGKSQIGDRGSALFEDQAITAVNRFHNVMAGQPEELSNPNGN
FT                   NQIFMNQRGSHGVVLANAGSSSVSINTATKLPDGRYDNKAGAGSFQVNDGKLTGTINAR
FT                   SVAVLYPDDIAKAPHVFLENYKTGVTHSFNDQLTITLRADANTTKAVYQINNGPDDRRL
FT                   RMEINSQSEKEIQFGKTYTIMLKGTNSDGVTRTEKYSFVKRDPASAKTIGYQNPNHWSQ
FT                   VNAYIYKHDGSRVIELTGSWPGKPMTKNADGIYTLTLPADTDTTNAKVIFNNGSAQVPG
FT                   QNQPGFDYVLNGLYNDSGLSGSLPH"
FT   CDS_pept        8982..9947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctE"
FT                   /product="L-lactate dehydrogenase"
FT                   /db_xref="GOA:P13714"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:3PQD"
FT                   /db_xref="PDB:3PQE"
FT                   /db_xref="PDB:3PQF"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13714"
FT                   /protein_id="BAA08939.1"
FT                   /translation="MMNKHVNKVALIGAGFVGSSYAFALINQGITDELVVIDVNKEKAM
FT                   GDVMDLPHGKAFGLQPVKTSYGTYEDCKDADIVCICAGANQKPGETRLELVEKNLKIFK
FT                   GIVSEVMASGFDGIFLVATNPVDILTYATWKFSGLPKERVIGSGTTLDSARFRFMLSEY
FT                   FGAAPQNVHAHIIGEHGDTELPVWSHANVGGVPVSELVEKNDAYKQEELDQIVDDVKNA
FT                   AYHIIEKKGATYYGVAMSLARITKAILHNENSILTVSTYLDGQYGADDVYIGVPAVVNR
FT                   GGIAGITELNLNEKEKEQFLHSAGVLKNILKPHFAEQKVN"
FT   CDS_pept        10180..11604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgC"
FT                   /note="homologue of L-lactate permease of E. coli"
FT                   /db_xref="GOA:P55910"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55910"
FT                   /protein_id="BAA08940.1"
FT                   /translation="MLGIGSGLWPIGYIVLMAVWLYKIAVKTGKFTIIRSSIAGISPDQ
FT                   RLQLLLIGFCFNAFLEGAAGFGVPIAISAALLVELGFKPLKAAALCLIANAASGAFGAI
FT                   GIPVITGAQIGDLSALELSRTLMWTLPMISFLIPFLLVFLLDRMKGIKQTWPALLVVSG
FT                   GYTAVQTLTMAVLGPELANILAALFSMGGLAFFLRKWQPKEIYREEGAGDAGEKKAYRA
FT                   ADIARAWSPFYILTAAITIWSLPAFKALFQEGGLLYQSTLLFKMPFLHQQIMKMPPIAP
FT                   SAMPLDAVFKVDLLSATGTAILAAVIVTGLVSKKFSSRDAFASLKETGKELWVPIMTIC
FT                   FVMGFANLANFAGLSSSIGLALARTGDLFPFVSPVLGWIGVFITGSVVSNNALFGHLQV
FT                   VTGAQIGAGSDLLLAANTAGGVMAKLVSPQSIAIAAAAVGQTGKESKLFKRTVPYSLIL
FT                   LLIICIWTFTLARLGV"
FT   CDS_pept        complement(12129..13193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgD"
FT                   /product="multidrug resistance protein(EmrB) homologue of
FT                   H. influenzae"
FT                   /db_xref="GOA:P94379"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:P94379"
FT                   /protein_id="BAA08941.1"
FT                   /translation="MDTTTAKQASTKFVVLGLLLGILMSAMDNTIVATAMGNIVADLGS
FT                   FDKFAWVTASYMVAVMAGMPIYGKLSDMYGRKRFSCLDLFFSLIGSALCGIAQTMNQLI
FT                   IFRAIQGIGGGALLPIAFTIIFDLFPPEKRGKMSGMFGAVFGLSSVLGPLLGAIITDSI
FT                   SWHWVFYINVPIGALSLFFIIRYYKESLEHRKQKIDWGGAITLVVSIVCLMFALELGGK
FT                   TYDWNSIQIIGLFIVFAVFFIAFFIVEKKAEDPARYSARSSRMACLRQRQILAFLYEGI
FT                   FIILAVFIPTFVQPVYASSAASAGFILTPMMIGSVIRSMIGGIFQHEDKLPQSDADICY
FT                   SFLYRHAASFQYDA"
FT   CDS_pept        13468..13773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgE"
FT                   /db_xref="GOA:P94380"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:P94380"
FT                   /protein_id="BAA08942.1"
FT                   /translation="MTAGELGKKTGLSTGSVTALVDRLEKAGVCGSWKRTPNDRRRVVI
FT                   VPLTASKKHIKDLFRPLSESTMDLCREYTEEELELIFSFVGKAADIMEDELERLKQ"
FT   CDS_pept        14000..14476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgF"
FT                   /db_xref="GOA:P94381"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94381"
FT                   /protein_id="BAA08943.1"
FT                   /translation="MLFIYFGLSQFLTAPFVKTFLWLFGFFVLTYTGIETLKNVREPMD
FT                   VRSSRGKPSYRKTFASGFLISLSNPLSILFWLGIYGSILAKTAEAYNMNQLLIYSSGIM
FT                   IGILIWDFCMAITASTFRNLLHEKLLRGLTGIAGVSLLVFGFYFGYQGIKQLLG"
FT   CDS_pept        14546..15307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgG"
FT                   /db_xref="InterPro:IPR014988"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94382"
FT                   /protein_id="BAA08944.1"
FT                   /translation="MVNGIYTKSFLERIQEELPEWQRIAFELLAETLGDDADTFPCIPG
FT                   RQAFLTDQLRIAFAGDPRENRTAEELAPLLAEYGKISRDTGKYASLVVLFDTPEDLAEI
FT                   IRLKRMKSCFGAFKIDLVIKTKKNGRKTFRPILSIINGSFVLTASRISFCALHRGTRQE
FT                   EAGAFLFFVVTFQPRWVFDDLNGSTAFGRNMSRLIRSRLEAYDQAPIHPQLGWYGGKDN
FT                   REWKQYFLRDDEKQVSKCPFSYLKNMFNKMK"
FT   CDS_pept        complement(15339..16472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgH"
FT                   /note="homologue of aromatic amino acids transport protein
FT                   of E. coli"
FT                   /db_xref="GOA:P94383"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94383"
FT                   /protein_id="BAA08945.1"
FT                   /translation="MSLNSSPSYRRRAGKGLVLCVCRKAFGKWAGFSNGWVYWTSEMLI
FT                   TGSQLTAISLFTKHWFPQVPLWVFASIYAVLGLLIIFTGLAVFEKTENVLAVIKTAAIF
FT                   MFIVIAILALCGILSGGNHGIHVPNKTSEFFPYGAMGLWTGLIYAFYAFGGIEVMGLMA
FT                   VHLKKPEEASKSGKLMLATLAIIYIISIGLALLLVPLHTFTEQDSPFITSLKGYNLEII
FT                   LDIFNGIFIIAGFSTLIASLFAVTTLLCTMADDGDAPKCFTLKEGKKICWPALGLTFAG
FT                   LVLSIILSLVLPKNIYEHMTTAAGLMLLYTWLFILFSSKKLTDPEGMGKTQIYLAMVLI
FT                   AAAVSGTLFEKSSRPGFFVSIGFLVIIAIVTMIYQKK"
FT   CDS_pept        16855..17373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgI"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:P94384"
FT                   /protein_id="BAA08946.1"
FT                   /translation="MSKGSRSLILCAYHAKDSYEHLDQGATIDAIHSIHVKVSDHLYSN
FT                   PVLSRWLPLIEDTGPASMICCWPACRPDIEQALIWEAKRMSFRIRAMTICAVRLSSLAY
FT                   RSPTCITHLRYCMDTVLDEEGNLSVETPLSDAGDYVRLRAEMDLIVAFSSCPRCNRDIQ
FT                   WRQCDIHTG"
FT   CDS_pept        17513..18331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="outB"
FT                   /product="spore outgrowth factor B"
FT                   /db_xref="GOA:P08164"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="PDB:1EE1"
FT                   /db_xref="PDB:1FYD"
FT                   /db_xref="PDB:1IFX"
FT                   /db_xref="PDB:1IH8"
FT                   /db_xref="PDB:1KQP"
FT                   /db_xref="PDB:1NSY"
FT                   /db_xref="PDB:2NSY"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08164"
FT                   /protein_id="BAA08947.1"
FT                   /translation="MSMQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKKTGAKGFVLG
FT                   ISGGQDSTLAGRLAQLAVESIREEGGDAQFIAVRLPHGTQQDEDDAQLALKFIKPDKSW
FT                   KFDIKSTVSAFSDQYQQETGDQLTDFNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAE
FT                   AVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDE
FT                   TELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK"
FT   CDS_pept        complement(18381..18974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmrB"
FT                   /product="tunicamycin resistance protein"
FT                   /db_xref="GOA:P12921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12921"
FT                   /protein_id="BAA08948.1"
FT                   /translation="MIIWINGAFGSGKTQTAFELHRRLNPSYVYDPQKMGFALRSMVPQ
FT                   EIAKDDFQSYPLWRAFNYSLLASLTDTYRGILIVPMTIVHPEYFNEIIGRLRQEGRIVH
FT                   HFTLMASKETLLKRLRTRAEGKNSWAAKQIDRCVEGLSSPIFEDHIQTDNLSIQDVAEN
FT                   IAARAELPLDPDTRGSLRRFADRLMVKLNHIRIK"
FT   CDS_pept        19250..19810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroI"
FT                   /product="sikimate kinase"
FT                   /db_xref="GOA:P37944"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37944"
FT                   /protein_id="BAA08949.1"
FT                   /translation="MNAKRAIPVRERNIVLIGFMGVGKTTIGQLVAKKLYRDFIDIDQQ
FT                   IEKDFNMSIPEIFEKKGEDFSRKTEKEYILDICHHKRFKIVSLGGGSFKQEEIRNCCLE
FT                   NCLVLHLDLSWENWKQRADLLIESRPVLHNRSMDEMEQLFNERKVIYDKHNSKVATDNL
FT                   SPEEVADYIVETLKIGWDLYQPM"
FT   CDS_pept        20289..20675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgJ"
FT                   /db_xref="UniProtKB/TrEMBL:P94386"
FT                   /protein_id="BAA08950.1"
FT                   /translation="MNRRGRGVTLPFLAESYVFNSFFLREGGRNLNHLFRCINTDALLY
FT                   IRRKCQRRMAGARSYIQHSMLCPAFRCFNHQPQIFPLGKYLFIPIHLGVFRKRCFICNL
FT                   NQLLLFVNDDMDYVSNFCYDSSKI"
FT   CDS_pept        20715..21689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgK"
FT                   /note="homologue of regulatory protein OxyR of E. coli"
FT                   /db_xref="GOA:P94387"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94387"
FT                   /protein_id="BAA08951.1"
FT                   /translation="MDIKVMEYAAEIARRQSFTKAAVHLHIAQPSLSQQIKKLEAELGL
FT                   TLFHRSHGSVTLTPHGRRFIEKAEDIIRSRDDLLREMQERSQGIGHKLSIGIPAVTGRY
FT                   LFPPLLKQFVARYPHVEVQLVEKDPVSLEKMTAKGEVDLSVLSLPIEDERLSITPLLTE
FT                   PVVLAVPKEKQRWMPPELVALIEKALEEDEGRQPCVPIDMVRNVPFILLKEGFGFRRTV
FT                   LDLCAESGFKPNAAFKTSHIETAQSLVANGLGVTMAPNMVRRDKDPGVIYLSIQSAPSR
FT                   TLVFVFLKNRYVSLTAQAFMELSRESLKQTFDEGCLGNKDENI"
FT   CDS_pept        21761..22717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cah"
FT                   /product="cephalosporin C deacetylase"
FT                   /db_xref="GOA:P94388"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR039069"
FT                   /db_xref="PDB:1L7A"
FT                   /db_xref="PDB:1ODS"
FT                   /db_xref="PDB:1ODT"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94388"
FT                   /protein_id="BAA08952.1"
FT                   /translation="MQLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQ
FT                   PVDYPADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVN
FT                   WALHGYATFGMLVRGQQSSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEV
FT                   ISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEQPY
FT                   LEINSFFRRNGSPETEVQAMKTLSYFDIMNLADRVKVPVLMSIGLIDKVTPPSTVFAAY
FT                   NHLETKKELKVYRYFGHEYIPAFQTEKLAFFKQHLKG"
FT   CDS_pept        22801..23583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgL"
FT                   /db_xref="InterPro:IPR018775"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94389"
FT                   /protein_id="BAA08953.1"
FT                   /translation="MKQRIIDELKRIEQSYGVKIVYAVESGSRAWGFPSQDSDYDVRFI
FT                   YVPKKEWYFSIEQERDVIEEPIHDLLDISGWELRKTLRLFKKSNPPLLEWLSSDIVYYE
FT                   AFTTAEQLRKLRTEAFKPEASVYHYINMARRNVKDYLQGQEVKIKKYFYVLRPILACQW
FT                   IEKHGTIPPMDFTVLMNELVAEPELKAEMETLLERKRRGEELDLEARIDVIHQFIETEI
FT                   ERIMEAAKELKAEKKDMTSELNRLLLNTVEEVWKDGGS"
FT   CDS_pept        23774..24685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgM"
FT                   /db_xref="GOA:P94390"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94390"
FT                   /protein_id="BAA08954.1"
FT                   /translation="MITRDFFLFLSKSGFLNKMARNWGSRVAAGKIIGGNDFNSSIPTI
FT                   RQLNSQGLSVTVDHLGEFVNSAEVARERTEECIQTIATIADQELNSHVSLKMTSLGLDI
FT                   DMDLVYENMTKILQTAEKHKIMVTIDMEDEVRCQKTLDIFKDFRKKYEHVSTVLQAYLY
FT                   RTEKDIDDLDSLNPFLRLVKGAYKESEKVAFPEKSDVDENYKKIIRKQLLNGHYTAIAT
FT                   HDDKMIDFTKQLAKEHGIANDKFEFQMLYGMRSQTQLSLVKEGYNMRVYLPYGEDWYGY
FT                   FMRRLAERPSNIAFAFKGMTKK"
FT   CDS_pept        24702..26249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgN"
FT                   /note="68% identity protein to 1-pyrroline-5-carboxylate
FT                   dehydrogenase of B. subtilis"
FT                   /db_xref="GOA:P94391"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94391"
FT                   /protein_id="BAA08955.1"
FT                   /translation="MTTPYKHEPFTNFQDQNYVEAFKKALATVSEYLGKDYPLVINGER
FT                   VETEAKIVSINPADKEEVVGRVSKASQEHAEQAIQAAAKAFEEWRYTSPEERAAVLFRA
FT                   AAKVRRRKHEFSALLVKEAGKPWNEADADTAEAIDFMEYYARQMIELAKGKPVNSREGE
FT                   KNQYVYTPTGVTVVIPPWNFLFAIMAGTTVAPIVTGNTVVLKPASATPVIAAKFVEVLE
FT                   ESGLPKGVVNFVPGSGSEVGDYLVDHPKTSLITFTGSREVGTRIFERAAKVQPGQQHLK
FT                   RVIAEMGGKDTVVVDEDADIELAAQSIFTSAFGFAGQKCSAGSRAVVHEKVYDQVLERV
FT                   IEITESKVTAKPDSADVYMGPVIDQGSYDKIMSYIEIGKQEGRLVSGGTGDDSKGYFIK
FT                   PTIFADLDPKARLMQEEIFGPVVAFCKVSDFDEALEVANNTEYGLTGAVITNNRKHIER
FT                   AKQEFHVGNLYFNRNCTGAIVGYHPFGGFKMSGTDSKAGGPDYLALHMQAKTISEMF"
FT   CDS_pept        26445..27794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgO"
FT                   /note="homologue of proline permease of E. coli"
FT                   /db_xref="GOA:P94392"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94392"
FT                   /protein_id="BAA08956.1"
FT                   /translation="MGPAVTALSAGAADMSGWLLMGLPGAMFSTGLSGAWIVIGLCLGA
FT                   WANWLYVAPRLRTYTEKAGNSITIPGFLENRFGDQTKLLRLFSGIVILVFFTFYVSSGM
FT                   VSGGVLFNSILGMDYHTGLWIVTGVVVAYTLFGGFLAVSWTDFVQGIIMFAALILVPIV
FT                   TFFHTGGAGDTVAEIRSVDPDMFNIFKGTSVLGIISLFAWGLGYFGQPHIIVRFMAITS
FT                   VKEIKRARRIGMGWMILSAVGAVLTGLGGIAYYHQRGMTLKDPETIFIQLGNILFHPII
FT                   TGFLISAILAAIMSTISSQLLVTSSSLVEDLYKSMFRRSASDKELVFLGRLAVLAVSIV
FT                   ALVLAWEKNNTILGLVSYAWAGFGASFGPVVLLSLFWKRMTKWGALAGMIVGAATVIIW
FT                   ANAGLSDFLYEMIPGFAASLLSVFFVSILTQAPSQAVTDQFNDYQDTMSQ"
FT   CDS_pept        27947..29182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgP"
FT                   /note="homologue of hypothetical protein HI0093 of H.
FT                   influenzae"
FT                   /db_xref="GOA:P94393"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94393"
FT                   /protein_id="BAA08957.1"
FT                   /translation="MEELLERVFSFSDVDKLIDFISYELQKPVILESADFFLLAYNSYY
FT                   INHFDSANQQTIFSKKCPVQIFERFLKDGIIEKLKTEPEPFRVNKIESIGLNQRVVVSA
FT                   KHKGEVMGYIWIQELDQNLTDEELDFLYETSFHVGKIIYKTNKLKQEKEEKAEDLIKRA
FT                   IYQQFTSEKELRREAERINTVLPSMFSVVILHAANGDGEAVEDLKENIRSYLNLRDKVS
FT                   HVLTIESNIVIVVASFSQKSSVSSAASEFINKLLTHFHFQKIPTPIYIGIGNEYNHLLK
FT                   LGKSYTEALEVIKAAEITGNQENIPYEYAKLGIYRYLESIEQKNEFLEYENKDLALLKA
FT                   KDEESSTELLKTLEVYLLNNCKTKPAAEQLFIHQNTLNYRIKQITEMTSIDLSDFRTRC
FT                   QLYLDLMLMKKK"
FT   CDS_pept        complement(29219..30076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgQ"
FT                   /db_xref="GOA:P94394"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94394"
FT                   /protein_id="BAA08958.1"
FT                   /translation="MFRLLVLMGFTFFFYHLHASGNLTKYINMKYAYLSFIAIFLLAIL
FT                   TAVQAYLFIKSPEKSGHHHDHDCGCGHDHEHDHEQNKPFYQRYLIYVVFLFPLVSGIFF
FT                   PIATLDSSIVKTKGFSFKAMESGDHYSQTQYLRPDASLYYAQDSYDKQMKQLFNKYSSK
FT                   KEISLTDDDFLKGMETIYNYPGEFLGRTIEFHGFAYKGNAINKNQLFVLRFGIIHCIAD
FT                   SGVYGMLVEFPKDMDIKDDEWIHIKGTLASEYYQPFKSTLPVVKVTDWNTIKKPDDPYV
FT                   YRGF"
FT   CDS_pept        complement(30081..30965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgR"
FT                   /note="homologue of unidentified protein of E. coli"
FT                   /db_xref="GOA:P94395"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94395"
FT                   /protein_id="BAA08959.1"
FT                   /translation="MTAQSSFLQLNSIFISILIEAIPFILIGVILSGIIQMFVSEEMIA
FT                   RIMPKNRFLAVLFGALAGVLFPACECGIIPITRRLLLKGVPLHAGVAFMLTAPIINPIV
FT                   LFSTYIAFGNRWSVVFYRGGLALAVSLIIGVILSYQFKDNQLLKPDEPGHHHHHHGTLL
FT                   QKLGGTLRHAIDEFFSVGKYLIIGAFIAAAMQTYVKTSTLLAIGQNDVSSSLVMMGLAF
FT                   VLSLCSEVDAFIASSFSSTFSLGSLIAFLVFGAMVDIKNLLMMLAAFKKRFVFLLITYI
FT                   VVIVLAGSLLVKG"
FT   CDS_pept        complement(31065..31835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgS"
FT                   /db_xref="GOA:P94396"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94396"
FT                   /protein_id="BAA08960.1"
FT                   /translation="MHGGHSNCYEEFGYTALIEQGYSIITPSRPGYGRTSKEIGKSLAN
FT                   ACRFYVKLLDHLQIESVHVIAISAGGPSGICFASHYPERVNTLTLQSAVTKEWLTPKDT
FT                   EYKLGEILFRPPVEKWIWKLISSLNNAFPRLMFRAMSPQFSTLPFQRIKSLMNEKDIEA
FT                   FRKMNSRQRSGEGFLIDLSQTAAVSLKDLQAIICPVLIMQSVYDGLVDLSHAHHAKEHI
FT                   RGAVLCLLHSWGHLIWLGKEAAETGSILLGFLES"
FT   CDS_pept        32554..33093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgT"
FT                   /note="homologue of thioredoxin reductase of Mycoplama
FT                   genitalium"
FT                   /db_xref="GOA:O31475"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PDB:5XHU"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31475"
FT                   /protein_id="BAA08961.1"
FT                   /translation="MVISGGGDTAVDWANELEPIAASVTVVHRREEFGGMESSVTKMKQ
FT                   SSVRVLTPYRLEQLNGDEEGIKSVTVCHTESGQRKDIEIDELIINHGFKIDLGPMMEWG
FT                   LEIEEGRVKADRHMRTNLPGVFVAGDAAFYESKLRLIAGGFTEGPTAVNSAKAYLDPKA
FT                   ENMAMYSTHHKKLVHK"
FT   CDS_pept        complement(33125..34576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasBE"
FT                   /product="S-adenosyl-L-methionine:uroporphyrinogen III
FT                   methyltransferase"
FT                   /db_xref="GOA:P42437"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42437"
FT                   /protein_id="BAA08962.1"
FT                   /translation="MIMKNGIVYFVGAGPGDPGLLTIKGKQALKEADVILYDRLANPKL
FT                   LEFASPDCQFIYCGKLPNRHFMKQKEINALLVEKALNGLTVVRLKGGDPSVFGRVGEEA
FT                   DALHEHGIRYEMVPGITSGIAAPLYAGIPVTHRDFASSFAMITAHDKSLKGTPNLDWEG
FT                   LARSVQTLVFYMGVKNLSYICQQLISYGKSPSVPVIVIQWGTWGRQRSVKGTLENIQQK
FT                   VQEHQITNPAIIVIGDIVNFQTHSWFESKPLIGRHLMVVTHGEDEDPLADKLRDSGADL
FT                   IEWPKWRTENMPVNEEILRKIGTFEDVFFTSRRAVCEFFRALASQKIDIRQLTAKLSAA
FT                   SEQAKTELEKRGFLVTAIQPDSEKRLVVGSRHAVENMQKHESCSFYITHENVIDDRFTH
FT                   MIQRTISESPLHMVICPNKLSVQQLINGGEQIGILPEPSASRPPIVCIGDDSAAGIYGF
FT                   TAVQEQDELLAFIHNQHAEKKLLHT"
FT   CDS_pept        complement(34637..34957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasBD"
FT                   /product="subunit of nitrite reductase"
FT                   /db_xref="GOA:P42436"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42436"
FT                   /protein_id="BAA08963.1"
FT                   /translation="MVNKDVTKVCIGKIEELPEQLGKTVYIEDKELAVFKLSDGSIRAI
FT                   ENRCPHKGGVLAEGIVSGQYVFCPMHDWKISLEDGIVQEPDHGCVKTYETLIEGEHVYL
FT                   VY"
FT   CDS_pept        complement(34989..37406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasBC"
FT                   /product="subunit of nitrite reductase"
FT                   /db_xref="GOA:P42435"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42435"
FT                   /protein_id="BAA08964.1"
FT                   /translation="MGKKQLVLVGNGMAGVRAIEEILSVAKDEFQITIFGAEPHPNYNR
FT                   ILLSKVLQGDTDIKDITLNDWDWYEENNIQLYTNETVIKVDTENKTVITDADRIQPYDE
FT                   LILATGSVPFILPIPGADKKGVTAFRDIKDTDTMLAASKQYKKAAVIGGGLLGLEAARG
FT                   LLNLGMDVSVIHLAPFLMERQLDATAGRLLQNELEKQGMTFLLEKQTEEIVGDDRVEGL
FT                   RFKDGTSIEADLVVMAVGIRPNTTLGAESGIPVNRGIIVNDYMQTEIPHIYAVGECAEH
FT                   RGIAYGLVAPLYEQAKVLAKHMCGIETKPYEGSVLSTQLKVSGVEVFSAGDFNESEEKK
FT                   AIKVFDEQDGIYKKIVLRGNQIVGAVLFGDSSEGNRLFSMIQKEADISETSKISILQPL
FT                   SQEAGTSITAAMSDDEIICGCNGVSKGAIIQAIQEKGCSSTDEIKACTGASRSCGGCKP
FT                   LVEEILQHTLGSDFDASAQKEAICGCTTLSRDEVVEEIKAKGLSHTREVMNVLGWKTPE
FT                   GCSKCRPALNYYLGMINPTKYEDDRTSRFVNERMHANIQKDGTYSVVPRMYGGVTNSTD
FT                   LRKIADVVDKYEIPLVKMTGGQRIDLIGVKKEDLPKVWEDLDMPSGYAYGKTLRTVKTC
FT                   VGEQFCRFGTQDSMALGIALEKKFEGLNTPHKVKMAVSACPRNCAESGIKDLGVVGIDG
FT                   GWELYVGGNGGTHLRAGDLLMKVKTNEEVLEYAGAYLQYYRETANYLERTSAWLERVGL
FT                   SHVQSVLNDPEKRQELNGRMNETLSVHKDPWKDFLEDKQTSKELFENVVTTS"
FT   CDS_pept        complement(37528..39660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasBB"
FT                   /product="catalytic subunit of nitrate reductase"
FT                   /db_xref="GOA:P42434"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42434"
FT                   /protein_id="BAA08965.1"
FT                   /translation="MTERLLRYFRDKQQDVQSEKTYDTQCPFCSMQCKMQLVEQTIVTR
FT                   KKYTAIGIDNPTTQGRLCIKGMNAHQHALNSSRITRPLLKKNGEFMPVSWEEALNHIKD
FT                   QVTMIQTEHGHDAMAVYGSASITNEEAYLLGKFARVGLQTKYIDYNGRLCMSAAATAAN
FT                   QTFGADRGLTNPLSDIPHTRVIILAGTNIAECQPTIMPYFEKAKENGAYFIAIDPRETA
FT                   TTKIADLHLKIKPGTDAALANGLVKIIIDEQLINEDFIQSRTNGFEELKQHTDSLDLND
FT                   IAEQTSVSLVDIRKAAVKFAKETSGMLFTARGIEQQTDGTAAVKGFLNMVLITGKIGKP
FT                   YSGYGAITGQGNGQGAREHGQKADQLPGYRSIENEEHRAHIAKVWGIHQDDLPRKGVSA
FT                   YEVMEKINDGDIKGLFLMCSNPAVSSPNANLVKKALRRLTFFVAIDLFISETAKYADVI
FT                   LPASSYLEDEGTMTNVEGRVTLREASRPCPGEAKHDWQIICDLASALGKGRYFSYTSAE
FT                   DIFNELREASRGGIADYSGISYGRLRREGGIHWPCPESDHPGTGRLFTESFAHPDQKAA
FT                   LSVIPNEPPVPKEKPTADYPLYLTTGRVMSHYLTGVQTRKSAALAARHFESFMEIHPQT
FT                   AATYNIEDRVLVKIESPRGSITVRSKLSEQIRKDTVFVPIHWADAQNVNDLIGEALDPA
FT                   CKMPGFKVCAVRIIPI"
FT   CDS_pept        complement(39667..41979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasBA"
FT                   /product="electron transfer subunit of nitrate reductase"
FT                   /db_xref="GOA:P42433"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42433"
FT                   /protein_id="BAA08966.1"
FT                   /translation="MKKQRLVLAGNGMAGIRCIEEVLKLNRHMFEIVIFGSEPHPNYNR
FT                   ILLSSVLQGEASLDDITLNSKDWYDKHGITLYTGETVIQIDTDQQQVITDRKRTLSYDK
FT                   LIVATGSSPHILPIPGADKKGVYGFRTIEDCQALMNMAQHFQKAAVIGAGLLGLEAAVG
FT                   LQHLGMDVSVIHHSAGIMQKQLDQTAARLLQTELEQKGLTFLLEKDTVSISGATKADRI
FT                   HFKDGSSLKADLIVMAAGVKPNIELAVSAGIKVNRGIIVNDFMQTSEPNIYAVGECAEH
FT                   NGTVYGLVAPLYEQGKALASHICGVPCEEYQGSAPSAALKIAGIDVWSAGKIQEDERTT
FT                   SIKIYDEQAGVYKKALFVDDKLRVILFGDTRDKQRLLDSLLKQRDISIAKKQIIEPETS
FT                   GPLFESMPSSETICQCNTVTKGAIEDAVHTNSLTTVEEVKHCTKATGSCGGCKPLVEDL
FT                   LRYMTNSEYTKPASTPSFCSCTDFTEDDIIAELQRRPFTNPAEVMNQLDWKTKNGCSTC
FT                   VPAIQYYLEMLYPGFVQPEPATEETCILIPQMYGGRTNAEQLRTIANIIEAYSIPDVSI
FT                   THGQRLKLSGIKPADLPNMKKDLKMPVYTNEHRHALQSIKACTCGQNRSIQQLAAQIER
FT                   QLEMLPLPAPISISLSCETDCTEAALQDVGAIRTQAGWDIHIGGVRGTHARSGALFCVT
FT                   ENEDSTAGMIKGLIQYYRETDHYLEGVHQWIDRLGIVHIREVLFEEDLRAQLLESLQTD
FT                   LSLIQNPTVETGAYKKG"
FT   CDS_pept        42159..43424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasA"
FT                   /product="nitrate transporter"
FT                   /db_xref="GOA:P42432"
FT                   /db_xref="InterPro:IPR004737"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42432"
FT                   /protein_id="BAA08967.1"
FT                   /translation="MKLSELKTSGHPLTLLCSFLYFDVSFMIWVMLGALGVYISQDFGL
FT                   SPFEKGLVVAVPILSGSVFRIILGILTDRIGPKKTAVIGMLVTMIPLLWGTFGGRSLTE
FT                   LYAIGILLGVAGASFAVALPMASRWYPPHLQGLAMGIAGAGNSGTLFATLFGPRLAEQF
FT                   GWHIVMGIALIPLLIVFILFVSMAKDSPAQPSPQPLKSYLHVFGQKETWFFCLLYSVTF
FT                   GGFVGLSSFLSIFFVDQYQLSKIHAGDFVTLCVAAGSFFRPVGGLISDRVGGTKVLSVL
FT                   FVIVALCMAGVSSLPSLSMGYGPIVCRNDGARNGKRRSIPARAAALPQRNRHGDGNRRC
FT                   GRRNRRVFLAEHLRISQTDDRHICYRFITFPVSRCWRLHLCLPQAITGGKAGARKAARR
FT                   MFRILTDTRLCVSFLFSLDFQQ"
FT   CDS_pept        43480..44397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciA"
FT                   /db_xref="GOA:P94398"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94398"
FT                   /protein_id="BAA08968.1"
FT                   /translation="MNQHTLLPKKTERLQYFGSVSPIKGEKPVEKEKMKDLQNIRKDYF
FT                   FDIQHVGVANVSHPVTITSAMMPAEQTTAANFTMTCNLPRNQKGINMSRLTELLQVYHQ
FT                   NGWILSFSSLQQFTKELAENMDTSSATVEVRFPWFFERKSPKLEKAGLMHADIFMSVTY
FT                   RKDQPFKQRAGISAKVTTLCPCSKEISEYSAHNQRGTVKHLGRIFTRAASLPSDVKADL
FT                   PHAAESNASARLHPVLKRPDEKAVTETAYENPRFVEDLARLIAADLFELEWVSAFEIEC
FT                   RNEESIHLHRCLCEVCFSKEVDKI"
FT   CDS_pept        44394..44978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciB"
FT                   /db_xref="GOA:C0SP99"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0SP99"
FT                   /protein_id="BAA08969.1"
FT                   /translation="MKLSLFIIAVLMPVILLSACSDHAEEHASINTKKTVENITDVRKT
FT                   AKTSIDWTKPSGGEYPDIKQKHVWIDVNVKEQKAYIKEGSNTIYTMMISSGLDQTKDDA
FT                   TPKGTFYVEPERGEWFFSEGYQEGAEYWVSWKNHGEFLFHSVPMTKDQKVIKTEAEKLG
FT                   TKVSHGCIRLTIPDAKWVYENIPEHTKVVIS"
FT   CDS_pept        45287..46480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciC"
FT                   /note="homologues to nitrile hydratase region
FT                   3'-hypothetical protein P47K of P. chlororaphis"
FT                   /db_xref="GOA:P94400"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94400"
FT                   /protein_id="BAA08970.1"
FT                   /translation="MKKIPVTVLSGYLGAGKTTLLNSILQNREGLKIAVIVNDMSEVNI
FT                   DAGLVKQEGGLSRTDEKLVEMSNGCICCTLREDLLIEVEKLAKDGRFDYIVIESTGISE
FT                   PIPVAQTFSYIDEEMGIDLTKFCQLDTMVTVVDANRFWHDYQSGESLLDRKEALGEKDE
FT                   REIADLLIDQIEFCDVLILNKCDLVSEQELEQLENVLRKLQPRARFIRSVKGNVKPQEI
FT                   LHTGLFNFEEASGSAGWIQELTAGHAEHTPETEEYGISSFVYKRRLPFHSTRFYRWLDQ
FT                   MPKNVVRAKGIVWCASHNNLALLMSQAGPSVTIEPVSYWVAALPKLEQEQVKQQEPEIL
FT                   EEWDPEFGDRLTQLVFIGTDLDEETITKELDQCLLTEYEFDSDWSLFEDPFKWKLNQ"
FT   CDS_pept        complement(46529..47209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckA"
FT                   /note="homologue of glutamine permease of H. inflenzae"
FT                   /db_xref="GOA:P42399"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42399"
FT                   /protein_id="BAA08971.1"
FT                   /translation="MINSIQWEYIFNTKLAIESFPYVIKGIGYTLLISFVSMFAGTVIG
FT                   LFISLARMSKLALLRWPAKLYISFMRGVPILVILFILYFGFPYIGIEFSAVTAALIGFS
FT                   LNSAAYIAEINRSAISSVEKGQWEAASSLGLSYWQTMRGIILPQSIRIALPPLANVLLD
FT                   LIKASSLAAMITVPELLQHAKIIGGREFDYMTMYILTALIYWAICSIAAVFQNILEKKY
FT                   AHYV"
FT   CDS_pept        complement(47219..47788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckB"
FT                   /note="homologue of FliY of E. coli"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q9R7U7"
FT                   /protein_id="BAA08972.1"
FT                   /translation="MLTAVNSGQVDAAANDIDVTKDREEKFAFSTPYKYSYGTAIVRKD
FT                   DLSGIKTLKDLKGKKAAGAATTVYMEVARKYGAKEVIYDNATNEQYLKDVANGRTDVIL
FT                   NDYYLQTLALAAFPDLNITIHPDIKYMPNKQALVMKKSNAALQKKMNEALKEMSKDGSL
FT                   TKLSKQFFNKADVSKKIDADVQDVDL"
FT   CDS_pept        48461..48916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckC"
FT                   /db_xref="GOA:P42401"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42401"
FT                   /protein_id="BAA08973.1"
FT                   /translation="MNIYKPAGFWIRLGAALLDYIIVSVPLLLIYWLITGKDPNDSMFI
FT                   SLVVLLYSILLPMFWRGYLIGKRICGIRIVKKDGSQVSLLTMFLRVIVAGLVYCITFGL
FT                   GLIASLILIAVREDKRTLHDLIAGTYVTYATPGEEELNADEEIRKSE"
FT   CDS_pept        48998..49330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckD"
FT                   /db_xref="InterPro:IPR024485"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42402"
FT                   /protein_id="BAA08974.1"
FT                   /translation="MKRITINIITMFIAAAVISLTGTAEAAEKQQQSPANVTLTDQQKK
FT                   EIEQLEAEILKKRKDVISKYVQYGILPKERGEHIKNHLDKHFEMMKQNGFVPKHHPHPH
FT                   KFEKRH"
FT   CDS_pept        49484..50917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckE"
FT                   /note="homologue of beta-glucosidase of B. circulans"
FT                   /db_xref="GOA:P42403"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42403"
FT                   /protein_id="BAA08975.1"
FT                   /translation="MIHQHPESFPKHFLWGSASAAYQIEGAWNEDGKGPSVWDVFTKIP
FT                   GKTFKGTNGEIAVDHYHRFKEDVALMAEMGLKAYRFSVSWPRVFPKGKGEINEAGLAFY
FT                   DSLIDELLSHHIEPVLTLYHWDLPQALMDEYGGFESRNIIEDFNHYCITLYKRFGDRVK
FT                   YWVTLNEQNYNFNHGFITAMHPPGVKDRKRFYEANHIAFLANAKAIESFREYVPEGKIG
FT                   PSFAYSPAYPLSSHPEDILAFENAEEFTNNWWLDMYCWGTYPQIPFRCLEKQGWAPTIE
FT                   AGDMDLLAKGKPDFVGVNYYQTITYERNPLDGVSEGKMNTTGQKGTNQETGIPGVFKTK
FT                   KNPHLTTSNWDWTIDPIGLRIGLRRITSRYQLPVFITENGLGEFDKVEDGTVQDDYRID
FT                   YLRSHLEQCRQAISDGVDLIGYCSWSFTDLLSWLNGYQKRYGFVYVNRDEESTSDLKRL
FT                   KKKSFYWYQDVIKTNGESL"
FT   CDS_pept        complement(50954..51352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comJ"
FT                   /product="competence specific protein"
FT                   /db_xref="GOA:P12669"
FT                   /db_xref="InterPro:IPR020354"
FT                   /db_xref="InterPro:IPR038691"
FT                   /db_xref="PDB:4MQD"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12669"
FT                   /protein_id="BAA08976.1"
FT                   /translation="MIKSWKPQELSISYHQFTVFQKDSTPPVMDWTDEAIEKGYAAADG
FT                   AISFEAQRNTKAFILFRLNSSETVNSYEKKVTVPFHVTENGIHIESIMSKRLSFDLPKG
FT                   DYQLTCWTVPAEMSDLHADTYIIDAVSV"
FT   CDS_pept        complement(51379..51690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comI"
FT                   /product="DNA-entry nuclease"
FT                   /db_xref="GOA:P12667"
FT                   /db_xref="InterPro:IPR029476"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12667"
FT                   /protein_id="BAA08977.1"
FT                   /translation="MAFPSDRYPETAKHIKDAINEGHSEVCTIDRDGAEERREQSLKDV
FT                   PSKKGYDRDEWPMAMCKEGGEGASVEYISPADNRGAGSWVGHRLTDYPDGTKVLFTIQ"
FT   CDS_pept        complement(51996..53717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlpC"
FT                   /product="methyl-accepting chemotaxis protein of B.
FT                   subtilis"
FT                   /db_xref="GOA:P39209"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39209"
FT                   /protein_id="BAA08978.1"
FT                   /translation="MLIKRFKMKLGTKILCLVFVVILLFSASVGTVMLKEITESMKQMA
FT                   TEKAKGDLALSSTYIDDVMSGDWQVKNNKLYKGQTQINGNEDIVDLLGEKTGDTITIFQ
FT                   GDTRVATNVMKNGERAVGTQASSEVIAAVLKKGKRFYGQADVAGSSYQTAYMPLKDQNG
FT                   NIIGMLYTGANQSILASLTQSLFTQFAIVLVIVIMVSVILVLVFTRKINKRLTALKSAF
FT                   ESAGNGDMTIEVSDKTGDELSELSVYYNKMRMKLNDTIQTVQQSALQLASASQQLSAGA
FT                   EETNQASEKITEAVQQIANGAQDQITRIENSESSLKQASADIRDISANTAPIADKGQLA
FT                   QSKADIGQKEIANVQAQMDAIHQSIQKSGEIIHQLDGRSKQIEQILSVITQIADQTNLL
FT                   ALNAAIEAARAGEQGKGFAVVADEVRKLAEESQQSAGQISKLIIEIQKDMNRSARSVEH
FT                   VKTEAAEGVTMIQRTRDAFKEIAAATGEISAEISDLSASVTNISASAHQINDSFAANTA
FT                   DIKESTKNTRQAAALTEEQFAAMEEITAASETLSQLAEELTGIISQFKMINQAENG"
FT   CDS_pept        complement(53828..54385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckF"
FT                   /db_xref="GOA:P42404"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR017552"
FT                   /db_xref="PDB:1M3S"
FT                   /db_xref="PDB:1VIV"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42404"
FT                   /protein_id="BAA08979.1"
FT                   /translation="MKTTEYVAEILNELHNSAAYISNEEADQLADHILSSHQIFTAGAG
FT                   RSGLMAKSFAMRLMHMGFNAHIVGEILTPPLAEGDLVIIGSGSGETKSLIHTAAKAKSL
FT                   HGIVAALTINPESSIGKQADLIIRMPGSPKDQSNGSYKTIQPMGSLFEQTLLLFYDAVI
FT                   LKLMEKKGLDSETMFTHHANLE"
FT   CDS_pept        complement(54495..55022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckG"
FT                   /db_xref="GOA:P42405"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017553"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42405"
FT                   /protein_id="BAA08980.1"
FT                   /translation="MELQLALDLVNIPEAIELVKEVEQYIDVVEIGTPVVINEGLRAVK
FT                   EIKEAFPQLKVLADLKIMDAGGYEIMKASEAGADIITVLGATDDATIKGAVEEAKKQKK
FT                   KILVDMINVTDIESRAKEIDALGVDYICVHTGYDLQAEGKNSFEELTTIKNTVKNAKTA
FT                   IAAASNLIHCQK"
FT   CDS_pept        55308..55616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckH"
FT                   /note="hypothetical 17.6 kDa protein homologue in rpil-cpdB
FT                   intergenic region of E. coli"
FT                   /db_xref="GOA:P42406"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42406"
FT                   /protein_id="BAA08981.1"
FT                   /translation="MIGGKWKMLILWHLGKEGTKRFNELKTLIPDITQKILVNQLRERE
FT                   QDMIVHREVYPVVPPKVEYSLTPHGESLMPILEAMYEWGKGYMEVIDIDKNVMKESL"
FT   CDS_pept        56190..66956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srfAA"
FT                   /product="surfactin production"
FT                   /db_xref="GOA:P27206"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27206"
FT                   /protein_id="BAA08982.1"
FT                   /translation="MEITFYPLTDAQKRIWYTEKFYPHTSISNLAGIGKLVSADAIDYV
FT                   LVEQAIQEFIRRNDAMRLRLRLDENGEPVQYISEYRPVDIKHTDTTEDPNAIEFISQWS
FT                   REETKKPLPLYDCDLFRFSLFTIKENEVWFYANVHHVISDGMSMNIVGNAIMHIYLELA
FT                   SGSETKEGISHSFIDHVLSEQEYAQSKRFEKDKAFWNKQFESVPELVSLKRNASAGGSL
FT                   DAERFSKDVPEALHQQILSFCEANKVSVLSVFQSLLAAYLYRVSGQNDVVTGTFMGNRQ
FT                   NAKEKQMLGMFVSTVPLRTNIDGGQAFSEFVKDRMKDLMKTLRHQKYPYNLLINDLRET
FT                   KSSLTKLFTVSLEYQVMQWQKEEDLAFLTEPIFSGSGLNDVSIHVKDRWDTGKLTIDFD
FT                   YRTDLFSREEINMICERMITMLENALTHPEHTIDELTLISDAEKEKLLARAGGKSVSYR
FT                   KDMTIPELFQEKAELLSDHPAVVFEDRTLSYRTLHEQSARIANVLKQKGVGPDSPVAVL
FT                   IERSERMITAIMGILKAGGAYVAIDPGFPAERIQYILEDCGADFYLTESKVAAPEADAE
FT                   LIDLDQAIEEGAEESLNADVNARNLAYIIYTSGTTGRPKGVMIEHRQVHHLVESLQQTI
FT                   YQSPTQTLPMAFLPPFHFDASVKQIFASLLLGQTLYIVPKKTVTNGAALTAYYRKNSIE
FT                   ATDGTPAHLQMLAAAGDFEGLKLKHMLIGGEGLSSVVADKLLKLFKEAGTAPRLTNVYG
FT                   PTETCVDASVHPVIPENAVQSAYVPIGKALGNNRLYILDQKGRLQPEGVAGELYIAGDG
FT                   VGRGYLHLPELTEEKFLQDPFVPGDRMYRTGDVVRWLPDGTIEYLGREDDQVKVRGYRI
FT                   ELGEIEAVIQQAPDVAKAVVLARPDEQGNLEVCAYVVQKPGSEFAPAGLREHAARQLPD
FT                   YMVPAYFTEVTEIPLTPSGKVDRRKLFALEVKAVSGTAYTAPRNETEKAIAAIWQDVLN
FT                   VEKAGIFDNFFETGGHSLKAMTLLTKIHKETGIEIPQQFLFEHPTITALAEEADHRESK
FT                   AFAVIEPAEKQEHYPLHWHSSEHISSASSRMRESAIHASSSNSEGFRYSKAGARISGIN
FT                   PTPRVIETSFVLENSTPRQKIHVCVDFNIEMIERGGRSDEAIMASFVRTFDLAKAPLFR
FT                   IGLLGLEENRHMLLFDMHHLISDGVSIGIMLEELARIYKGEQLPDLRLQYKDYAVWQSR
FT                   QAAEGYKKDQAYWKEVFAGELPVLQLLSDYPRPPVQSFEGDRVSIKLDAGVKDRLNRLA
FT                   EQNGATLYMVMLSAYYTLLSKYTGQDDIIVGTPSAGRNHSDTEGIIGMFVNTLAIRSEV
FT                   KQNETFTQLISRVRKRVLDAFSHQDYPFEWLVEDLNIPRDVSRHPLFDTMFSLQNATEG
FT                   IPAVGDLSLSVQETNFKIAKFDLTVQARETDEGIEIDVDYSTKLFKQSTADRLLTHFAR
FT                   LLEDAAADPEKPISEYKLLSEEEAASQIQQFNPGRTPYPKDKTIVQLFEEQAANTPDHT
FT                   ALQYEGESLTYRELNERANRLARGILSLGAGEGRTAAVLCERSMDMIVSILAVLKSGSA
FT                   YVPIDPEHPIQRMQHFFRDSGAKVLLTQRKLKALAEEAEFKGVIVLADEEESYHADARN
FT                   LALPLDSAAMANLTYTSGTTGTPKGNIVTHANILRTVKETNYLSITEQDTILGLSNYVF
FT                   DAFMFDMFGSLLNGAKLVLIPKETVLDMARLSRVIERENISILMITTALFHLLVDLNPA
FT                   CLSTLRKIMFGGERASVEHVRKALQTVGKGKLLHMYGPSESTVFATYHPVDELEEHTLS
FT                   VPIGKPVSNTEVYILDRTGHVQPAGIAGELCVTGEGLVKGYYNRPELTEEKFVPHPFTS
FT                   GERMYKTGDLARWLPNGTIEFIGRIDHQVKIRGQAIELGEIEHQLQTHDRVQESVVLAV
FT                   DQGAGDKLLCAYYVGEGDISSQEMREHAAKDLPAYMVPAVFIQMDELPLTGNGKIDRRA
FT                   LPIPDANVSRGVSYVAPRNGTEQKVADIWAQVLQAEQVGAYDHFFDIGGHSLAGMKMPA
FT                   LVHQELGVELSLKDLFQSPTVEGLAQVIASAEKGTAASISPAEKQDTYPVSSPQKRMYV
FT                   LQQLEDAQTSYNMPAVLRLTGELDVERLNSVMQQLMQRHEALRTTFEIKDGETVQRIWE
FT                   EAECEIAYFEAPEEETERIVSEFIKPFKIDQLPLFRIGLIKHSDTEQVLLFDMHHIISD
FT                   GASVGVLIEELSKLYDGETLEPLRIQYKDYAVWQHRFIQSELYKKQEEHWLKELDGELP
FT                   VLTLPTDYSRPAVQTFEGDRIAFSLEAGKADALRRLAKETDSTLYMVLLASYSAFLSKI
FT                   CGQDDIIVGSPVAGRSQADVSRVIGMFVNTLALRTYPKGEKTFADYLNEVKETALSAFD
FT                   AQDYPLEDLIGNVQVQRDTSSNPLFDAVFSMQNANIKDLTMKGIQLEPHPFERKTAKFD
FT                   LTLTADETDGGLTFVLEYNTALFKQETIERWKQYWMELLDAVTGNPNQPLSSLSLVTET
FT                   EKQALLEAWKGKALPVPTDKTVHQLFEETAQRHKDRPAVTYNGQSWTYGELNAKANRLA
FT                   RILMDCGISPDDRVGVLTKPSLEMSAAVLGVLKAGAAFVPIDPDYPDQRIEYILQDSGA
FT                   KLLLKQEGISVPDSYTGDVILLDGSRTILSLPLDENDEENPENPETAVTAENLAYMIYT
FT                   SGTTGQPKGVMVEHHALVNLCFWHHDAFSMTAEDRSAKYAGFGFDASIWEMFPTWSIGA
FT                   ELHVIEEAIRLDIVRLNDYFETNGVTITFLPTQLAEQFMELENTSLRVLLTGGDKLKRA
FT                   VKKPYTLVNNYGPTENTVVATSAEIHPEEGSLSIGRAIANTRVYILGEGNQVQPEGVAG
FT                   ELCVAGRGLARGYLNREDETAKRFVADPFVPGERMYRTGDLVKWTGGGIEYIGRIDQQV
FT                   KVRGYRIELSEIEVQLAQLSEVQDAAVTAVKDKGGNTAIAAYVTPESADIEALKSALKE
FT                   TLPDYMIPAFWVTLNELPVTANGKVDRKALNEPDIEAGSGEYKAPTTDMEELLAGIWQD
FT                   VLGMSEVGVTDNFFSLGGDSIKGIQMASRLNQHGWKLEMKDLNQHPTIEELTQYVERAE
FT                   GKQADQGPVEGEVILTPIQRWFFEKNFTNKHHWNQSVMLHAKKGFDPERVEKTLQALIE
FT                   HHDALRMVYREGQEDVIQYNRGLEAASAQLEVIQIEGQAADYEDRIEREAERLQSSIDL
FT                   QEGGLLKAGLFQAEDGDHLLLAIHHLVVDGVSWRILLEDFSAVYTQLEQGNEPVLPQKT
FT                   HSFAEYAERLQDFANSKAFLKEKEYWSQLEEQAVAAKLPKDRESGDQRMKHTKTIEFSL
FT                   TAEETEQLTTKVHEAYHTEMNDILLTAFGLAMKEWTGQDRVSVHLEGHGREEIIEDLTI
FT                   SRTVGWFTSMYPMVLDMKHADDLGYQLKQMKEDIRHVPNKGVGSGILRYLTAPEHKEDV
FT                   AFSIQPDVSFNYLGQFHQMSHPPFFTTSHLPSPHSLSPETEKPNALDVVGYIENGKLTM
FT                   SLAYHSLEFHEKTVQTFSDSFKAHLLRIIEHCLSQDGTELTPSDLGDDDLTLDELDKLM
FT                   EIF"
FT   CDS_pept        66969..77732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srfAB"
FT                   /product="surfactin production"
FT                   /db_xref="GOA:Q04747"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04747"
FT                   /protein_id="BAA08983.1"
FT                   /translation="MSKKSIQKVYALTPMQEGMLYHAMLDPHSSSYSTQLELGIHAAFD
FT                   LEIFEKSVNELIRSYDILRTVFVHQQLQKPRQVVLAERKTKVHYEDISHADENRQKEHI
FT                   ERYKQQVQRQAFNLAKDILFKVAVFRLAADQLYLAWSNHHIMMDGWSMGVLMKSLFQNY
FT                   EALRAGRTPANGQGKPYSDYIKWLGKQDNEEAESYWSERLAGFEQPSVLPGRLPVKKDE
FT                   YVNKEYSFTWDETLVARIQQTANLHQVTGPNLFQAVLGIVLSKYNFTDDVIFGTVVSGR
FT                   PSEINGIETMAGLFINTIPVRVKVERDRAFADIFTAVQQHAVEAERYDYVPLYEIQKRS
FT                   ALDGNLLNHLVAFENYPLDQELENGSMEDRLGFSIKVESAFEQTSFDFNLIVYPGKTWT
FT                   VKIKYNGAAFDSAFIERTAEHLTRMMEAAVDQPAAFVREYGLVGDEEQRQIVEVFNSTK
FT                   AELPEGMAVHQVFEEQAKRTPASTAVVYEGTKLTYRELNAAANRLARKLVEHGLQKGET
FT                   AAIMNDRSVETVVGMLAVLKAGAAYVPLDPALPGDRLRFMAEDSSVRMVLIGNSYTGQA
FT                   HQLQVPVLTLDIGFEESEAADNLNLPSAPSDLAYIMYTSGSTGKPKGVMIEHKSILRLV
FT                   KNAGYVPVTEEDAMAQTGAVSFDAGTFEVFGALLNGAALYPVKKRHVLDAKQFAAFLRE
FT                   QSITTMWLTSPLFNQLAAKDAGMFGTLRHLIIGGDALVPHIVSKVKQASPSLSLWNGYG
FT                   PTENTTFSTSFLIDREYGGSIPIGKPIGNSTAYIMDEQQCLQPIGAPGELCVGGIGVAR
FT                   GYVNLPELTEKQFLEDPFRPGERIYRTGDLARWLPDGNIEFLGRIDNQVKVRGFRIELG
FT                   EIETKLNMAEHVTEAAVIIRKNKADENEICAYFTADREVAVSELRKTLSQSLPDYMVPA
FT                   HLIQMDSLPLTPNGKINKKELPAPQSEAVQPEYAAPKTESEKKLAEIWEGILGVKAGVT
FT                   DNFFMIGGHSLKAMMMTAKIQEHFHKEVPIKVLFEKPTIQELALYLEENESKEEQTFEP
FT                   IRQASYQQHYPVSPAQRRMYILNQLGQANTSYNVPAVLLLEGEVDKDRLENAIQQLINR
FT                   HEILRTSFDMIDGEVVQTVHKNISFHLEAAKGREEDAEEIIKAFVQPFELNRAPLVRSK
FT                   LVQLEEKRHLLLIDMHHIITDGSSTGILIGDLAKIYQGADLELPQIHYKDYAVWHKEQT
FT                   NYQKDEEYWLDVFKGELPILDLPADFERPAERSFAGERVMFGLDKQITAQIKSLMAETD
FT                   TTMYMFLLAAFNVLLSKYASQDDIIVGSPTAGRTHPDLQGVPGMFVNTGALRTAPAGDK
FT                   TFAQFLEEVKTASLQAFEHQSYPLEELIEKLPLTRDTSRSPLFSVMFNMQNMEIPSLRL
FT                   GDLKISSYSMLHHVAKFDLSLEAVEREEDIGLSFDYATALFKDETIRRWSRHFVNIIKA
FT                   AAANPNVRLSDVDLLSSAETAALLEERHMTQITEATFAALFEKQAQQTPDHSAVKAGGN
FT                   LLTYRELDEQANQLAHHLRAQGAGNEDIVAIVMDRSAEVMVSILGVMKAGAAFLPIDPD
FT                   TPGERIRYSLEDSGAKFAVVNERNMTAIGQYEGIIVSLDDGKWRNESKERPSSISGSRN
FT                   LAYVIYTSGTTGKPKGVQIEHRNLTNYVSWFSEEAGLTKRRADGNDKTVLLSSYAFDLG
FT                   YTCMFPVLLGGGELHIVQKETYTAPDEIAHYIKEHGITYIKLTPSLFHTIVNTASFAFD
FT                   ANFESLRLIVLGGEKIIPTDVIAFRKMYGHTEFINHYGPTEATIGAIAGRVDLYEPDAF
FT                   AKRPTIGRPIANAGALVLNEALKLVPPGASGQLYITGQGLARGYLNRPQLTAERFVENP
FT                   YSPGSLMYKTGDVVRRLSDGTLAFIGRADDQVKIRGYRIELGEIETVMLSLSGIQEAVV
FT                   LAVSEGGLQELCAYYTSDQDIEKAELRYQLSLTLPSHMIPAFFVQVDAIPLTANGKTDR
FT                   NALPKPNAAQSGGKALAAPETALEESLCRIWQKTLGIEAIGIDDNFFDLGGHSLKGMML
FT                   IANIQAELEKSVPLKALFEQPTVRQLAAYMEASAVSGGHQVLKPADKQDMYPLSSAQKR
FT                   MYVLNQLDRQTISYNMPSVLLMEGELDIWPARLTPQLVNRHESLRTSFMEANGEPVQRI
FT                   IEKAEVDLHVFEAKEDEADQKIKEFIRPFDLNDAPLIRAALLRIEAKKHLLLLDMHHII
FT                   ADGVSRGIFVKELALLYKGEQLPEPTLHYKDFAVWQNEAEQKERMKEHEAYWMSVLSGE
FT                   LPELDLPLDYARPPVQSFKGDTIRFRTGSETAKAVEKLLAETGTTLHMVLHAVFHVFLS
FT                   KISGQRDIVIGSVTAGRTNADVQDMPGMFVNTLALRMEAKEQQTFAELLELAKQTNLSA
FT                   LEHQEYPFEDLVNQLDLPRDMSRNPLFNVMVTTENPDKEELTLQNLSISPYEAHQGTSK
FT                   FDLTLGGFTDENGIGLQLEYATDLFAKETAEKWSEYVLRLLKAVADNPNQPLSSLLLVT
FT                   ETEKQALLEAWKGKALPVPTDKTVHQLFEETVQRHKDRPAVTYNGQSWTYGELNAKANR
FT                   LARILMDCGISPDDRVGVLTKPSLEMSAAVLGVLKAGAAFVPIDPDYPDQRIEYILQDS
FT                   GAKLLLKQEGISVPDSYTGDVILLDGSRTILSLPLDENDEGNPETAVTAENLAYMIYTS
FT                   GTTGQPKGVMVEDHALVNLCFWDHDAFSMTAEDRSAKYAGFGFDASIWEMFPTWTIGAE
FT                   LHVIDEAIRLDIVRLNDYFETNGVTITFLPTQLAEQFMELENTSLRVLLTGGDKLKRAV
FT                   KKPYTLVNNYGPTENTVVATSAEIHPEEGSLSIGRAIANTRVYILGEGNQVQPEGVAGE
FT                   LCVAGRGLARGYLNREDETAKRFVADPFVPGERMYRTGDLVKWVNGGIEYIGRIDQQVK
FT                   VRGYRIELSEIEVQLAQLSEVEDRAVTRVKDKGGNTAIAAYVTPETADIEALKSTLKET
FT                   LPDYMIPAFWVTLNELPVTANGKVDRKALPEPDIEAGSGEYKAPTTDMEELLAGIWQDV
FT                   LGMSEVGVTDNFFSLGGDSIKGIQMASRLNQHGWKLEMKDLFQHPTIEELTQYVERAEG
FT                   KQADQGPVEGEVILTPIQRWFFEKNFTNKHHWNQSVMLHAKKGFDPERVEKTLQALIEH
FT                   HDALRMVYREENGDIVQVYKPIGESKVSFEIVDLYGSDEEMLRSQIKLLANKLQSSLDL
FT                   RNGPLLKAAEYRTEAGDHLLIAVHHLVVDGVSWRILLEDFASGYMQAEKEESLVFPQKT
FT                   NSFKDWAEELAAFSQSAHLLQQAEYWSQIAAEQVSPLPKDCETEQRIVKDTSSVLCELT
FT                   AEDTKHLLTDVHQPYGTEINDILLSALGLTMKEWTKGAKIGINLEGHGREDIIPNVNIS
FT                   RTVGWFTAQYPVVLDISDADASAVIKTVKENLRRIPDKGVGYGILRYFTETAETKGFTP
FT                   EISFNYLGQFDSEVKTDFFEPSAFDMGRQVSGESEALYALSFSGMIRNGRFVLSCSYNE
FT                   KEFERATVEEEMERFKENLLMLIRHCTEKEDKEFTPSDFSAEDLEMDEMGDIFDMLEEN
FT                   LK"
FT   CDS_pept        70105..70245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comS"
FT                   /product="regulation of genetic competence"
FT                   /db_xref="GOA:P80355"
FT                   /db_xref="InterPro:IPR035139"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80355"
FT                   /protein_id="BAA08984.1"
FT                   /translation="MNRSGKHLISSIILYPRPSGECISSISLDKQTQATTSPLYFCWRE
FT                   K"
FT   CDS_pept        77769..81593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srfAC"
FT                   /product="surfactin production"
FT                   /db_xref="GOA:Q08787"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="PDB:1JMK"
FT                   /db_xref="PDB:2VSQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08787"
FT                   /protein_id="BAA08985.1"
FT                   /translation="MSQFSKDQVQDMYYLSPMQEGMLFHPILNPGQTFYLEQITMKVKG
FT                   SLNIKCLEESMNVIMDRYDVFRTVFIHEKVKRPVQVVLKKRQFHIEEIDLTHLTGSEQT
FT                   AKINEYKEQDKIRGFDLTRDIPMRAAIFKKAEESFEWVWSYHHIILDGWCFGIVVQDLF
FT                   KVYNALREQKPYSLPPVKPYKDYIKWLEKQDKQASLRYWREYLEGFEGQTTFAEQRKKQ
FT                   KDGYEPKELLFSLSEAETKAFTELAKSQHTTLSTALQAVWSVLISRYQQSGDLAFGTVV
FT                   SGRPAEIKGVEHMVGLFINVVPRRVKLSEGITFNGLLKRLQEQSLQSEPHQYVPLYDIQ
FT                   SQADQPKLIDHIIVFENYPLQDAKNEESSENGFDMVDVHVFEKSNYDLNLMASPGDEML
FT                   IKLAYNENVFDEAFILRLKSQLLTAIQQLIQNPDQPVSTINLVDDREREFLLTGLNPPA
FT                   QAHETKPLTYWFKEAVNANPDAPALTYSGQTLSYRELDEEANRIARRLQKHGAGKGSVV
FT                   ALYTKRSLELVIGILGVLKAGAAYLPVDPKLPEDRISYMLADSAAACLLTHQEMKEQAA
FT                   ELPYTGTTLFIDDQTRFEEQASDPATAIDPNDPAYIMYTSGTTGKPKGNITTHANIQGL
FT                   VKHVDYMAFSDQDTFLSVSNYAFDAFTFDFYASMLNAARLIIADEHTLLDTERLTDLIL
FT                   QENVNVMFATTALFNLLTDAGEDWMKGLRCILFGGERASVPHVRKALRIMGPGKLINCY
FT                   GPTEGTVFATAHVVHDLPDSISSLPIGKPISNASVYILNEQSQLQPFGAVGELCISGMG
FT                   VSKGYVNRADLTKEKFIENPFKPGETLYRTGDLARWLPDGTIEYAGRIDDQVKIRGHRI
FT                   ELEEIEKQLQEYPGVKDAVVVADRHESGDASINAYLVNRTQLSAEDVKAHLKKQLPAYM
FT                   VPQTFTFLDELPLTTNGKVNKRLLPKPDQDQLAEEWIGPRNEMEETIAQIWSEVLGRKQ
FT                   IGIHDDFFALGGHSLKAMTAVPHQQELGIDLPVKLLFEAPTIAGISAYLKNGGSDGLQD
FT                   VTIMNQDQEQIIFAFPPVLGYGLMYQNLSSRLPSYKLCAFDFIEEEDRLDRYADLIQKL
FT                   QPEGPLTLFGYSAGCSLAFEAAKKLEEQGRIVQRIIMVDSYKKQGVSDLDGRTVESDVE
FT                   ALMNVNRDNEALNSEAVKHGLKQKTHAFYSYYVNLISTGQVKADIDLLTSGADFDMPEW
FT                   LASWEEATTGVYRVKRGFGTHAEMLQGETLDRNAEILLEFLNTQTVTVS"
FT   CDS_pept        81622..82350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srfAD"
FT                   /product="surfactin production"
FT                   /db_xref="GOA:Q08788"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:2K2Q"
FT                   /db_xref="PDB:2RON"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08788"
FT                   /protein_id="BAA08986.1"
FT                   /translation="MSQLFKSFDASEKTQLICFPFAGGYSASFRPLHAFLQGECEMLAA
FT                   EPPGHGTNQTSAIEDLEELTDLYKQELNLRPDRPFVLFGHSMGGMITFRLAQKLEREGI
FT                   FPQAVIISAIQPPHIQRKKVSHLPDDQFLDHIIQLGGMPAELVENKEVMSFFLPSFRSD
FT                   YRALEQFELYDLAQIQSPVHVFNGLDDKKCIRDAEGWKKWAKDITFHQFDGGHMFLLSQ
FT                   TEEVAERIFAILNQHPIIQP"
FT   CDS_pept        82451..83680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycxA"
FT                   /note="homologue of KO5B2.5 gene product of C. elegans"
FT                   /db_xref="GOA:Q08791"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08791"
FT                   /protein_id="BAA08987.1"
FT                   /translation="MRTSPRSKWFVFLFTFVFAIGMNSFRNSFQFFMLPMADAFHADRS
FT                   LISVSVSIFMITTGIVQFFVGFFIDRFSVRKIMALGAVCISASFLVLPYSPNVHVFSAI
FT                   YGVLGGIGYSCAVGVTTQYFISCWFDTHKGLALAILTNANSAGLVVSPPPIWAAAPYHA
FT                   GWQSTYTILGIVMAAVLVPLLVFGMKHPPHAQAETVKKSYDWRGFWNVMKQSRLIHILY
FT                   FGVFTCGFTMGIIDAHLVPILKDAHVSHVNGMMAAFGAFIIIGGLLAGWLSDLLGSRSV
FT                   MLSILFFIRLLSLICLLIPILGIHHSDLWYFGFILLFGLSYTGVIPLTAASISESYQTG
FT                   LIGSLLGINFFIHQVAGALSVYAGGLFFDMTHGYLLIVAVCIVFVGLSAVIELVPFLDK
FT                   QKAKETHHSI"
FT   CDS_pept        complement(83695..84252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycxB"
FT                   /db_xref="GOA:Q08793"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08793"
FT                   /protein_id="BAA08988.1"
FT                   /translation="MIQYASESINLPGEITFKDVREIFFYQIAKISCFYFLLFCAIFAA
FT                   VNFINGWPRIVYGSDALNLFMNSMLIIVMSVLFTLLLLLLLYVKFSRAYKKNERMKSKR
FT                   TYTLNQEGIRICSKKYDLIFNWDEITAVFEYKNIFRVNTSSGQYIAIPKHFFHSEEEMN
FT                   RFKEIILKNTETKKLKFKKDQH"
FT   CDS_pept        complement(84306..85244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycxC"
FT                   /note="homologue of hypothetical protein of Buchnera
FT                   aphidicola"
FT                   /db_xref="GOA:Q08794"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08794"
FT                   /protein_id="BAA08989.1"
FT                   /translation="MVKHQQTPAYIAAILYSFIIGLSFLFVKIALQTAEPFDILAHRFT
FT                   IAFAAATVPILFGWVKLSILVKDVIDILPLALLYPALFFSFQAFGLVYSSSSEAGIIQA
FT                   AIPIFTMVFAAYVLKERPTWTQKGFTVLSVAGVMFIFVMKGVDVESASLKGSLLILLSA
FT                   LSSAMYNTAARKMTQRFKLTELTYIMSAIGFVVFNAIALVRHGAAGTVGTYFLPFREPG
FT                   FVLAIVYLGVLSSLVTSFLSNYTLSRIEAFKMSAFNHVSTIVTMIAGFVILNESLAWYH
FT                   LAGAVCIMIGVVGSNINLEKKTKRPGMPAKK"
FT   CDS_pept        85368..86702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycxD"
FT                   /note="homologue of mocR gene product of Rhizobium
FT                   meliloti"
FT                   /db_xref="GOA:Q08792"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08792"
FT                   /protein_id="BAA08990.1"
FT                   /translation="MEKYMSLLTRIEEMMQSTSYQEGDRLPSIRQLSARYQVSKSTVIR
FT                   ALQELEKRHLIYSVPKSGYYIVKKSGKSKSGQPGPIDFATSAPDPDVFPYLDFQHCINK
FT                   AIDTYKNDLFIYGTPKGLPSLIRVLRKLLATQQVFADERHIFITSGVQQALSLLCAMPF
FT                   PNGKEKIAIEQPGYHLMVEQLETLGIPAIGVKRTEEGLDIAKVERLFQTESIKFFYTMP
FT                   RFHNPLGCSLSERDKQELVRLAEAYDVYLVEDDYLGDLEENKKADPLYAYDLSSHVIYL
FT                   KSFSKMMFPGLRVGAAVLPEALTDTFYAYKKLNDIDCSMISQAALEIYLKSGMYGRHKE
FT                   KIRDSYKERSLRLHQAIRTHRQLGSGRFTFSSGQAPCMHTHLVLPQDLPASRVIHRLEK
FT                   QGVLLEAIDRHYLSDYPKENLLKINISNVKTEDIERGVKLLMSHL"
FT   CDS_pept        complement(86875..87372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfp"
FT                   /product="surfactin production"
FT                   /db_xref="GOA:P94401"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:P94401"
FT                   /protein_id="BAA08991.1"
FT                   /translation="MKIYGIYMDRPLSQEENERFMTFISPEKREKCRRFYHKEDAHRTL
FT                   LGDVLVRSVISRQYQLDKSDIRFSTQEYGKPCIPDLPDAHFNISHSGRWVIGAFDSQPI
FT                   GIDIEKTKPISLEMPKRFFSKTEYSDLLAKDKDEQTDYFYHLWSMKESFIKQGRQRLIA
FT                   SA"
FT   CDS_pept        complement(88442..89185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckI"
FT                   /note="homologue of glutamine transport ATP-binding protein
FT                   GlnQ of E. coli"
FT                   /db_xref="GOA:P39456"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39456"
FT                   /protein_id="BAA08992.1"
FT                   /translation="MLTVKGLNKSFGENEILKKIDMKIEKGKVIAILGPSGSGKTTLLR
FT                   CLNALEIPNRGELAFDDFSIDFSKKVKQADILKLRRKSPMVFQAYHLFPHRTALENVME
FT                   GPVQVQKRNKEEVRKEAIQLLDKVGLKDKMDLYPFQLSGGQQQRVGIARALAIQPELML
FT                   FDEPTSALDPELVGEVLKVIKDLANEGWTMVVVTHEIKFAQEVADEVIFIDGGVIVEQG
FT                   PPEQIFSAPKEERTQRFLNRILNPL"
FT   CDS_pept        complement(89199..89903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckJ"
FT                   /note="homologue of glutamine transport system permerase
FT                   protein GlnP of E. coli"
FT                   /db_xref="GOA:P42200"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42200"
FT                   /protein_id="BAA08993.1"
FT                   /translation="MFLNNLPALTLGTAIPWDLVQQSFWPILSGGIYYTIPLTILSFIF
FT                   GMILALITALARMSKVRPLRWVFSVYVSAIRGTPLLVQLFIIFYLFPAFNVTLDPFPSA
FT                   VIAFSLNVGAYASEIIRASILSVPKGQWEAGYTIGMTHQKTLFRVILPQAFRVSIPPLS
FT                   NTFISLIKDTSLASQILVAELFRKAQEIGARNLDQILVIYIEAAFIYWIICFLLSLVQH
FT                   VIERRLDRYVAK"
FT   CDS_pept        complement(89890..90696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckK"
FT                   /note="homologue of glutamine-binding periplasmic protein
FT                   precursor GlnH of E. coli"
FT                   /db_xref="GOA:P42199"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42199"
FT                   /protein_id="BAA08994.1"
FT                   /translation="MKKALLALFMVVSIAALAACGAGNDNQSKDNAKDGDLWASIKKKG
FT                   VLTVGTEGTYEPFTYHDKDTDKLTGYDVEVITEVAKRLGLKVDFKETQWGSMFAGLNSK
FT                   RFDVVANQVGKTDREDKYDFSDKYTTSRAVVVTKKDNNDIKSEADVKGKTSAQSLTSNY
FT                   NKLATNAGAKVEGVEGMAQALQMIQQARVDMTYNDKLAVLNYLKTSGNKNVKIAFETGE
FT                   PQSTYFTFRKGSGEVVDQVNKALKEMKEDGTLSKISKKWFGEDVSK"
FT   CDS_pept        complement(90811..91683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclA"
FT                   /note="homologue of als operon regulatory protein AlsR of
FT                   B. subtilis"
FT                   /db_xref="GOA:P94403"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94403"
FT                   /protein_id="BAA08995.1"
FT                   /translation="MDIRQLRYFITIAQEQKITSAAKKLHMAQPPLSRQLKQLEDELGV
FT                   VLFDRNKKKQMTLTYEGAVFLKRAKEILHRFEDAVIEVQELKEEVAGTLAVGSTIYCAA
FT                   LMLEKVTQIKERYPHLTFNIWENEPATLLELLESRQIDAAVTTTLIKSDTVQFKQLDDI
FT                   PCVLVLSDEAGYPCGDTIKMVDIPSFPLILLRPVNGKGVYNQVMNEFHRLNLEPRIVCE
FT                   CHDSATLLSLVSSGFGASILPVTMIPVHMRNHVHTVHIENNPFIMTPAVMWRTDSYLPK
FT                   PAQQFLDLF"
FT   CDS_pept        91773..92387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclB"
FT                   /note="homologue of phenylacrylic acid decarboxylase PAD1
FT                   of yeast"
FT                   /db_xref="GOA:P94404"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR032901"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94404"
FT                   /protein_id="BAA08996.1"
FT                   /translation="MKAEFKRKGGGKVKLVVGMTGATGAIFGVRLLQWLKAAGVETHLV
FT                   VSPWANVTIKHETGYTLQEVEQLATYTYSHKDQAAAISSGSFDTDGMIVAPCSMKSLAS
FT                   IRTGMADNLLTRAADVMLKERKKLVLLTRETPLNQIHLENMLALTKMGTIILPPMPAFY
FT                   NRPRSLEEMVDHIVFRTLDQFGIRLPEAKRWNGIEKQKGGA"
FT   CDS_pept        92390..93811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclC"
FT                   /note="homologue of hypothetical protein of E. coli"
FT                   /db_xref="GOA:P94405"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR032902"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94405"
FT                   /protein_id="BAA08997.1"
FT                   /translation="MAYQDFREFLAALEKEGQLLTVNEEVKPEPDLGASARAASNLGDK
FT                   SPALLFNNIYGYHNARIAMNVIGSWPNHAMMLGMPKDTPVKEQFFEFAKRYDQFPMPVK
FT                   REETAPFHENEITEDINLFDILPLFRINQGDGGYYLDKACVISRDLEDPDNFGKQNVGI
FT                   YRMQVKGKDRLGIQPVPQHDIAIHLRQAEERGINLPVTIALGCEPVITTAASTPLLYDQ
FT                   SEYEMAGAIQGEPYRIVKSKLSDLDVPWGAEVVLEGEIIAGEREYEGPFGEFTGHYSGG
FT                   RSMPIIKIKRVYHRNNPIFEHLYLGMPWTECDYMIGINTCVPLYQQLKEAYPNEIVAVN
FT                   AMYTHGLIAIVSTKTRYGGFAKAVGMRALTTPHGLGYCKMVIVVDEDVDPFNLPQVMWA
FT                   LSTKMHPKHDAVIIPDLSVLPLDPGSNPSGITHKMILDATTPVAPETRGHYSQPLDSPL
FT                   TTKEWEQKLMDLMNK"
FT   CDS_pept        93828..94517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclD"
FT                   /db_xref="GOA:C0H3U9"
FT                   /db_xref="GOA:C0SPB5"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H3U9"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0SPB5"
FT                   /protein_id="BAA08998.1"
FT                   /translation="MHTCPRCDSKKGEVMSKSPVEGAWEVYQCQTCFFTWRSCEPESIT
FT                   NPEKYNPAFKIDPKETETAIEVPAVPEPKGLIRVNCMSDRLFELLDGSCLNEKQHEAFV
FT                   LQTVSEDGWPHAAMISAGEIIALSRTDIRIALWKNTMTSANILRTGKAQFTAWWKGAAY
FT                   YVKLECAPLPPLKDAEYERDRFSCRIVSVKEDVAKYADLTSGVRIQLHSPEEVLSRWKK
FT                   TLEDLKR"
FT   CDS_pept        94583..95428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclE"
FT                   /db_xref="GOA:P94407"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94407"
FT                   /protein_id="BAA08999.1"
FT                   /translation="MERAGICHSDGFDLAYRIEGEGAPILVIGSAAYYPRLFSSDIKQK
FT                   YQWVFVDHRGFAKPKRELRAEDSRLDAVLADIERMRTFLQLEDVTTLGHSGHAFMALEY
FT                   ARTYPKQVRKVALFNTAPDNSEERQRKSESFFMETASLERKKRFEKDIENLPQDIDKDP
FT                   ERRFVHMCIRAEAKSFYQERPHAAALWDGVFTNMPIIDELWGNTFARIDLLQRLADVRM
FT                   PVYIGLGRYDYLVAPVSLWDAVDGLYPHVDKVIFEKSGHQPMLEEPEAFDQSFRKWLDQ
FT                   "
FT   CDS_pept        complement(95468..96946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclF"
FT                   /note="homologue of Di-tripeptide transporter Dtp of L.
FT                   lactis"
FT                   /db_xref="GOA:P94408"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94408"
FT                   /protein_id="BAA09000.1"
FT                   /translation="MASIDNESIIKSVPQKGFFGHPRGLFTLFFTEFWERFSYYGMRAI
FT                   LLYYLYTETVNGGLGFDKGTAVAIMSIYGSLVYMSTIIGGWLADRVFGTANTVFYGGIF
FT                   IMFGHIALAYPGSSIAFYISMVLIIVGTGLLKPNVSSVVGDLYTKEDPRRDSGFSIFYM
FT                   GINLGGLLAPLIVGTLGQKYNYHLGFGAAAVGMLLGLIVFPLTRKKNLGLAGSNVPNPL
FT                   SKKSAIGTGIGVIIVAIAVIISVQTGVLTIKRFIDLVSILGILIPVIYFIIMFTSKKAD
FT                   KTEKSRLAAYVPLFIGAVMFWAIQEQGATILAVYADERIRLSLGGFELQSSWFQSLNPL
FT                   FVVIFAPIFAWLWMKLGKRQPSTPVKFSIGIILAGLSFIIMVFPAMQGKEALVSPLWLV
FT                   LSFLLVVLGELCLSPVGLSVTTKLAPAAFSAQTMSMWFLTNAAAQAINAQVAGLFDKIP
FT                   ETMYFGTIGLISIVLGGILLLLSPVIKRAMKGVL"
FT   CDS_pept        97226..98980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclG"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024535"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94409"
FT                   /protein_id="BAA09001.1"
FT                   /translation="MAEFILNAADFGVPRDGKTDSTERINQCLSTAVSKGYHTVWFPKG
FT                   TYLIDATLGGDLNQRFRNAGIIVPGNLEIMMDPECIMKVIPNSSWGYSAFYVGKQENIT
FT                   ISGGQIIGERDEHTYASAGIRSTHEWGFGICIEGCSNVVIDDVKISDFTGDGIIVSPRG
FT                   LKTNQDYRTSEQIIIRRCEVRRSRRNNISITGCDMVTVEECLIEDAGTGNGTAPKFGID
FT                   IEGYGEGDVDYEEPINVSIRNNHFVGNVSSSVTNFNGYGILIEGNHSDNTISYGYGTQT
FT                   VIKGNILRRPEDAAAAPRVGITGLGVSQGKETSDAVIAGNLITGFSTGIDVRGKSVLVT
FT                   NNKISNFENTGILVYQSSDVKVDGNQIQNGLSETRRSIGLRAVLSDDIAFLNNCLIQVV
FT                   DGVNVSGGNMIIKDNLLRKFSRGIWIAQGNAVIEGNTLNPDAFEAVPESYSVSVTNNAG
FT                   AIIKNNTFKEFKNYPIYCSTSAKTSIIGNHLERSPLLVTIYISAGVHEIFDNTISVNRT
FT                   AGNPIVIYLNGSAGSIISGNTINNLSAGTATAIQTNTSTNSKIIGNRIFKGTINKHSSD
FT                   TIDGNMIV"
FT   CDS_pept        99343..100977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKA"
FT                   /product="spore germination protein GerKA"
FT                   /db_xref="GOA:P49939"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49939"
FT                   /protein_id="BAA09002.1"
FT                   /translation="MPLFSKRKNNTDSKDKQNTDERNQEQQQEKERPVLISPSLAKNIA
FT                   ETKKEVGSSSDVIIREIKIGEQDHVHLAVIYISGLVDNNTIHESLIDPLVQDESIQNTH
FT                   AIQQILEKTLPLGGVKAEKSWDKLFSELMLGNALIFADGHDEALICSTQGGEQRSIQEP
FT                   STQVSFRGPRQGFTESLQTNISMIRRYIKNPNLWVEKMKKGSVTNTDIALMYIQGICDE
FT                   KVLKEVKQRLEKIDIDSILESGYIEQLIEDETFTTFPTMYHTERPDVVAGNLLEGRFAI
FT                   IVDGTPFVLIAPALFVQFFQSVEDYYSRFDIATSIRILRVLVFFISLVAPAVYVAATTF
FT                   HQEMIPTQLLVVIAAQREIVPFPAVVEALTMEVAFEILREAGVRLPRVVGSAVSIVGAL
FT                   VIGQAAVQAGIVSPAMVIIVALTAIASFATPAFAMAISARLIRFIFIIASAVMGFYGLI
FT                   LGIIMMFVHLCSLRSFGVPYMSPLAPFSSQGVKDALFRVPWWADEKRPESVSKEDKVRQ
FT                   GKDQRPEPAASRGMVNKDLEEGDQNGT"
FT   CDS_pept        100967..102190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKC"
FT                   /product="spore germination protein GerKC"
FT                   /db_xref="GOA:P49941"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49941"
FT                   /protein_id="BAA09003.1"
FT                   /translation="MVRKCLLAVLMLLSVIVLPGCWDKRELTDLAIISAIGIDRTNDSN
FT                   YVLHLQIINPGNVAGGLQGGGAGDRPPVSVYSIEGNNITEALRKASMKVSRRLYFAHTN
FT                   LVVINEKLAKEEGLDFVLDNLDRDTEFRTTATFVVAHKTKAENIVKILTPIDKIPSNKV
FT                   NKTLDFTEAQYGRVVKINIQDVLKTLAANTMAPVIPGYMMIGDDKKGVSMENTQATDPK
FT                   AILQADGLAVFDKAGYLKYWLEDDESVGAVWLMNKIQHTFINADWGKTKDAVSLQVTHQ
FT                   DTKLVPKMRNGRPYIHVKVSVEGIIDAVKYPFQLSDPKVLAAIEKALNKELEKEISHTV
FT                   KKIKKNKIDFIGFGDTIYRKYPEQWEKMKDTWDKEYLPELPIDVKAETYIRRTGLRNNP
FT                   IKHQFKDD"
FT   CDS_pept        102215..103336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKB"
FT                   /product="spore germination protein GerKB"
FT                   /db_xref="GOA:P49940"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49940"
FT                   /protein_id="BAA09004.1"
FT                   /translation="MEKARISIRQLFVMIIIFELGSSLLITPGSMAGRDAWIAVLLGCA
FT                   IGLFLFYLYQGIYQCYPNSSPKEYMDDMLGTKLSWLFSFLYILYFAYIAARVLRDFGEM
FT                   LLTFAYHDTPIIIVNALLMVVSIYAVRKGIEVLARAAELLFGAMYLLGAIGLVLIIVSG
FT                   TIDPHNLKPVLANGISPVLHSVFTQTMYVPFGEVVLFVMIFPNLNDRKDVKKMGMIAMA
FT                   ISGLIVALTVAINISVLDVDLTLRSQFPLLSTIQTIKVEEFLDRLDVFFMLALIIGGFF
FT                   KVSLYLYATVVGTSTLFKEKNPSQLAYPMGLGILILSITIATNFSEHLNEGLNVVPLYI
FT                   HLPFQLLFPLFLFIVAVWKKKRREKSKGEEAKK"
FT   CDS_pept        complement(103441..104121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclH"
FT                   /note="homologue of hypothetical protein in a rapamycin
FT                   synthesis gene cluster of Streptomyces hygroscopicus"
FT                   /db_xref="GOA:P94411"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94411"
FT                   /protein_id="BAA09005.1"
FT                   /translation="MSLLQFQQVGYWYKNKSQPLFQDINISFQKGKFYTIVGTSGTGKT
FT                   TFLSLAGGLDAPKEGNILYDGKAVSKIGLTNFRNQYVSIVFQAYNLLPYMTALQNVTTA
FT                   MEITGSKEKNKESYALDMLQKVGINEKQARQKVLTLSGGQQQRVSITRAFCCDTDLIVA
FT                   DEPTGNLDEDTSKEIVRLFQDLAHKEDKCVIMVTHDEQIAKVSDINIRLSRGSFTVKEN
FT                   VAVV"
FT   CDS_pept        complement(104137..105597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclI"
FT                   /note="homologue of hypothetical protein in a rapamycin
FT                   synthesis gene cluster of Streptomyces hygroscopicus"
FT                   /db_xref="GOA:P94412"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94412"
FT                   /protein_id="BAA09006.1"
FT                   /translation="MNFIKRAFWNMKAKKGKTLLQLFVFTVICVFVLSGLAIQSAAQKS
FT                   SELARQELGGSVTLQVDRQKQMEKQQDSGEKRTFESTPIKVSDANKLAALDHVKSYNYT
FT                   TSASANAGNFDAIESSSSSDSSSSSSSSNAKNSQGGGQGGPQMVQADLSIEGVISTALV
FT                   DDFSDGDSKITDGRAITKSDVGKKVTVINETLAEENDLSVGDSITIESATDEDTTVKLK
FT                   IVGIYKTTSSGDDQAQNFSFLNPYNKLYTPYTATAALKGDDYKNTIDSAVYYMDDAKNM
FT                   DTFVKAAKKTSIDFDTYTLNTNDQLYQQMVGPIENVASFSKNVVYLVSVAGAVILGLIV
FT                   MMSIRERKYEMGVLMAIGEKRWKLIGQFLTEILIVAVIAIGLASVTGNLVANQLGNQLL
FT                   SQQISSSTDSTQTASGQMPGGGGGMGGKMFGHSSSNVDVIDSLNVAVSMNDMLILGGIG
FT                   ILIAIIATLLPSISVLRLHPKTILTKQE"
FT   CDS_pept        105810..106493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclJ"
FT                   /note="homologue of alkaline phosphatase synthesis
FT                   transcriptional regulatory protein PhoP of B. subtilis"
FT                   /db_xref="GOA:P94413"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94413"
FT                   /protein_id="BAA09007.1"
FT                   /translation="MKILMIEDNVSVCTMTEMFFFKEGFEAEFVHDGLEGYQRFTEENW
FT                   DLIILDIMLPSMDGVTICRKIRETSTVPIIMLTAKDTESDQVIGFEMGADDYVTKPFSP
FT                   LTLVARIKAVIRRYKATGKAVIDEDMIETECFTINKKTREVLLNGEPVENLTPKEFDLL
FT                   YYLVQNPRQVFSREQLLEQVWGYQFYGDERTVDVHIKRLRKKLASEDKPFLYTVWGVGY
FT                   KFDED"
FT   CDS_pept        106480..107901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclK"
FT                   /note="homologue of alkaline phosphatase synthesis sensor
FT                   protein PhoR of B. subtilis"
FT                   /db_xref="GOA:P94414"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94414"
FT                   /protein_id="BAA09008.1"
FT                   /translation="MMKIKYLYQLLLSHISILILAFVIIISLFSHFVKEFAYQNKVEEL
FT                   TSYAVQIANEFQSGQVDMRRLYPYQDILSTRKTQFIIFNEEQQPYFLPEGFHHPPREQL
FT                   KKSEWNKLKKGQTVTIRADGRFDDEVSLVAQPIFVQNEFKGAVLLISPISGVEQMVNQV
FT                   NLYMFYAVISTLVITILVSWLLSKFHVKRIQKLREATDKVASGDYDIHLENSYGDEIGV
FT                   LASDFNIMAKKLKQSRDEIERLEKRRRQFIADVSHELKTPLTTINGLVEGLNSHTIPED
FT                   KKDKCFSLISEETKRMLRLVKENLDYEKIRSQQITLNKLDVPLIEVFEIVKEHLQQQAE
FT                   EKQNKLMIQVEDHVIVHADYDRFIQILVNITKNSIQFTQNGDIWLRGMEGYKETIIEIE
FT                   DTGIGIPKEDIEHIWERFYKADISRTNTAYGEYGLGLSIVRQLVEMHQGTVEIKSEEGK
FT                   GTKFIIRLPLTAKQQ"
FT   CDS_pept        108064..109212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rapC"
FT                   /product="response-regulator aspartate phosphatase C"
FT                   /db_xref="GOA:P94415"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR040702"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94415"
FT                   /protein_id="BAA09009.1"
FT                   /translation="MKSGVIPSSAVGQKINEWYRYIRTFSVPDAEVLKAEIQQELKHMQ
FT                   HDSNLLLYYSLMEFRHQLMLDYLEPLEKLNIEDQPSLSELSRNIDSNQADLKGLLDYYV
FT                   NFFRGMYEFDKREFISAITYYKQAEKKLSFVADHIERAEFYFKIAEAYYYMKQTYFSLI
FT                   NIKNAYEIYVEQETYNVRIIQCHFVFGVNLMDERNFEQAARHFKLALNMAQAEQKAQLV
FT                   GRAYYNLGLCYYNQDLLDPAIDYFEKAVSTFESSRIVNSLPQAYFLITLIYYKQGKHDK
FT                   ASEYHKRGYEYAKETDDADYAVKFEFLQSLYLDQPNEEGIERCFQYLKNKNMYADIEDL
FT                   ALEVAKYYYEQKWFKLSASYFLQVEEARKQIQRSEGLYEIEI"
FT   CDS_pept        109196..109318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprC"
FT                   /product="phosphatase regulator C"
FT                   /db_xref="GOA:P94416"
FT                   /db_xref="InterPro:IPR025899"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94416"
FT                   /protein_id="BAA09010.1"
FT                   /translation="MKLKSKLFVICLAAAAIFTAAGVSANAEALDFHVTERGMT"
FT   CDS_pept        complement(109856..111220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclM"
FT                   /note="homologue of aspartokinase 2 alpha and beta subunits
FT                   LysC of B. subtilis"
FT                   /db_xref="GOA:P94417"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR035804"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94417"
FT                   /protein_id="BAA09011.1"
FT                   /translation="MKVVKFGGSSLASGAQLDKVFHIVTSDPARKAVVVSAPGKHYAED
FT                   TKVTDLLIACAEQYLATGSAPELAEAVVERYALIANELQLGQSIIEKIRDDLFTLLEGD
FT                   KSNPEQYLDAVKASGEDNNAKLIAAYFRYKGVKAEYVNPKDAGLFVTNEPGNAQVLPES
FT                   YQNLYRLRERDGLIIFPGFFGFSKDGDVITFSRSGSDITGSILANGLQADLYENFTDVD
FT                   AVYSVNPSFVENPKEISELTYREMRELSYAGFSVFHDEALIPAFRAGIPVQIKNTNNPS
FT                   AEGTRVVSKRDNTNGPVVGIASDTGFCSIYISKYLMNREIGFGRRALQILEEHGLTYEH
FT                   VPSGIDDMTIILRQGQMDAATERSVIKRIEEDLHADEVIVEHHLALIMVVGEAMRHNVG
FT                   TTARAAKALSEAQVNIEMINQGSSEVSMMFGVKEAEERKAVQALYQEFFAGVLIS"
FT   CDS_pept        111605..112555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclN"
FT                   /note="homologue of ferric anguibactin transport system
FT                   permerase protein FatD of V. anguillarum"
FT                   /db_xref="GOA:P94418"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94418"
FT                   /protein_id="BAA09012.1"
FT                   /translation="MKLRYLFILLIILAVTSVFIGVEDLSPLDLFDLSKQEASTLFASR
FT                   LPRLISIVIAGLSMSICGLIMQQISRNKFVSPTTAGTMDWARLGILISLLLFTSASPLI
FT                   KMLVAFVFALAGNFLFMKILERIKFNDTIFIPLVGLMLGNIVSSIATFIAYKYDLIQNV
FT                   SSWLQGDFSLVVKGRYELLYLSIPLVIIAYVYADKFTLAGMGESFSVNLGLKYKRVVNI
FT                   GLIIVSLITSLVILTVGMLPFLGLIIPNIVSIYRGDNLKSSLPHTVLLGAVFVLFCDIL
FT                   GRIIIFPYEISIGLMVGIIGSGIFLFMLLRRKAYA"
FT   CDS_pept        112548..113495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclO"
FT                   /note="homologue of ferric anguibactin transport system
FT                   permerase protein FatC of V. anguillarum"
FT                   /db_xref="GOA:P94419"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94419"
FT                   /protein_id="BAA09013.1"
FT                   /translation="MRNQMKIALLVGLAIVCIGLFLFYDLGNWDYTLPRRIKKVAAIVL
FT                   TGGAIAFSTMIFQTITNNRILTPSILGLDSLYMLIQTGIIFLFGSANMVIMNKNINFII
FT                   SVLLMILFSLVLYQIMFKGEGRNIFFLLLIGIVFGTLFSSLSSFMQMLIDPNEFQVVQD
FT                   KMFASFNNINTDLLWLAFIIFLLTGVYVWRFTKFFDVLSLGREHAVNLGIDYDKVVKQM
FT                   LIVVAILVSVSTALVGPIMFLGLLVVNLAREFLKTYKHSYLIAGSVFISIIALVGGQFV
FT                   VEKVFTFSTTLSVIINFAGGIYFIYLLLKENKSW"
FT   CDS_pept        113489..114247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclP"
FT                   /note="homologue of iron dicitrate transport ATP-binding
FT                   protein FecE of E. coli"
FT                   /db_xref="GOA:P94420"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94420"
FT                   /protein_id="BAA09014.1"
FT                   /translation="MVEVRNVSKQYGGKVVLEETSVTIQKGKITSFIGPNGAGKSTLLS
FT                   IMSRLIKKDSGEIYIDGQEIGACDSKELAKKMSILKQANQINIRLTIKDLVSFGRFPYS
FT                   QGRLTEEDWVHINQALSYMKLEDIQDKYLDQLSGGQCQRAFIAMVIAQDTDYIFLDEPL
FT                   NNLDMKHSVEIMKLLKRLVEELGKTIVIVIHDINFASVYSDYIVALKNGRIVKEGPPEE
FT                   MIETSVLEEIYDMTIPIQTIDNQRIGVYFS"
FT   CDS_pept        114269..115222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yclQ"
FT                   /product="ferric anguibactin-binding protein precusor FatB
FT                   of V. anguillarum"
FT                   /db_xref="GOA:P94421"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR033870"
FT                   /db_xref="PDB:3GFV"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94421"
FT                   /protein_id="BAA09015.1"
FT                   /translation="MKKFALLFIALVTAVVISACGNQSTSSKGSDTKKEQITVKHQLDK
FT                   NGTKVPKNPKKVVVFDFGSLDTLDKLGLDDIVAGLPKQVLPKYLSKFKDDKYADVGSLK
FT                   EPDFDKVAELDPDLIIISARQSESYKEFSKIAPTIYLGVDTAKYMESFKSDAETIGKIF
FT                   DKEDKVKDELANIDHSIADVKKTAEKLNKNGLVIMANDGKISAFGPKSRYGLIHDVFGV
FT                   APADQNIKASTHGQSVSYEYISKTNPDYLFVIDRGTAIGETSSTKQVVENDYVKNVNAV
FT                   KNGHVIYLDSATWYLSGGGLESMTQMIKEVKDGLEK"
FT   CDS_pept        complement(115269..116687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnB"
FT                   /note="homologue of multidrug resistance protein B, EmrB,
FT                   of E. coli"
FT                   /db_xref="GOA:P94422"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94422"
FT                   /protein_id="BAA09016.1"
FT                   /translation="MNTSIEQKPFNRSVIVGILLAGAFVAILNQTLLITALPHIMRDFN
FT                   VDANQAQWLTTSFMLTNGILIPITAFLIEKFTSRALLITAMSIFTAGTVVGAFAPNFPV
FT                   LLTARIIQAAGAGIMMPLMQTVFLTIFPIEKRGQAMGMVGLVISFAPAIGPTLSGWAVE
FT                   AFSWRSLFYIILPFAVIDLILASILMKNVTTLRKTQIDILSVILSTFGFGGLLYGFSSV
FT                   GSYGWSSSTVLISLLVGVIALLLFITRQMKLKKPMLEFRVFTFGVFSLTTLLGTLVFAL
FT                   LIGTETILPLYTQNVRDVTAFDTGLMLLPGAVVMGFMSPIIGRIFDRVGGRGLAIAGFC
FT                   IIFLTSLPFMQLTDHTSLAWIVVLYTVRLLGTAMIMMPVTTAGINALPRHLIPHGTAMN
FT                   NTIRQVGGSIGTALLVSVMSNQAAHAGTTNVKHAALHGMNAAFIVAAVIALVGFLLSFT
FT                   LKKPQRPAEQQPAR"
FT   CDS_pept        complement(116707..117585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnC"
FT                   /db_xref="GOA:P94423"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94423"
FT                   /protein_id="BAA09017.1"
FT                   /translation="MLDKKTDILLAARKLFSEKDFTSVSMQAIAEECKMSKASIYKLFQ
FT                   SKEDLLLELLSFNQKQMVAAASRLQENTALTPEERLTQKVKMELEGFRRNQQFFNMLTY
FT                   GNPRLHNDRVKQHIHQTRSTIICWHRDSLIQAYGETILPFVWDLVIILHGMMREFLMLI
FT                   KIEEKPLELDPIAEFIISTLNQIIKNRETRQSLLPPEAIELYIHSASSYKPKDKSVLLS
FT                   ESLKELHKGISSLSAADYDVDELTSAAAMLEEEAKKEEPRAFLLKSLIGYLEQTGVLTQ
FT                   PVSMLKTLLIT"
FT   CDS_pept        complement(117749..118498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnD"
FT                   /note="homologue of NADPH-flavin oxidoreductase Frp of V.
FT                   harveyi"
FT                   /db_xref="GOA:P94424"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="PDB:1ZCH"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94424"
FT                   /protein_id="BAA09018.1"
FT                   /translation="MNEVIKSLTDHRSIRSYTDEPVAQEQLDQIIEAVQSAPSSINGQQ
FT                   VTVITVQDKERKKKISELAGGQPWIDQAPVFLLFCADFNRAKIALEDLHDFKMEITNGL
FT                   ESVLVGAVDAGIALGTATAAAESLGLGTVPIGAVRGNPQELIELLELPKYVFPLSGLVI
FT                   GHPADRSAKKPRLPQEAVNHQETYLNQDELTSHIQAYDEQMSEYMNKRTNGKETRNWSQ
FT                   SIASYYERLYYPHIREMLEKQGFKVEK"
FT   CDS_pept        complement(118515..118802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnE"
FT                   /db_xref="GOA:P94425"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94425"
FT                   /protein_id="BAA09019.1"
FT                   /translation="MIVLQAYIKVKPEKREEFLSEAQSLVQHSRAEEGNAQYDLFEKVG
FT                   EENTFVMLEKWKDEAAMKFHNETAHFQGFVAKGKELLSAPLDVVRTELSE"
FT   CDS_pept        complement(119258..120697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnF"
FT                   /note="homologue of regulatory protein MocR of R. meliloti"
FT                   /db_xref="GOA:P94426"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:4MGR"
FT                   /db_xref="PDB:4N0B"
FT                   /db_xref="PDB:4TV7"
FT                   /db_xref="PDB:5T4J"
FT                   /db_xref="PDB:5T4K"
FT                   /db_xref="PDB:5X03"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94426"
FT                   /protein_id="BAA09020.1"
FT                   /translation="MDITITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKREL
FT                   AENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEELDMFSAEEHPPFALPDDLKEIHI
FT                   DQSDWISFSHMSSDTDHFPIKSWFRCEQKAASRSYRTLGDMSHPQGIYEVRAAITRLIS
FT                   LTRGVKCRPEQMIIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTI
FT                   MLDEKGMSIAEITRQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDY
FT                   DSEFTYDVDSIPALQSLDRFQNVIYMGTFSKSLLPGLRISYMVLPPELLRAYKQRGYDL
FT                   QTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGL
FT                   HFVTEFDTRRTEQDILSHAAGLQLEIFGMSRFNLKENKRQTGRPALIIGFARLKEEDIQ
FT                   EGVQRLFKAVYGHKKIPVTGD"
FT   CDS_pept        120804..122114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnG"
FT                   /note="homologue of 4-aminobutyrate aminotransferase GabT
FT                   of E. coli"
FT                   /db_xref="GOA:P94427"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94427"
FT                   /protein_id="BAA09021.1"
FT                   /translation="MSQTTASITTAQWQQKRDQFVSKGVSNGNRSLAVKGEGAELYDLD
FT                   GRRFIDFAGAIGTLNVGHSHPKVVEAVKRQAEELIHPGFNVMMYPTYIELAEKLCGIAP
FT                   GSHEKKAIFLNSGAEAVENAVKIARKYTKRQGVVSFTRGFHGRTNMTMSMTSKVKPYKF
FT                   GFGPFAPEVYQAPFPYYYQKPAGMSDESYDDMVIQAFNDFFIASVAPETVACVVMEPVQ
FT                   GEGGFIIPSKRFVQHVASFCKEHGIVFVADEIQTGFARTGTYFAIEHFDVVPDLITVSK
FT                   SLAAGLPLSGVIGRAEMLDAAAPGELGGTYAGSPLGCAAALAVLDIIEEEGLNERSEEI
FT                   GKIIEDKAYEWKQEFPFIGDIRRLGAMAAIEIVKDPDTREPDKTKAAAIAAYANQNGLL
FT                   LLTAGINGNIIRFLTPLVISDSLLNEGLSILEAGLRA"
FT   CDS_pept        122183..123571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnH"
FT                   /note="homologue of succinate semialdehyde dehydrogenase
FT                   GabD of E. coli"
FT                   /db_xref="GOA:P94428"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94428"
FT                   /protein_id="BAA09022.1"
FT                   /translation="MPDQLTVYNPATGEEIKTIPQQSATEVEEAIERSHQAFKTWSKTS
FT                   ANERTSLLKKWYELIVEHKEELADLITKENGKPYQEAVGEVLYGAGYIEWFAEEAKRVY
FT                   GRTVPAPTTGKRIVVTRQPVGPVAAITPWNFPNAMITRKAAPALAAGCTFIIKPAPDTP
FT                   LSAYELARLAYEAGIPKDVLQVVIGDGEEIGNVFTSSPKIRKITFTGSTPVGKILMKNS
FT                   ADTVKHVSMELGGHAPLIVDEDADIDLAVEQAMASKYRNAGQTCVCANRLIVHESIKDE
FT                   FAAKLSEQVSKLKVGNGLEEGVNVGPIINKRGFEKIVSQIDDAVEKGAKVIAGGTYDRN
FT                   DDKGCYFVNPTVLTDVDTSMNIMHEETFGPVAPIVTFSDIDEAIQLANDTPYGLAAYFF
FT                   TENYRRGIYISENLEYGIIGWNDGGPSAVQAPFGGMKESGIGREGGSEGIEPYLETKYL
FT                   SIGL"
FT   CDS_pept        123694..124557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycxE"
FT                   /note="homologues to hypothetical 30.5 kDa protein gdh1 5'
FT                   region of B. megateruim"
FT                   /db_xref="GOA:P40420"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40420"
FT                   /protein_id="BAA09023.1"
FT                   /translation="MDLLLALLPALFWGSIVLFNVKLGGGPYSQTLGTTIGALIVSIVI
FT                   YFFVQPVLSLRIFIVGIVSGLFWSLGQANQLKSIQLMGVSKTMPISTGMQLVSTSLFGV
FT                   IVFREWSTPIAITLGVLALIFIIVGIILTSLEDKNDKKEGEPSNLKKGILILLVSTLGY
FT                   LVYVVVARLFNVSGWSALLPQAIGMVVGGLVLTYRHKPFNKYAIRNILPGLIWAGGNMF
FT                   LFISQPRVGVATSFSLSQMGIVISTLGGIFILREKKTKRQLIAIAIGIILIIAAAVFLG
FT                   IAKTNS"
FT   CDS_pept        124577..125362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdh"
FT                   /product="glucose dehydrogenase"
FT                   /db_xref="GOA:P12310"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12310"
FT                   /protein_id="BAA09024.1"
FT                   /translation="MYPDLKGKVVAITGAASGLGKAMAIRFGKEQAKVVINYYSNKQDP
FT                   NEVKEEVIKAGGEAVVVQGDVTKEEDVKNIVQTAIKEFGTLDIMINNAGLENPVPSHEM
FT                   PLKDWDKVIGTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEVIPWPLFVHYAASKG
FT                   GIKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFADPKQKADVESMIPMGYIGEPE
FT                   EIAAVAAWLASKEASYVTGITLFADGGMTQYPSFQAGRG"
FT   CDS_pept        complement(125407..126021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnI"
FT                   /db_xref="GOA:P94431"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94431"
FT                   /protein_id="BAA09025.1"
FT                   /translation="MLKKIALTLCPAIVGSLLFFTAPASAHVSVKPAESAAGSWETYTM
FT                   KVPSEKNLPTTKVVLKMPKDVEFQQYEPIPGWKVSTQKHDDKSVSVTWEATDGGIQEGQ
FT                   FQQFTFVAKNPDKAEEAAWDAYQYYKDGSIVEWTGDEDADTPHSITNITSAKQVTDEHG
FT                   ATKTEDDSENSGSSALDITAMVLSAAAIILSVAALVKKKRA"
FT   CDS_pept        complement(126034..127659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnJ"
FT                   /note="homologue of copper export protein PcoD of E. coli"
FT                   /db_xref="GOA:C0SP95"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032693"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0SP95"
FT                   /protein_id="BAA09026.1"
FT                   /translation="MKRNRWWIILLLFLVFLPKTSFAHAYIVKSSPGENSELKSAPAQV
FT                   EIEFNEPVEEGFHYIKVYNSNGDRLDTDKTEIKKDNHHIMTVKLKKNLPKDVYRAEWNA
FT                   VSADGHPVSGVIPFSIGKADGGFSSQKAADSALNPGTAADRAILYTALSLFIGTVFFHL
FT                   FWYKGKSEQLVKRTRRILTGSIAALGLALLLQLPIQTKANAGGGWGSAFQPGYIRETLF
FT                   ETAGGSIWIIQAALFVLLALSVIPAIRKNRFSSFGYWTAPLIFFFGLLLAKAFTGHAAV
FT                   VEEKTVGILMDFLHLTSASIWVGGIAALVLLLSKEWRQPDKTLAWETVRRFSPWALTAV
FT                   GVILFSGLLNGFFIIRSMDSLFHTAYGQALLVKSGLFVFMLVLGAIHFLLTRKQRRTGI
FT                   SRTLKAEWAIGIAVLITAAVFTSLPSPPEPAPEPFYQTKAIENGQSVSLSISPNQPGKN
FT                   VFELRVTDHNGDPVKNIQQITLTVYKTGLSGSENKSTFTLKEKTKGVFQDQNLSINEKG
FT                   NWKIKVHGLTGDFNEINIMFTKTN"
FT   CDS_pept        complement(127694..128266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnK"
FT                   /db_xref="GOA:P94433"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94433"
FT                   /protein_id="BAA09027.1"
FT                   /translation="MLPINRQQHILKWLKEEGSLRISDISARFGVSEMTVYRDVNQLVQ
FT                   SNQVIKTAGGITLPVRTPQTDHMCSYCLKPVNQAHSVQLITVNQDIEQLCCAHCAFLRY
FT                   ADKTEEVSHLICRDFLLQTTVSAGSAYFVVNAELNLHCCQPQAIPFATLDHAERFQKGF
FT                   GGAVCTFDQALEDMLQDRKKRCTCTKK"
FT   CDS_pept        128431..128784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycnL"
FT                   /db_xref="GOA:P94434"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94434"
FT                   /protein_id="BAA09028.1"
FT                   /translation="MKETPCPNCGKPLTGDMVRSSNVPCQFRCGHCRERLYEYKVSAPI
FT                   MLVSLAAIVLLIYLLMLLRNAAGSVLPAVQHVPMAVFALVCAYPVFIVSERMIAKYVIQ
FT                   NGNIIYRGKRKGS"
FT   CDS_pept        128957..130789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltA"
FT                   /note="homologue of mannitol transport protein of B.
FT                   stearothermophilus"
FT                   /db_xref="GOA:P42956"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42956"
FT                   /protein_id="BAA09029.1"
FT                   /translation="MQQQEQQQGGMKVKVQRFGSYLSGMIMPNIGAFIAWGIITALFIP
FT                   AGWFPNEQLNTLVSPMITYLLPLLIAYTGGKMIYDHRGGVVGATAAIGVIVGSDIPMFL
FT                   GAMIMGPLGGYLIKQTDKLFKDKVKQGFGMLINNFTAGIVGAALTILAFYAIGPVVLTL
FT                   NKLLAAGVEVIVHANLLPVASVFLEPAKVLFLNNAINHGILSPIGIEQASQTGKSILFL
FT                   VEANPGPGLGIFLAYMFFGKGSSKSTAPGAAIIHFFGGIHEIYFPYILMKPGPDSRSHC
FT                   RRSKRTLNITIFNAGLVAAASPGSIIALMAMTPRGGYFGVLAGVLVAAAVSFIVSAVIL
FT                   KSSKASEEDLAAATEKMQSMKGKKSQAAAALEAEQAKAEKRLSCLLKARTKLSFRVIRD
FT                   GIKCHGGIHLKKQSEKAELDISVTNTAINNLPSDADIVITHKDLTDRAKAKLPNATHIS
FT                   VDNFLNSPKYDELIEKLKSNLIEREYCHASTRKGNIKLNQTVSSKEEAIKLAGQTLIDN
FT                   GYVTEDYISKMFDREETSSTFMGNFIAIPHGTEEAKSEVLHSGISIIQIPEGVEYGEGN
FT                   TAKVVFGIAGKNNEHLDILSNIAIICSEEETLNA"
FT   CDS_pept        130842..131942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltD"
FT                   /note="homologue of mannitol-1-phosphate dehydrogenase of
FT                   Streptococcus mutans"
FT                   /db_xref="GOA:P42957"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42957"
FT                   /protein_id="BAA09030.1"
FT                   /translation="MIALHFGAGNIGRGFIGALLHHSGYDVVFADVNETMVSLLNEKKE
FT                   YTVELAEEGRSSEIIGPVSAINSGSQTEELYRLMNEAALITTAVGPNVLKLIAPSIAEG
FT                   LRRRNTANTLNIIACENMIGGSSFLKKEIYSHLTEAEQKSVSETLGFPNSAVDRIVPIQ
FT                   HHEDPLKVSVEPFFEWVIDESGFKGKTPVINGALFVDDLTPYIERKLFTVNTGHAVTAY
FT                   VGYQRGLKTVKEAIDHPEIRRVVHSALLETGDYLVKSYGFKQTEHEQYIKNQRSLLKSF
FT                   HFGRCDPRSEVTSQKTGRKCRLVGPAKKIKEPNALAEGIAAALRFDFTGDPEAVELQAL
FT                   IEEKDTAAYFKRCAAFSPMNRCTPSF"
FT   CDS_pept        132414..132950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsA"
FT                   /note="homologue of tartrate dehydrogenase of Pseudomonas
FT                   putida"
FT                   /db_xref="GOA:P42958"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42958"
FT                   /protein_id="BAA09031.1"
FT                   /translation="MIFDFVVIRENSEGEYSEVVGRIHRGDDEIAIQNAVFTRKATERV
FT                   MRFAFELAKKRRTLVTSATKSNGIYHAMPFWDEVFQQTAADYSGIETSSQHIDALAAFF
FT                   VTRPETFDVIVASKLFGDILTDISSSLMESIGIAPPDINPSGKYPSMFEPVHGSAPDIA
FT                   GQALPIRSARFGQRS"
FT   CDS_pept        133240..133803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sipU"
FT                   /product="signal peptidase"
FT                   /db_xref="GOA:P42959"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42959"
FT                   /protein_id="BAA09032.1"
FT                   /translation="MNAKTITLKKKRKIKTIVVLSIIMIAALIFTIRLVFYKPFLIEGS
FT                   SMAPTLKDSERILVDKAVKWTGGFHRGDIIVIHDKKSGRSFVKRLIGLPGDSIKMKNDQ
FT                   LYINDKKVEEPYLKEYKQEVKESGVTLTGDFEVEVPSGKYFVMGDNRLNSLDSRNGMGM
FT                   PSEDDIIGTESLVFYPFGEMRQAK"
FT   CDS_pept        134107..134553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsC"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JMQ0"
FT                   /protein_id="BAA09033.1"
FT                   /translation="MMKRVAYPGTVITNRSAHLRHTAAFPCDSSPHAESNHKDVPSGVL
FT                   PDHRLDDGFSRFQPFVFCKLFVCRFFFFQCVDFILAEQVGRQHIISSHFDQPAHLFHMA
FT                   VYTIYFVCENDKRFWEHNGLLLCFFHYILSFHFRLRYNGQKKEI"
FT   CDS_pept        134555..135067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsD"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42961"
FT                   /protein_id="BAA09034.1"
FT                   /translation="MNSLSLPHRYPFLFIDGVTDSEPGKHAAAYKLISENDWFITDTQT
FT                   EMPFSLVIEGLRKPRLLQELQMRTAWDYCLRKRKSWEKLCLVTGLILRLKSRAIGAGLC
FT                   SDMPRHQLESSLLLKLKSASILKNEKNPSQHFVRGSILCRNPVRFESYLFAGVCVFHHS
FT                   YFPSALH"
FT   CDS_pept        135270..136019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsE"
FT                   /note="homologue to hypothetical 29.7 kDa protein in
FT                   ibpA-gyrB of E. coli"
FT                   /db_xref="GOA:P42962"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42962"
FT                   /protein_id="BAA09035.1"
FT                   /translation="MSVQREDVDIKLIAIDMDGTLLNDEQLISDENRKAIREAEDKGVY
FT                   VVISTGRTLMTCRELAESLKLSSFLITANGSEIWDSNFNLVERKLLHTDHIQMMWDLRN
FT                   KHNTNFWASTVNKVWRGEFPENITDHEWLKFGFDIEDDDIRNEVLEELRKTKSSEITNS
FT                   SPTNIEVNALGINKAAAPCQGYGKLGFTMENVMAMGDSLNDIAMIKEAGLGVAMGNAQD
FT                   IVKETADYITDTNIEDGVAKAIRHWVL"
FT   CDS_pept        136224..136859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsF"
FT                   /product="lactam utilization protein LamB homologue of H.
FT                   influenza"
FT                   /db_xref="GOA:P42963"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42963"
FT                   /protein_id="BAA09036.1"
FT                   /translation="MFQIDLNCDLGESFGAYKIGLDQDILEYVTSANIACGFHAGDPSV
FT                   MRKTVALAAERGVKMGAHPGLPDLLGFGRRNMAISPEEAYDLVVYQIGALSGFLKAEGL
FT                   HMQHVKPHGALYNMAAVDQKLSDAIAKAVYKVDPGLILFGLAESELVKAGERIGLQTAN
FT                   EVFADRTYQSDGTLTPAPSRTHSLKVMMPRHPGHQNGERRGGQISARP"
FT   CDS_pept        137259..138224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsG"
FT                   /product="branched chain as transport system II carrier
FT                   protein BraB homologue of H. influenzae"
FT                   /db_xref="GOA:P42964"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42964"
FT                   /protein_id="BAA09037.1"
FT                   /translation="MVLPGLGYSIAILVVLGGLAFNIGNIGGAGLGLQVLFGITPETGA
FT                   LISAVIAILIFVIKEAGIAMDRFTQIAGFVMIILTVYVAATTAPPVGQAVANTFVPEHI
FT                   SIFAIVTLVGGTVGGYITFAGGHRLLDAGIKGKESIPQVTKSSVVGILITSVMRIALFF
FT                   AVLGVVSKGLHIDESNPAASVFKLAAGNVGYKIFGLIMWSAAITSVIGAAYTSVSFFKT
FT                   FSPKIEKNSRGIIIGFIVVSTLAFVTIGQPAKILVLVGSLNGLILPIALGTLLVAAYKK
FT                   NIVGDYKHPLWLTSTGALVVIVMAVMGIYTLCTQLPQLWS"
FT   CDS_pept        138248..139021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsI"
FT                   /note="homologues to unidentified protein of
FT                   Schizosaccharomyces pombe"
FT                   /db_xref="GOA:P42966"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42966"
FT                   /protein_id="BAA09038.1"
FT                   /translation="MAPKDVRALIREGKINGPTAGMSGGYAQANLVVLKKDLAFDFLLF
FT                   CQRNQKPCPVLDVTEAGSPVPSLLRRMLISRTDFPKYRIYRHGILTEEVSDITPYWEDD
FT                   FVGFLIGCSFSFEQALINNGIAVRHIDEGTNVSMYKTNIDCFPVGAFHGQMVVSMRPVP
FT                   ERLAVRAAQVTSRFPAVHGGPIHIGNPGAIGIRDLGKPDFGDAVSIRDGEVPVFWACGV
FT                   TPQAVAMNVKPEMVITHAPGHMLITDIRDESLAVL"
FT   CDS_pept        139065..140801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsJ"
FT                   /note="homologues to hypothetical protein HI1731 of H.
FT                   influenzae"
FT                   /db_xref="GOA:P60495"
FT                   /db_xref="GOA:Q7WY77"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="PDB:2KWA"
FT                   /db_xref="PDB:2ZP2"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60495"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WY77"
FT                   /protein_id="BAA09039.1"
FT                   /translation="MTVRYQIEQLGDSAMMIRFGEEINEQVNGIVHAAAAYIEEQPFPG
FT                   FIECIPAFTSLTVFYDMYEVYKHLPQGISSPFESVKRDVEERLAEIAEDYEVNRRIVEI
FT                   PVCYGGEFGPDLEEVAKINQLSPEEVIDIHTNGEYVVYMLGFAPGFPFLGGMSKRIAAP
FT                   RKSSPRPSIPAGSVGIAGLQTGVYPISTPGGWQLIGKTPLALFRPQENPPTLLRAGDIV
FT                   KFVRISEKTITPIRRSPIEHESIKARTAHNGSGYRQNGLPKIRRSGQRRYGHGFTAHCQ
FT                   SVDRKRRNEAGLEITMMGPGPSFHFSKQTLIAVTGADFTLRINDEEAPLWKPVLIKENS
FT                   TVSFGPCKLGSRAYLAAAGGIEVPAVMESKSTYVRGSIGGLHGRALQKEDELNIGEMSA
FT                   LSQTILSRLSSQLAHTVIGSTDVVSQPWEISVIEDESRHSSAGGISICLLHSRIKNAFS
FT                   EEAFRVTPQSDRMGYRLKGEPLDLTAPLEMVSAAVSFGAAQMPPAGKPYYPCLQDRQDD
FT                   WPAIRGIAHIISADLPIVSQIMPGEHVQFEPVSLQEAEALAVEREQHIKELKTRMKMEW
FT                   LT"
FT   CDS_pept        140817..141557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsO"
FT                   /product="homologue of pectin degradation repressor KdgR of
FT                   Erwinia chrysanthemi"
FT                   /db_xref="GOA:P42968"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42968"
FT                   /protein_id="BAA09040.1"
FT                   /translation="MQNKNKTVVKSMALLNLFLHKPSLTLSELVSLTGMPKTSVHRMVS
FT                   SLEEMGFLSRDASGAYSLGLVFLEFGQLVADRLDIRKIAKPVMEELCREVDEAVQLIMR
FT                   DGNEAIYVEKIEGTQTVRLYTAIGRRSPLYAGACARSILSFLPREEIEAYIKQTELISI
FT                   GSGTITDPEKLLQEIDASVQNGYTVSYSELENYTAAIGAPIFNHERQVAAGISIAGFEA
FT                   RFTEDRLPYLTEKVKDAALQISRK"
FT   CDS_pept        141632..142273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsK"
FT                   /db_xref="GOA:P42969"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42969"
FT                   /protein_id="BAA09041.1"
FT                   /translation="MVLRYTALGDSLTTGRGSGLFSPGFVQRFGDMMEADLKTRTAINI
FT                   FARSGLNTEEILGLLSYPYVQKCIRDADMITITGCGNDLIDSVLAYQTSKDETIFSRVS
FT                   AHCHENFEKMIAKVAEIKGENPSPYAIRVFNLYNPFPEIDIAGKWITSFNSHLETLASA
FT                   PHVKIADAYSIFKGKEQEYLSFDGVHPNSKGYQAMAEAVHKLGYKELSVS"
FT   CDS_pept        142462..142776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsL"
FT                   /db_xref="GOA:P42970"
FT                   /db_xref="InterPro:IPR025018"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42970"
FT                   /protein_id="BAA09042.1"
FT                   /translation="MSFAVIIIILALIAFNYTEHTSVIQSVMLVFLGAVMFMQGLEERK
FT                   KENDGSGAFNIYTAVLYGLSPLSVLHFILYKSILHILKMLDRRERGIEPMKQGFPLLIL
FT                   "
FT   CDS_pept        143132..145138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpC"
FT                   /product="penicillin-binding protein III"
FT                   /note="PBP3"
FT                   /db_xref="GOA:P42971"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR007887"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42971"
FT                   /protein_id="BAA09043.1"
FT                   /translation="MLKKCILLVFLCVGLIGLIGCSKTDSPEDRMEAFVKQWNDQQFDD
FT                   MYQSLTKDVKKEISKKDFVNRYKAIYEQAGVKNLKVTAGEVDKDDQDNKTMKHIPYKVS
FT                   MNTNAGKVSFKNTAVLKLEKTDDEESWNIDWDPSFIFKQLADDKTVQIMSIEPKRGQIY
FT                   DKNGKGLAVNTDVPEIGIVPGELGDKKEKVIKELAKKLDLTEDDIKKKLDQGWVKDDSF
FT                   VPLKKVKPDQEKLVSEATSLQGVTRTNVSSRYYPYGEKTAHLTGYVRAITAEELKKKKE
FT                   GTYSDTSNIGIAGLENVYEDKLRGTTGWKIYVPQTGEVIAEKKAKDGEDLHLTIDIKTQ
FT                   MKLYDELKDDSGAAVALQPKTGETLALVSAPSYDPNGFIFGWSDKEWKKLNKDKNNPFS
FT                   AKFNKTYAPGSTIKPIAAAIGIKNGTLKADEKKTIKGKEWQKDSSWGGYSVTRVSERLQ
FT                   QVDLENALITSDNIYFAQNALDMGADTFTKGLKTFGFSEDVPYEFPIQKSSIANDKLDS
FT                   DILLADTGYGQGQMQMSPLHLATAYTPFVDNGDLVKPTLIKKDSQTADVWHKQVVTKEG
FT                   AADITKGLKGVVEDERGSAYQPVVKGITVAGKTGTAELKTSKDDKDGTENGWFVGYDYE
FT                   NKDLLVAMMIQNVQDRGGSHYVVEKAKKQFQSN"
FT   CDS_pept        145240..146142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsN"
FT                   /note="homologue of aryl-alcohol dehydrogenase of
FT                   Phanerochaete chrysosporium"
FT                   /db_xref="GOA:P42972"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42972"
FT                   /protein_id="BAA09044.1"
FT                   /translation="MQRIQLAEDLQFSRVIHGLWRLNEWNYSDAELLSLIEWCIDHGIT
FT                   TFDHADIYGGYTCEKLFGNALALSPGLRENIELVTKCGIVLESPERPAHRSHHYNTSKS
FT                   HILASVEQSLMNLRTDYIDMLLIHRPDPLMDPEGVAEAFQALKCSGKVRYFGVSNFKDH
FT                   QYRMLESYLPEKLVTNQIELSAYELENMLDGTLNLCQEKRIPPMAWSPLAGGKVFTENT
FT                   DKDRRVRTALESVQGEIGAASLDEVMYAWLYTHPAGIMPIVGSGKRERISAAINALSYK
FT                   LDQDQWFRIFTAVQGYDIP"
XX
SQ   Sequence 146191 BP; 39986 A; 31990 C; 36003 G; 38212 T; 0 other;
     aattccaata aaagcgtttt caactaaagg taggagaaaa atcacccgta aaatacaatc        60
     atataggagg attacagagc atttagaagc ataaataaga tcatgtggtc acatggatgt       120
     ttataaagaa atggtacaga ataaaagaga atatgctgtt tgtgtgggaa gttacataaa       180
     tgttacggta ataaagattg cttaatatgg agggaaaata tgagtgtaga tgagaaacca       240
     attaagataa aagtcgagaa agtctctaag atttttggga aacaaacaaa gaaggcagtt       300
     caaatgcttg ccaacggaaa ggcaaaaaaa gagatcctga aagcaaccgg atcaaccgtt       360
     ggggttaatc aggcagattt tgaagtatat gatggtgaga tatttgtcat catgggtcta       420
     tcagggagcg gtaaatcaac tttagtacgg atgttaaacc ggcttattga accgactgcc       480
     ggaaatattt acattgatgg tgacatgata acaaatatgt caaaagacca gctccgggaa       540
     gtccgccgga aaaaaatcag catggtcttc caaaagttcg ctctgtttcc gcacagaacg       600
     atacttgaaa acacagaata cggactggag cttcaaggtg tagacaaaca agagcggcag       660
     caaaaagcgc ttgagtctct taagctcgtt ggactggaag gatttgaaca ccaatatccc       720
     gaccagcttt ccggcgggat gcagcagcgt gtcggccttg cccgcgcgtt gacgaatgac       780
     ccggacatcc ttctgatgga cgaagcgttc agtgcgctcg atccactgat tcgtaaagat       840
     atgcaggatg agcttcttga tcttcacgat aatgtcggaa aaacaattat ctttattacg       900
     catgacttgg acgaagcgtt gcggatcggc gacagaattg tcctaatgaa ggacggcaac       960
     atcgttcaaa tcggcacgcc tgaagaaatc ctgatgaatc catctaacga atatgttgag      1020
     aaattcgtcg aagatgttga tttgtctaaa gtcctcacag caggccacat tatgaaacgc      1080
     gctgaaacag tgcggattga taaagggcct cgcgtagcat tgacactgat gaaaaacctt      1140
     ggaatttctt caatttatgc agtggataaa caaaagaaat tattaggtgt tatctatgcg      1200
     tctgatgcga aaaaagcggc tgagtctgat ttgtcacttc aagacatctt gaatacagaa      1260
     tttacgactg taccagagaa tacgtatctg actgagattt ttgacgttgt gtccgatgcg      1320
     aatattccaa ttgcggttgt ggatgagaag caaagaatga aaggaattgt cgtaagaggc      1380
     gcgctgattg gcgcacttgc cggcaataac gagtatatca atgctgaagg cactaacgaa      1440
     caaacacaag atccttctgc acaggaggtg aaataagatg gatagactgc ctagaatacc      1500
     tttagcagat attattgacc gttttgttga ctggattacg atgacgtttg gcggattctt      1560
     cgacggaatc gctaacggat tggccgcttt tgtaaatgga attgtcaccg gtcttggatt      1620
     tattccatct attttgttaa cgattatttt cgccgcactt gcgtggtgga tcagtacaag      1680
     gggaattgcg ttatttacgt tgattggatt cctcctgatc gattatttag gatattggga      1740
     cccaatgctg caaacattgg cgcttgtttt gacatctgtg attatttcga ttgtggtcgg      1800
     ggttccgatc ggaatttggg cgtctcagaa agaaacggtt cgccgtattg taacgccaat      1860
     tcttgattta atgcagacaa tgcctgcttt cgtatatcta ttgccggcga ttttcttctt      1920
     taacatcggt gttgtgccgg gtgttgttgc atctgttatc ttcgcgatgc cgccgacaat      1980
     ccgcatgact gtcctcggta ttaaacaagt gccggcggat ttgattgaag cgactgaggc      2040
     attcggttct acaacagctc agcgtttgtt taaagttcag ctcccgcttg cgacaaaaac      2100
     gattttggcc gggatcaacc agagcatcat gcttgcgtta tcaatggttg ttatcgccgc      2160
     aatggtcggt gcaccgggac ttggttctga agtatacagt gccgttacac agctgaaaac      2220
     cggggtcgga gtagaggccg gtatcgccat cgttatcgtt gccattaccc tggaccgtat      2280
     tactcaaaat attaaagtga agaagaaaag cagggggaat gcctgatgct taaaaaaatc      2340
     ataggcatcg gcgtttccgc catgctggcg ctctcacttg cggcttgcgg ttcagaaaac      2400
     gatgaaaatg catccgcagc agaacaagtg aataagacca tcatcgggat tgaccccggt      2460
     tcagggatta tgtccctgac tgacaaagcg atgaaggatt atgacctgaa tgactggaca      2520
     ttgatttcag cgtcaagtgc tgcgatgacc gctacgctta aaaagtcata cgaccgtaag      2580
     aaaccgatta tcattacagg atggacaccg cactggatgt tctccagata taagctgaaa      2640
     tatctcgatg atccgaaaca atcttatggc agcgcagagg aaatccatac gatcacacgc      2700
     aaaggcttca gcaaagagca gccgaatgcc gcaaagcttc tgagccagtt taaatggacg      2760
     caggacgaaa tgggcgaaat catgatcaag gtggaagaag gcgagaaacc tgccaaagtt      2820
     gctgctgagt acgtcaataa acacaaggat cagattgccg aatggacaaa aggcgttcaa      2880
     aaggtgaagg gagacaaaat caaccttgcc tatgtggcgt gggacagtga gattgcaagt      2940
     acaaacgtca taggcaaagt cttagaagac ttgggctatg aggtaacact tactcaggta      3000
     gaggctgggc cgatgtggac tgcaattgcg acgggaagtg cggatgcatc cctttccgca      3060
     tggctgccga atacccataa agcatacgcc gctaaatata aaggcaaata tgatgatatt      3120
     ggcaccagta tgactggtgt gaagatgggg cttgttgttc ctcaatatat gaaaaatgtc      3180
     aactcaattg aagatttgaa gaagtaatca aaaaagcagc ctgtgtcagg ctgctttttt      3240
     tgcgttaaga agcgttagcg gcagcaagtg attccgcctt ctgaaatgtt ttgagcacgc      3300
     gttcgccaaa atatgaatgc cggtaaacat cgcatttctg tcaaaggtca tgtgcggatg      3360
     atggagcccc ggctggagcc cgcagcctag tccgagcatc gttgttttca gattcggcac      3420
     cttcacggcg taaaaatgga aatcctcgcc gccggtggtg acaagcgggt catcaagccg      3480
     ctcagccccg atgatttccg taatggcttc tgccatgatc gcttcagctt ctttattttg      3540
     tgttgccgca ggaaggctgt gttctttgtg cagctcgatc tttgcgccaa atgcagcggc      3600
     ggccgcttca caggctcttt ctgtttcggc gattaatgcc tccatggctt cattggtctg      3660
     tgcgcgcaaa tcaaggctga acgatgcttt tcctggaatg atgttagagc tttcaccgcc      3720
     ggcttgcagt tttgtcattt tgacggtatg cgggatttgc gggtcaatat gaatgagtcc      3780
     gagcttgtgt acaagaaatg ccgcaatttc aatgctgttt ttcccgaggt gcggacgggc      3840
     gccatgagcc tcttccccga tgatcgttcc ctcaatgtgc tggcttgatc cgtgcagaat      3900
     agaaggagcg cagcggccgt tctgtgtttc ctggatcgga cggacgtgaa cgccatacaa      3960
     atagtcgata tcatcaagca cgccttcttc tatcattttc aaggcgccgc cgcctttttc      4020
     ttctgccggc tgaaagataa aacggattgt gcccttcgga agctcaggtt gtttttttag      4080
     cagcattaac gtgcccaatg ccattgtcat atgtgaatcg tgtccgcagg aatggttggc      4140
     gcgaaatgtg ccgttaacct cctgccacag cgcgtcaata tcagcgcgta ccgctacaac      4200
     aggtgagcct gagccgattt cgccgacaac cccggtgcag tctgaaaacg tgcgcgtccg      4260
     gcaccctaaa tcctcaagct tttgtttcaa aaatgaagtt gtctcatatt ccttccagct      4320
     gacttcaggg ttcgcgtgca gatgctcgaa gatgtccata atggtttgtt tcatttcttc      4380
     tgaaagcttt tgcatggtaa gaaatacctc cttctatcag aatgaatttt taccttcttt      4440
     actttattta tattgaaaca ggaagatagg ctgtatataa tatagcacat attgctacta      4500
     ttcagaataa ttaatatttt caaacagagg ggatggatcg aaatatgagt atgccagcag      4560
     ccgaaacaca gcctaagaaa aaacgtatga catttaaaat gcctgacgcc tatgtcctct      4620
     tatttatgat tgctttcatt tgcgcaatcg cttcatatat tgtgccggca ggtaatttga      4680
     ccgcgtgaca aagggggatg tcacgaccgc tgttccggga agctatcatt caattgaaca      4740
     gtctccggtc agattgatca gcttttttac ttctctacag gatggaatgg ttggatcagc      4800
     acccatcatc tttctgattt tattcacagg cggcaccatt gctattctag aaaaaacggg      4860
     tgccatcaat ggcctgattt acaatgtcat cagcaaattc cgcacaaagc aattattatg      4920
     tatttgtatt gtcggcgcat tgttctccat tctcggaaca accgggattg tcgtgaattc      4980
     agttatcggt tgtatcccca tcggcctcat tgtggcacga tccttaaaat gggacgcagt      5040
     cgcgggagcc gctgttatat acatcggctg ctacgctgga tttaactcca ccatattatc      5100
     accgtcaccg ctcggtttat cacaatcaat cgcggagctc cctcttttct caggaatcgg      5160
     cctgcgagtt gtgatataca tatgcttttt gctgtcttct attatttata tctatttgta      5220
     tacgagaaaa ttaaaaaaat caaaagatgc cagtgtgtta ggaacagatt ggttccctgc      5280
     ggcaggaatg ggcgaagccg gtaaagaaga agatcagtca gtgccgttta ccgttcgcca      5340
     taagctgatt ttggctgtgg cgggactctc acttgtcgga tttttatacg gcgctttgaa      5400
     gcttggctgg tcagattccc aaatggctgc gacatttatt tttatttctg tccttgccgg      5460
     tttaataggc gggcttgcgg cgaacgatat tgccaaaacc ttcattacgg gctgccaaag      5520
     tcttgtatac ggggcgctga ttgtcgggat ggcacgaagc atttccgtta tccttgaaaa      5580
     tggaaagctt ctcgatactg tcgtcaatgc tttggcttca cttttggatg gattcagccc      5640
     gattgctggg gcaatcggca tgtatatcgc cagtgcgctg cttcattttc tcatctcttc      5700
     aggttctggc gaagccgttg tatttattcc aatcctggcg ccgctcgctg atttgatggg      5760
     aatcacgaga caggttgcgg ttgaagcggt tatgcttgga gaaggggtcg tcaactgtgt      5820
     gaacccgaca tccggcgttc tcatggcggt gcttgccgcc agcggtattc cgtatgtcaa      5880
     gtggctgcgg tttatggtgc cgcttgctct gatttggttc ttgatcgggc ttgtctttat      5940
     cgtgatcgga gtcatgatca attgggggcc gttttaacga ttgctgcccg ccggcttgta      6000
     cggcgggctt ttgagttatt cattgcagaa gcgcaggctg ttattgtaac atgtaagcca      6060
     taagccattc gtaaaagtgc gggaggaagg tcatgaataa tctgcgtaat agactttcag      6120
     gcgtgaatgg gaaaaataag agagtaaaag aaaaagaaca aaaaatctgg tcggagaatg      6180
     ggatgatagc gggagcagtt gctctgcctg atgtgatcat ccgcggcatt atgtttgaat      6240
     ttccgtttaa agaatggtct gcaagccttg tgtttttgtt catcattatc ttatattact      6300
     gcatcagggc tgcggcatcc ggaatgctca tgccgagaat agacaccaaa gaagaactgc      6360
     aaaaacgggt gaagcagcag cgaatagaat caattgcttg cgcctttgcg gtagtggtgc      6420
     ttacgatgta cgacaggggg attccccata cattcttcgc ttggctgaaa atgattcttc      6480
     tttttatcgt ctgcggcggc gttctgtttc tgcttcggta tgtgattgtg aagctggctt      6540
     acagaagagc ggtaaaagaa gaaataaaaa agaaatcatc ttttttgttt ggaaagcgag      6600
     ggaagcgttc acagtttcgg gcagcttttt ttataggaac attgatttgt attcactctg      6660
     ccaagttgtt ttgatagagt gattgtgata attttaaatg taagcgttaa caaaattctc      6720
     cagtcttcac atcggtttga aaggaggaag cggaagaatg aagtaagagg gatttttgac      6780
     tccgaagtaa gtcttcaaaa aatcaaataa ggagtgtcaa gaatgtttgc aaaacgattc      6840
     aaaacctctt tactgccgtt attcgctgga tttttattgc tgtttcattt ggttctggca      6900
     ggaccggcgg ctgcgagtgc tgaaacggcg aacaaatcga atgagcttac agcaccgtcg      6960
     atcaaaagcg gaaccattct tcatgcatgg aattggtcgt tcaatacgtt aaaacacaat      7020
     atgaaggata ttcatgatgc aggatataca gccattcaga catctccgat taaccaagta      7080
     aaggaaggga atcaaggaga taaaagcatg tcgaactggt actggctgta tcagccgaca      7140
     tcgtatcaaa ttggcaaccg ttacttaggt actgaacaag aatttaaaga aatgtgtgca      7200
     gccgctgaag aatatggcat aaaggtcatt gttgacgcgg tcatcaatca taccaccagt      7260
     gattatgccg cgatttccaa tgaggttaag agtattccaa actggacaca tggaaacaca      7320
     caaattaaaa actggtctga tcgatgggat gtcacgcaga attcattgct cgggctgtat      7380
     gactggaata cacaaaatac acaagtacag tcctatctga aacggttctt agacagggca      7440
     ttgaatgacg gggcagacgg ttttcgattt gatgccgcca aacatataga gcttccagat      7500
     gatggcagtt acggcagtca attttggccg aatatcacaa atacatctgc agagttccaa      7560
     tacggagaaa tcctgcagga tagtgcctcc agagatgctg catatgcgaa ttatatggat      7620
     gtgacagcgt ctaactatgg gcattccata aggtccgctt taaagaatcg taatctgggc      7680
     gtgtcgaata tctcccacta tgcatctgat gtgtctgcgg acaagctagt gacatgggta      7740
     gagtcgcatg atacgtatgc caatgatgat gaagagtcga catggatgag cgatgatgat      7800
     atccgtttag gctgggcggt gatagcttct cgttcaggca gtacgcctct tttcttttcc      7860
     agacctgagg gaggcggaaa tggtgtgagg ttcccgggga aaagccaaat aggcgatcgc      7920
     gggagtgctt tatttgaaga tcaggctatc actgcggtca atagatttca caatgtgatg      7980
     gctggacagc ctgaggaact ctcgaacccg aatggaaaca accagatatt tatgaatcag      8040
     cgcggctcac atggcgttgt gctggcaaat gcaggttcat cctctgtctc tatcaatacg      8100
     gcaacaaaat tgcctgatgg caggtatgac aataaagctg gagcgggttc atttcaagtg      8160
     aacgatggta aactgacagg cacgatcaat gccaggtctg tagctgtgct ttatcctgat      8220
     gatattgcaa aagcgcctca tgttttcctt gagaattaca aaacaggtgt aacacattct      8280
     ttcaatgatc aactgacgat taccttgcgt gcagatgcga atacaacaaa agccgtttat      8340
     caaatcaata atggaccaga cgacaggcgt ttaaggatgg agatcaattc acaatcggaa      8400
     aaggagatcc aatttggcaa aacatacacc atcatgttaa aaggaacgaa cagtgatggt      8460
     gtaacgagga ccgagaaata cagttttgtt aaaagagatc cagcgtcggc caaaaccatc      8520
     ggctatcaaa atccgaatca ttggagccag gtaaatgctt atatctataa acatgatggg      8580
     agccgagtaa ttgaattgac cggatcttgg cctggaaaac caatgactaa aaatgcagac      8640
     ggaatttaca cgctgacgct gcctgcggac acggatacaa ccaacgcaaa agtgattttt      8700
     aataatggca gcgcccaagt gcccggtcag aatcagcctg gctttgatta cgtgctaaat      8760
     ggtttatata atgactcggg cttaagcggt tctcttcccc attgagggca aggctagacg      8820
     ggacttaccg aaagaaacca tcaatgatgg tttctttttt gttcataaat cagacaaaac      8880
     ttttctcttg caaaagtttg tgaagtgttg cacaatataa atgtgaaata cttcacaaac      8940
     aaaaagacat caaagagaaa cataccctgc aaggatgatt aatgatgaac aaacatgtaa      9000
     ataaagtagc tttaatcgga gcgggttttg ttggaagcag ttatgcattt gcgttaatta      9060
     accaagggat cacagatgag cttgtggtca ttgatgtaaa taaagaaaaa gcaatgggcg      9120
     atgtgatgga tttaccccac ggaaaggcgt ttgggctaca accggtcaaa acatcttacg      9180
     gaacatatga agactgcaag gatgctgata ttgtctgcat ttgcgccgga gcaaaccaaa      9240
     aacctggtga gacacgcctt gaattagtag aaaagaactt gaagattttc aaaggcatcg      9300
     ttagtgaagt catggcgagc ggatttgacg gcattttctt agtcgcgaca aatccggttg      9360
     atatcctgac ttacgcaaca tggaaattca gcggcctgcc aaaagagcgg gtgattggaa      9420
     gcggcacaac acttgattct gcgagattcc gtttcatgct gagcgaatac tttggcgcag      9480
     cgcctcaaaa cgtacacgcg catattatcg gagagcacgg cgacacagag cttcctgttt      9540
     ggagccacgc gaatgtcggc ggtgtgccgg tcagtgaact cgttgagaaa aacgatgcgt      9600
     acaaacaaga ggagctggac caaattgtag atgatgtgaa aaacgcagct taccatatca      9660
     ttgagaaaaa aggcgcgact tattatgggg ttgcgatgag tcttgctcgc attacaaaag      9720
     ccattcttca taatgaaaac agcatattaa ctgtcagcac atatttggac gggcaatacg      9780
     gtgcagatga cgtgtacatc ggtgtgccgg ctgtcgtgaa tcgcggaggg atcgcaggta      9840
     tcactgagct gaacttaaat gagaaagaaa aagaacagtt ccttcacagc gccggcgtcc      9900
     ttaaaaacat tttaaaacct cattttgcag aacaaaaagt taactaaccg caactttaga      9960
     gtaaagggct gattgtcaat gtgggagcag ttgtatgatc cgtttggaaa cgagtatgtg     10020
     agcgcacttg tggcgctcac tccgattctc tttttccttt tggctttaac tgttttgtaa     10080
     atgaaaggca tccttgcggc atttcttacc ctagccgtca gtttcttcgt ctccgtctgg     10140
     gcacttcata tgccggttga aaaagcgatt tctactgttt tgttaggaat cgggagcggg     10200
     ctgtggccca ttggctacat cgtcctgatg gcggtgtggc tgtataaaat cgccgtgaaa     10260
     accgggaaat ttaccattat tcggtccagc attgccggca tttcgcctga ccaacgatta     10320
     cagctattat taattggttt ttgttttaac gcgtttttag aaggcgcggc cggttttggt     10380
     gttccgattg cgattagtgc ggcgctgctc gtcgaacttg gttttaaacc gttaaaagcg     10440
     gcggcgctct gcttgattgc aaacgctgcc tccggagcct ttggggcgat tgggattcct     10500
     gtcatcacag gggcgcagat tggtgatttg tctgctcttg agctgtctcg gacattaatg     10560
     tggacactgc cgatgatctc atttttaata ccattcctgc ttgtattctt attagaccga     10620
     atgaaaggaa tcaaacagac atggcccgct cttctggttg tgagcggtgg gtatacagcg     10680
     gttcagacac tgacaatggc ggtgctcggg ccggaattag caaacatttt ggcggcctta     10740
     ttcagcatgg gcgggcttgc cttcttcctc cgcaaatggc agccgaaaga gatttaccgc     10800
     gaggaagggg ccggcgatgc tggtgagaaa aaggcatacc gtgccgctga cattgcgaga     10860
     gcgtggtctc ctttctacat tttaactgcg gcgatcacca tctggagcct tcctgccttc     10920
     aaagcgcttt tccaagaagg cgggctgtta tatcaatcaa cgctcctgtt caaaatgcct     10980
     tttctgcatc agcaaattat gaaaatgccg ccgattgcgc catctgccat gccgttagat     11040
     gcagtcttta aagttgatct gctgtcagcg actggtacag cgattttagc ggcggtcatc     11100
     gtgacagggc tggtcagcaa aaagttctcc tctcgggatg cctttgcttc cttgaaggag     11160
     acgggaaaag agctgtgggt gccgattatg acgatctgct tcgtgatggg gtttgccaat     11220
     ctggccaact tcgcagggct cagctcttca attgggttag cattggcgag aacaggagac     11280
     ctgttcccgt ttgtcagtcc tgttctcggc tggattggcg tgttcatcac cggttctgtt     11340
     gtcagcaata atgctttgtt cggccatttg caggttgtca cgggagcgca gatcggtgcg     11400
     ggttcagatt tgctgttagc cgcaaatacg gcgggcggtg tcatggcgaa acttgtttct     11460
     cctcaatcta tcgccatcgc tgccgcagcg gtcggccaaa caggcaagga atctaaactg     11520
     tttaaaagga cagtgccgta cagcctgatt ctgttattga tcatttgtat atggacgttt     11580
     actcttgcaa gattaggagt gtaatagaaa aaagcagtac atgcccagca tgtactgctt     11640
     tttttatgtt aatttgcttt ctttgtcatt tcggctgttg ttttcactct ggcttttccc     11700
     ataaataaaa tggtaaccgc cgcgaggaca attggaatca aagcgagcaa aaagacatac     11760
     gtgatacttg atgacatcgc gtcaataatg cgattcagga tcgcatcagg aatctgggaa     11820
     cgtgttcccg cttggaatat ctcctgcggg tcgccaatat tttgcgcagc gcctgatccc     11880
     gctgggcctt tcataccgct gaaggcgtca ttcagcttgt ctgtgaatac gtttgtttgc     11940
     acccgttccg aaaatggtga caacctaagg tcatgccaaa tgatcgcaaa aatgaatttg     12000
     tagagtttgc cgttccccga aagcgaggtt caagatcatt catcgatgcc gccgacagca     12060
     gggagaagtt aaagcctaca ccaaagcctg aaatcatcat aaagactgtc agccataccc     12120
     gtgctgtgtc aggcgtcata ttggaaagaa gcagcatgcc gataaagaaa gctataacag     12180
     atatcagcat cagattgcgg aagcttgtct tcgtgttgga agatcccgcc gatcatgctt     12240
     cggatgactg atccaatcat catcggcgtc agaatgaagc ccgcgcttgc cgccgagctg     12300
     gcgtagaccg gctgaacgaa agtcggaatg aataccgcta aaatgataaa tatcccctca     12360
     tacaggaaag cgagaatctg tcgctgccgc aaacacgcca tcctggagga tctagctgag     12420
     tacctagcgg gatcttctgc ttttttctcc acaataaaaa aggcaatgaa gaaaacggcg     12480
     aatacaataa acagcccgat gatctgaatg gagttccaat cgtatgtttt gccgccaagc     12540
     tcaagggcga acatcaggca tacaatggat acgactaagg taatcgcgcc gccccagtct     12600
     attttttgct ttctgtgctc cagagattct ttgtagtagc gaataatgaa aaacaatgac     12660
     aatgcgccga tcggcacatt gatgtaaaac acccagtgcc agctgatcga atctgtaatg     12720
     atcgcgccta agagcggacc aagaacactg gataatccaa atacagcacc gaacatgccg     12780
     gacatttttc cgcgtttttc cggcggaaac aaatcaaaga taatggtaaa ggcaatcggc     12840
     aggagcgcgc cgcctccgat cccttgaatg gcccggaaga tgatcagctg attcatcgtc     12900
     tgggcaatcc cgcataaagc agaaccgatt aaggaaaaaa ataagtccaa acaggaaaaa     12960
     cgttttcggc cgtacatatc ggaaagcttg ccgtaaatcg gcatgccagc cataaccgcc     13020
     accatatagg atgccgtcac ccaggcaaat ttatcgaagc ttccaagatc ggctacgata     13080
     ttgcccatcg cggtggcaac aatcgtattg tccattgcag acatcaagat gcccagcagg     13140
     agaccgagga ccacaaattt ggtggaagcc tgttttgctg ttgttgtgtc catttgttct     13200
     acctcctctt acttttctat gtaagttctg atatcatgat aatagtttga ttgttgaata     13260
     tctcgattat ccagataaac tcgattttat agggaggact gtcagttgta aacaagaaat     13320
     tccagaagtg agttggaaaa gactgctgtt cagctttttc gaaaactggg cacaagaacg     13380
     gttctgtttc atcaggcagc cgctcaagct ctcggtctgt ttcccaccga tttgaaatca     13440
     gctgacattt taaatgaagc agggccgatg acggccggag agctggggaa aaaaaccggc     13500
     ctcagcacgg gttccgtcac ggcgcttgtt gaccggctgg aaaaagcggg ggtatgtggc     13560
     tcgtggaaaa ggactccgaa cgatcgcagg agagtcgtaa tcgtcccttt gactgcttcg     13620
     aaaaaacata taaaggattt gttccgtcct ctgtctgagt caacgatgga tttgtgccgc     13680
     gaatatacgg aagaggagct ggaactcatt ttcagttttg taggcaaagc tgccgatatt     13740
     atggaggatg agcttgaacg tctgaaacag taagtgaatt tgtgcatagc ttggcccgtt     13800
     cccgaataaa ttgtacaagt tacataagag aagggagtac gggacggaga acattttttt     13860
     gagctatatt gtgctgggac tgtccttgtc tgcgcctgtg gggccagtga atgcggcgca     13920
     aatagacaaa ggaattaaaa acggtttttg gcatgcatgg attttcggtt taggcgccat     13980
     gacagcggat gggctgtaca tgctttttat ctatttcggg ctgtcgcagt tcttgaccgc     14040
     tccatttgtg aaaacgtttt tgtggctgtt cggctttttt gtcctgacct ataccggaat     14100
     tgaaacgctg aaaaacgtca gagaaccgat ggatgtgcga agctcgcggg ggaaaccgtc     14160
     atacaggaaa acattcgcat cgggttttct catttcattg tcaaacccat tgagcatcct     14220
     tttttggctt ggaatttacg gaagcattct tgcgaaaaca gcagaggcct acaatatgaa     14280
     tcagcttcta atctatagct ccggcatcat gatcggcatt ttaatctggg atttctgcat     14340
     ggctatcaca gccagtacgt tcagaaacct gcttcatgaa aagctattga gaggattgac     14400
     cggaatcgcc ggtgtatccc tccttgtgtt tggcttttac tttggttatc agggcatcaa     14460
     acagttattg ggctgattca tgaaggacag tcacctgccg cttccagttt taatatagta     14520
     tccagatgat actggaggtg gatcaatggt gaatgggatt tacaccaaaa gttttctgga     14580
     acgtattcag gaagagcttc ctgaatggca aagaatcgct tttgagctgc tggcagaaac     14640
     tctgggggac gacgcggata catttccgtg cattcccgga cgccaggcgt ttctgactga     14700
     tcagcttcgg attgcttttg ccggagatcc gcgggaaaac cgcacagcgg aggaactggc     14760
     tccgttgctt gcggagtacg gcaagatatc gcgggacacg ggaaaatacg catccctcgt     14820
     tgtgttgttt gatacaccgg aagatttggc ggagattatt cgattgaagc gtatgaagag     14880
     ctgttttggc gcttttaaaa tagacttagt catcaagacg aaaaagaatg gccggaagac     14940
     attccggccg atcctgagca ttataaatgg gagttttgtt ttgacggcga gccgtatttc     15000
     attctgtgcg ctacaccggg gcacgaggca agaagaagcc ggagctttcc ttttttttgt     15060
     ggtcacgttt cagccaaggt gggtgtttga cgacctaaat ggatcaactg catttggccg     15120
     taacatgagc aggctgatcc gatctcgttt agaggcctat gatcaggctc cgattcaccc     15180
     gcaattaggc tggtacggag gaaaagataa tcgtgaatgg aagcagtatt tcctccgtga     15240
     tgacgaaaaa caggtatcga agtgcccgtt ttcttattta aagaacatgt tcaacaaaat     15300
     gaaataaatc aaggactggc agggcgatct ttgtgaccct actttttttg atagatcatg     15360
     gtaacgatgg cgataatcac gagaaaacct atgctgacga aaaaaccggg ccggcttgat     15420
     ttttcaaaca atgtaccgga cacagctgca gcaatcagaa ccatcgctaa ataaatttgc     15480
     gtttttccca tgccctcggg atcagtcagc tttttgctgg agaacaggat aaacagccaa     15540
     gtgtataaaa gcataagccc cgcagctgtt gtcatatgct cataaatgtt tttaggcagc     15600
     actaacgaca aaataatgga gaggacaagc cccgcaaacg tcagcccaag tgccggccag     15660
     catatttttt tgccttcctt tagagtaaag catttcggcg cgtcgccgtc atcagccatt     15720
     gtacaaagca atgtcgtaac cgcaaatagc gaagcgatga gggtcgagaa ccctgcgatg     15780
     atgaaaatcc cgttaaatat atcaaggatg atctcaaggt tatatccttt taatgacgta     15840
     atgaacggac tgtcctgttc agtaaacgtg tgtaacggaa ccaaaagcag agcaagcccg     15900
     attgaaatga tataaataat cgccagcgtc gccagcatca gtttccctga tttagacgct     15960
     tcctcaggtt tttttaagtg aaccgccatc agccccatga cctcaattcc gccaaaagcg     16020
     taaaacgcgt agattaaacc tgtccacagc cccatggcgc cgtatgggaa aaactcactc     16080
     gtcttatttg gaacatgtat gccatgattt ccgccggaca ggataccgca taaagccagg     16140
     atggcaatga caataaacat aaaaatagca gctgttttaa tgactgccag cacgttttct     16200
     gttttttcaa agacggccag gccggtgaaa ataataagga gcccaagtac tgcgtagatt     16260
     gaggcaaaca cccatagcgg cacttgagga aaccaatgct tcgtaaagag cgaaatggct     16320
     gtcagctggc ttccggtaat cagcatttct gatgtccagt acacccagcc gttgctgaag     16380
     cctgcccatt tgccgaatgc ttttcggcat acgcacaaaa cgagcccttt tccggctctt     16440
     cgccgatagc ttggcgagct gttcaaagac aaaatacgta ccgatccctg cgatcagaaa     16500
     tgaaaggaga acggaaaaac cgctttttac aattcgatgc tggaaccgag aaagaagcct     16560
     gttccaatcg tgcagccgac tccgatcagt gacagctgcc accaagccag attccctttt     16620
     ggctggtctt tttttgtttg gctcattatt tattcaaccc cttttatcta aggttagatt     16680
     gtgatctgtc caaagcttat gtacatcgga tttttgcctc tttttacatg gagaaggaag     16740
     cagacgctca tactaatgaa aaaaggagca aaccaatgac acagcaatat attgtggagc     16800
     cgaaaaaagg gcttgggctg aagctgaaaa aggggcagat tttacaggtg gttgatgtcg     16860
     aagggcagca ggtcgctgat tttgtgcgca taccatgcca aggattctta tgaacacctt     16920
     gatcagggag cgacgataga cgccattcac tccattcatg tgaaggtcag cgaccatctc     16980
     tactccaacc ctgtattaag ccgatggtta cccttgattg aagatacggg tccggcaagc     17040
     atgatctgct gttggcccgc ctgccgtcct gatattgaac aggctcttat atgggaagcc     17100
     aaaaggatga gtttcaggat acgtgctatg acaatatgcg ccgtgcgctt gagcagtttg     17160
     gcgtaccgaa gccccacatg cattacccac ttgcgatatt gtatggatac tgtccttgat     17220
     gaggaaggga atctgtctgt ggaaacgccg ctttcggatg ccggagatta tgtaaggctc     17280
     agggcggaga tggatttaat tgtcgcgttt tcttcctgcc cgagatgcaa cagggacatc     17340
     caatggcgac agtgtgacat ccatacgggg tgaagtcagc tgatctctct tgttcacagt     17400
     gaatgaagac ctgtgctata tttaataggg atacataaca gtcatgattc attttcattg     17460
     atttagggaa atgatcagta ataagggaaa atgtacagga ggaatgattg ggatgagcat     17520
     gcaggaaaag attatgcgtg agttacatgt gaagccctca attgatccaa agcaagaaat     17580
     tgaggaccga gtcaattttt taaaacaata tgtaaagaaa accggtgcta aaggctttgt     17640
     attgggaatc agcgggggcc aggattcaac acttgcggga agactcgctc agcttgcggt     17700
     ggagagcatt cgcgaggagg gcggagacgc tcaatttatc gcggtccgtc ttccgcatgg     17760
     cacacagcag gatgaagacg atgcccagct tgctttgaag tttattaagc cggataaatc     17820
     atggaagttt gatattaaat cgacagtcag cgctttttct gatcagtatc agcaggaaac     17880
     aggcgatcag ctgacggact ttaataaagg aaacgtaaaa gcaagaacaa gaatgatcgc     17940
     gcaatacgcg atcggcggcc aggaaggtct tcttgtgtta ggaacagacc atgctgctga     18000
     agcagtgact ggtttcttta cgaagtacgg tgacggcgga gcagacctcc tgccgctgac     18060
     aggcttgacg aagcgccagg gaagaacctt gctgaaagag ctgggtgcac cggaacgctt     18120
     atacttaaaa gaaccgactg ccgatctgct cgacgaaaaa ccgcagcagt cggatgaaac     18180
     agagcttggc atttcctacg acgagattga cgattatctc gaaggaaaag aagtatcagc     18240
     gaaagtatca gaagcgctgg aaaaacgcta cagcatgact gaacataaac gccaggttcc     18300
     ggcgtctatg tttgatgact ggtggaaata agttgaagaa agcccgctct cggagcgggc     18360
     ttttgtcgtg tacagaagct ttatttgatg cggatatgat tcagctttac cattaatctg     18420
     tcggcgaacc ttcggaggct gcctcttgta tcaggatcta atgggagttc ggctctcgcg     18480
     gcaatgttct ctgccacatc ctgaatcgac aggttgtctg tttgaatgtg gtcctcaaaa     18540
     atgggtgatg ataatccttc aacacagcgg tcaatttgtt tggcggccca tgagtttttt     18600
     ccttctgctc tggtgcgcag cctttttaac aaggtttcct ttgaagccat tagtgtaaag     18660
     tggtgaacga tcctgccttc ctgtctgagc ctgccgatga tctcattgaa gtattcaggg     18720
     tgtacaatcg tcataggcac aataaggatg ccgcggtatg tatctgtcag agaagctagc     18780
     aaactgtaat tgaacgcccg ccataaagga tagctttgaa aatcgtcctt tgcgatctcc     18840
     tgcggcacca tggagcgcag cgcaaaaccc attttctggg gatcatacac gtaagatggg     18900
     ttcagccttc tgtgcagttc gaaggctgtt tgtgtttttc ccgaaccgaa tgccccgttt     18960
     atccaaatga tcatcgccat tcctcccttc ctatttatca tacagaaaaa gacccttcca     19020
     tcgaagagtc agctggaaaa acaataaagg cggaaggttt taacgctttt ttgcgtcgaa     19080
     gtattaaaat acctgcagaa atgttgtaca atgaatgtca ttcaggcaaa aatggctaca     19140
     acaaagcgca ctataagctt gaccggtaaa gccggtatct atataaatat tcgctaaata     19200
     agcatataat gaatatataa ttccattcct taggaggatt tcgccgaaga tgaacgctaa     19260
     acgagccatc ccagtaagag aaagaaatat cgtcctgatc ggattcatgg gtgtaggaaa     19320
     aacaacaatc ggccaattgg tcgctaaaaa attatataga gattttattg atattgacca     19380
     gcagatcgaa aaggatttca atatgtcaat tcctgagata tttgagaaaa agggagaaga     19440
     cttttcccgg aaaacggaga aggaatatat tttagacatc tgccatcata aacgattcaa     19500
     aatcgtatct ctgggcgggg gatcttttaa acaagaagaa atcagaaatt gctgtctgga     19560
     aaactgtctc gtgcttcatc tggacctgtc atgggagaac tggaagcagc gcgcggattt     19620
     attgatcgaa agccgccctg tactgcataa ccgttcaatg gatgaaatgg aacagctgtt     19680
     taacgaaaga aaagtcattt atgacaagca caattcaaaa gtggcaacag acaacctttc     19740
     cccggaagag gttgccgatt acattgttga gacattaaaa attggctggg atctttatca     19800
     gccgatgtaa aaagccgtgc gcagcgcacg gcttttttta tcgttttatc ccttgtatca     19860
     aaatcgcttt taaacaaaag gagatgggct gtccgttttg gttcaatgta atacagaacg     19920
     tgtcgcgtgc ttcgtctgat gcgtgattca agtgggtaat gatttgtttt tctcggtcag     19980
     cgggggttcc gcctcgtttg atccagctat cgtattgaat cggcaagttc cacttttgga     20040
     tgtcttgata ggccagttga ttggcgctga acatcgcctg ccattctgat aatgagcttt     20100
     cacgaacatg ggaaggtctc gaagccggtt caaatgattg acaaactcat caagaacggg     20160
     atcttcaggc gcgtaatgat caactaagag aaaacgtccg tcctgtttta gtacgcgtgc     20220
     aacctctctg acagctttgc ggacatctga aaaatggtgg gctgcgtatc ggcaggtgat     20280
     gatgtcaaat gaatcgtcgg ggaaggggag ttactctccc gttccttgct gaaagctacg     20340
     ttttcaactc ctttttcttg cgcgaaggag gacgcaacct caaccatctc tttcgttgca     20400
     tcaacaccga tgcactcctg tacataagga gaaaatgcca gcgccgtatg gccggcgccc     20460
     gctcctatat ccagcactcg atgctctgcc cggcattccg ctgttttaat catcaacccc     20520
     aaatcttccc cctcggcaaa taccttttca tcccgataca tctcggcgtt tttagaaaac     20580
     ggtgtttcat ttgtaatttg aaccagctcc ttcttttcgt aaatgatgat atggattatg     20640
     ttagcaattt ctgttatgat tcgtccaaga tataaaaatg atgaaaatga taggttcaac     20700
     ctatggaggc tgaaatggat attaaagtga tggaatatgc agcggaaatt gcccggcgcc     20760
     aaagctttac aaaggcggcg gtacatcttc atatcgcaca gccgtctctc agccagcaaa     20820
     tcaaaaagct tgaggctgag ctggggctta ccctttttca cagatcccat ggctctgtta     20880
     cactgacacc tcacggcagg cgtttcattg aaaaagccga ggacatcatt cgctccagag     20940
     atgatttgct tcgggaaatg caggagcgat cacagggaat cggtcataaa ttatccatcg     21000
     ggattcctgc tgtaacaggg agatatctct ttcctccgct gctgaagcag tttgtggcgc     21060
     gctatcctca tgtggaggtt cagcttgttg aaaaagatcc ggtttcatta gagaagatga     21120
     cggcaaaggg agaagttgac ctttctgttt tatccttgcc catcgaggat gaacggctct     21180
     ccattacacc cttgctcacg gaaccggttg ttctcgcggt gccgaaggaa aaacaaaggt     21240
     ggatgccgcc ggaattggtc gcgctgattg agaaagcgct ggaagaagat gagggacgcc     21300
     agccgtgtgt gccgattgac atggtaagga acgtgccctt tattctgtta aaagaaggct     21360
     tcggctttcg caggacagtt ctcgatctct gtgcggaaag cggctttaag ccgaatgctg     21420
     cctttaaaac gagccatatt gaaaccgccc aatctcttgt ggctaacgga ttaggtgtga     21480
     caatggcacc gaatatggtc agaagggata aagatccggg tgtgatctat ttatcgattc     21540
     aatccgcgcc atcacgaacc ctcgtctttg tctttttaaa gaaccgctat gtcagtctga     21600
     cggcccaggc ctttatggaa ctaagccggg aaagtcttaa acaaacgttt gatgaaggct     21660
     gtctgggaaa caaagatgaa aatatttaga aaacaaagac gaaacgtggt agtataggaa     21720
     tacaaactaa atcttataaa acaaagggga ataatcggaa atgcaactat tcgatctgcc     21780
     gctcgaccaa ttgcaaacat ataagcctga aaaaacagca ccgaaagatt tttctgagtt     21840
     ttggaaattg tctttggagg aacttgcaaa agtccaagca gaacctgatt tacagccggt     21900
     tgactatcct gctgacggag taaaagtgta ccgtctcaca tataaaagct tcggaaacgc     21960
     ccgcattacc ggatggtacg cggtgcctga caaggaaggc ccgcatccgg cgatcgtgaa     22020
     atatcatggc tacaatgcaa gctatgatgg tgagattcat gaaatggtaa actgggcact     22080
     ccatggctac gccacattcg gcatgcttgt ccgcggccag cagagcagcg aggatacgag     22140
     tatttcaccg cacggtcacg ctttgggctg gatgacgaaa ggaattcttg ataaagatac     22200
     atactattac cgcggtgttt atttggacgc cgtccgcgcg cttgaggtca tcagcagctt     22260
     cgacgaggtt gacgaaacaa ggatcggtgt gacaggagga agccaaggcg gaggtttaac     22320
     cattgccgca gcagcgctgt cagacattcc aaaagccgcg gttgccgatt atccttattt     22380
     aagcaacttc gaacgggcca ttgatgtggc gcttgaacag ccgtaccttg aaatcaattc     22440
     cttcttcaga agaaatggca gcccggaaac agaagtgcag gcgatgaaga cactttcata     22500
     tttcgatatt atgaatctcg ctgaccgagt gaaggtgcct gtcctgatgt caatcggcct     22560
     gattgacaag gtcacgccgc cgtccaccgt gtttgccgcc tacaatcatt tggaaacaaa     22620
     gaaagagctg aaggtgtacc gctacttcgg acatgagtat atccctgctt ttcaaactga     22680
     aaaacttgct ttctttaagc agcatcttaa aggctgataa atgtgaaaag ccgccgcata     22740
     tcatcaggcg gtttttttct gcaaactgcc ggaatgagaa cagactggag acgaatagat     22800
     atgaaacaaa gaatcattga tgaattaaaa cggatcgagc agtcatacgg agtcaaaatc     22860
     gtgtatgccg tcgagtcagg aagccgcgca tggggatttc cctcgcagga tagtgattac     22920
     gacgtccgct ttatttatgt tccgaaaaag gagtggtact tttcaattga gcaggagcgt     22980
     gatgtcattg aggaaccgat tcacgatttg ctggatatca gcggctggga gctgagaaaa     23040
     acgcttcggc ttttcaaaaa gtcaaaccct ccgctactcg aatggctgtc ctcagacatt     23100
     gtgtattatg aagcatttac gaccgcagag cagttaagaa aactccgcac ggaggcattt     23160
     aagcctgaag caagcgtgta tcactatatc aatatggcga gaaggaacgt caaggattat     23220
     ctacaaggac aagaggtcaa aattaaaaag tacttctacg ttcttcggcc tattttggcc     23280
     tgccaatgga ttgaaaagca cggaaccata ccgccaatgg actttactgt tttgatgaat     23340
     gaacttgttg ctgaacccga gctgaaggct gaaatggaaa ccttgcttga acggaaaaga     23400
     agaggggaag agcttgacct cgaagcaaga atcgatgtta ttcaccaatt cattgaaacg     23460
     gaaatcgaaa gaatcatgga agcggcaaaa gaactgaagg cagagaaaaa agatatgaca     23520
     tctgaattga accgtttgct tttgaatacg gttgaagaag tgtggaagga tggaggaagc     23580
     tgatgttttt tgtcgcttcc ttttctcctt tattcgacag aatccccccc cgactttcta     23640
     actatctgat tgtggcaaac ccacaaaaat aatcagaatc tttgtatttt gaggatattg     23700
     tgaacgctgg ttttgtccat ttacaataaa ctcatacaaa tacttcttag attgcggggt     23760
     gttgaggttg gaagtgatca caagagattt tttcttattt ttatccaaaa gcggctttct     23820
     caataaaatg gcgaggaact ggggaagtcg ggtagcagcg ggtaaaatta tcggcgggaa     23880
     tgactttaac agttcaatcc cgaccattcg acagcttaac agccaaggct tgtcagttac     23940
     tgtcgatcat ttaggcgagt ttgtgaacag cgccgaggtc gcacgggagc gtacggaaga     24000
     gtgcattcaa accattgcga ccatcgcgga tcaggagctg aactcacacg tttctttaaa     24060
     aatgacgtct ttaggtttgg atatagatat ggatttggtg tatgaaaata tgacaaaaat     24120
     ccttcagacg gccgagaaac ataaaatcat ggtcaccatt gacatggagg acgaagtcag     24180
     atgccagaaa acgcttgata ttttcaaaga tttcagaaag aaatacgagc atgtgagcac     24240
     agtgctgcaa gcctatctgt accggacgga aaaagacatt gacgatttgg attctttaaa     24300
     cccgttcctt cgccttgtaa aaggagctta taaagaatca gaaaaagtag ctttcccgga     24360
     gaaaagcgat gtcgatgaaa attacaaaaa aatcatccga aagcagctct taaacggtca     24420
     ctatacagcg attgccacac atgacgacaa aatgatcgac tttacaaagc agcttgccaa     24480
     ggaacatggc attgccaatg acaagtttga atttcagatg ctgtacggca tgcggtcgca     24540
     aacccagctc agcctcgtaa aagaaggtta taacatgaga gtctacctgc catacggcga     24600
     ggattggtac ggctacttta tgagacgcct tgcagaacgt ccgtcaaaca ttgcatttgc     24660
     tttcaaagga atgacaaaga agtaaaaaag gagagattat catgacaaca ccttacaaac     24720
     acgagccatt cacaaatttc caagatcaaa actacgtgga agcgtttaaa aaagcgcttg     24780
     cgacagtaag cgaatattta ggaaaagact atccgcttgt cattaacggc gagagagtgg     24840
     aaacggaagc gaaaatcgtt tcaatcaacc cagctgataa agaagaagtc gtcggccgag     24900
     tgtcaaaagc gtctcaagag cacgctgagc aagcgattca agcggctgca aaagcatttg     24960
     aagagtggag atacacgtct cctgaagaga gagcggctgt cctgttccgc gctgctgcca     25020
     aagtccgcag aagaaaacat gaattctcag ctttgcttgt gaaagaagca ggaaagcctt     25080
     ggaacgaggc ggatgccgat acggctgaag cgattgactt catggagtat tatgcacgcc     25140
     aaatgatcga actggcaaaa ggcaaaccgg tcaacagccg tgaaggcgag aaaaaccaat     25200
     atgtatacac gccgactgga gtgacagtcg ttatcccgcc ttggaacttc ttgtttgcga     25260
     tcatggcagg cacaacagtg gcgccgatcg ttactggaaa cacagtggtt ctgaaacctg     25320
     cgagtgctac acctgttatt gcagcaaaat ttgttgaggt gcttgaagag tccggattgc     25380
     caaaaggcgt agtcaacttt gttccgggaa gcggatcgga agtaggcgac tatcttgttg     25440
     accatccgaa aacaagcctt atcacattta cgggatcaag agaagttggt acgagaattt     25500
     tcgaacgcgc ggcgaaggtt cagccgggcc agcagcattt aaagcgtgtc atcgctgaaa     25560
     tgggcggtaa agatacggtt gttgttgatg aggatgcgga cattgaatta gcggctcaat     25620
     cgatctttac ttcagcattc ggctttgcgg gacaaaaatg ctctgcaggt tcacgtgcag     25680
     tagttcatga aaaagtgtat gatcaagtat tagagcgtgt cattgaaatt acggaatcaa     25740
     aagtaacagc taaacctgac agtgcagatg tttatatggg acctgtcatt gaccaaggtt     25800
     cttatgataa aattatgagc tatattgaga tcggaaaaca ggaagggcgt ttagtaagcg     25860
     gcggtactgg tgatgattcg aaaggatact tcatcaaacc gacgatcttc gctgaccttg     25920
     atccgaaagc aagactcatg caggaagaaa ttttcggacc tgtcgttgca ttttgtaaag     25980
     tgtcagactt tgatgaagct ttagaagtgg caaacaatac tgaatatggt ttgacaggcg     26040
     cggttatcac aaacaaccgc aagcacatcg agcgtgcgaa acaggaattc catgtcggaa     26100
     acctatactt caaccgcaac tgtacaggtg ctatcgtcgg ctaccatccg tttggcggct     26160
     tcaaaatgtc gggaacggat tcaaaagcag gcgggccgga ttacttggct ctgcatatgc     26220
     aagcaaaaac aatcagtgaa atgttctaag cgggactaaa tgggcatcct ccctgcgggg     26280
     gtgtccattt catccatata ctataaaaaa gaggaggaag tgccatagaa aacacacagc     26340
     tgattatttc gatttgtatt tatatggcgg gaatgctgct aatcggctac tttgcttaca     26400
     agcgtacgtc gaatctgacg gattatatgc tgggaggacg ctctttgggt ccggcagtaa     26460
     ccgctctcag tgccggcgct gccgatatga gcggctggct gctaatgggg cttccgggcg     26520
     ccatgttttc tactggtctg agcggcgctt ggatcgtcat cggactttgc cttggagcgt     26580
     gggcgaactg gctttacgtc gcaccacggc tgagaaccta tactgaaaaa gcggggaatt     26640
     ctattacaat tcccggattc ctggaaaatc gcttcggaga tcaaacaaag cttctcagac     26700
     tgttttcggg aattgtcatt ttagtctttt tcacgtttta tgtatcgtcc ggaatggtgt     26760
     ccggcggcgt cttattcaac agcatcttgg ggatggatta tcacaccggc ctgtggattg     26820
     tgacgggtgt tgttgtggca tataccctgt ttggcggctt tttggcagtc agctggacag     26880
     attttgttca ggggattatt atgtttgccg cactcattct tgtgccgatc gttacgtttt     26940
     tccacacggg aggagcaggt gatacagttg ctgaaatccg ctctgtagat cctgatatgt     27000
     ttaatatttt caaaggaacg agcgtccttg gcattatttc tttgtttgcc tgggggctgg     27060
     gatactttgg ccagccgcat attattgtgc gttttatggc gataacgtct gtcaaagaga     27120
     tcaaaagagc gcgcagaatt gggatgggct ggatgatttt gtctgcagta ggcgcagtgc     27180
     tgaccggttt gggcggaatc gcttattacc atcagcgcgg catgacactg aaggacccag     27240
     agacgatttt tattcaatta gggaatatct tgttccatcc gattatcacg ggttttctga     27300
     tttcagcgat tttggccgcg attatgagta caatttcttc ccagctgctt gtgacatcaa     27360
     gctctctggt agaagatttg tataagtcga tgttcagacg ctcagcttca gataaagaac     27420
     tggtgttttt aggccgactg gctgttctgg ctgtttcaat tgtcgcgttg gttctggctt     27480
     gggagaaaaa taacaccatc cttggattgg tcagctacgc gtgggcgggc ttcggtgcat     27540
     cattcgggcc agttgtactg ctcagtctgt tttggaaacg aatgaccaaa tggggggcac     27600
     tcgccggcat gattgtggga gcagcgactg taatcatttg ggcgaatgcc ggtctttcgg     27660
     actttctgta tgaaatgata cctggttttg ctgcgagtct attatctgtc ttttttgtca     27720
     gcatattgac gcaggctccg tcacaagctg tcacagacca gttcaacgac taccaagata     27780
     caatgtcgca ataaagatcg aaaggaggag gaaggggctg tccctttttc ctcttttctc     27840
     cttttaagcg gccatttttt tcttttggaa acaaacgtat ttttttctat acaaaaagac     27900
     cccgtatgga tatgattaaa gtaaaaaaag tataggagaa aaaggtatgg aagagctttt     27960
     agagagagtt ttttcatttt cagatgttga taagctaatt gattttatta gctatgaact     28020
     gcaaaagcca gtgatactgg aaagcgcgga tttctttttg ttagcctata attcttacta     28080
     tattaaccat tttgattctg ccaaccagca gactattttt tcgaaaaagt gtccggtcca     28140
     gatttttgag aggtttctga aggacggaat tattgaaaaa ttgaaaacag agcctgagcc     28200
     ttttcgcgtc aataaaattg aaagcattgg gttaaaccag agggtggtcg tgagtgcaaa     28260
     gcacaaaggg gaagtcatgg gctacatctg gattcaggag ctggaccaaa atctgacgga     28320
     tgaagagctc gactttttgt acgagacctc cttccatgtc gggaaaatca tttataaaac     28380
     gaataaattg aaacaggaaa aggaagaaaa agcagaggat ctcatcaaac gggcgatcta     28440
     tcagcaattt acctctgaga aggaactcag acgggaagct gaaaggatca acaccgtgct     28500
     gccttccatg ttttcagttg ttatcctgca cgccgcaaat ggggatgggg aagcggttga     28560
     ggatttaaag gaaaatatca ggtcgtacct gaatttacgg gataaggtca gtcatgtctt     28620
     aacgatcgaa tcaaacattg tcatcgtcgt agcgagtttt tcccaaaaaa gctccgtctc     28680
     ctcagcagct tctgagttta ttaacaagct gttaacacat tttcactttc aaaaaatacc     28740
     tacccctatt tatatcggta tcggaaacga atataatcac ctattaaaac ttggcaagag     28800
     ctacacagaa gcacttgaag tcatcaaagc cgcagaaatc accggcaatc aggaaaacat     28860
     tccatatgaa tatgccaaac tcggcattta ccgctattta gaaagcatcg aacagaaaaa     28920
     tgaattttta gaatacgaga ataaagattt agctttatta aaagcaaaag acgaagaaag     28980
     cagcactgag ctgctcaaaa ccttggaagt ctatctcctc aacaactgca aaacaaaacc     29040
     agcggcagaa cagctgttta ttcaccaaaa tacattgaat taccgcatca aacagattac     29100
     tgagatgacg tcgatcgatt taagcgattt cagaacgcgg tgccagctct atctcgattt     29160
     gatgctgatg aaaaagaaat aaaaaagaaa ccagtacttg tactggtttc gtcttcactt     29220
     aaaatcctct gtaaacatac ggatcatcag gttttttaat ggtattccag tcagttactt     29280
     tgacgacagg gagagttgac ttgaatggct ggtaatattc tgaggccaga gtgcccttaa     29340
     tgtgaatcca ttcatcatcc ttgatgtcca tgtccttcgg aaattccaca agcatcccgt     29400
     acacgccgga atcagcgata cagtgaatga tgccaaacct taatacgaac agctgatttt     29460
     tgttaattgc gtttcctttg taagcaaatc catgaaattc tatcgtccgt ccgagaaatt     29520
     cacccggata gttatagatg gtttccattc cttttaggaa atcgtcatcg gtcagagaaa     29580
     tctctttttt gctggaatac ttattaaaca gctgtttcat ttgtttgtca tagctgtctt     29640
     gcgcgtaata aaggctggca tcaggccgca aatactgtgt ttgggagtag tgatctccgc     29700
     tctccatcgc cttaaacgag aacccttttg ttttgactat ggatgagtca agcgttgcaa     29760
     tcgggaagaa gatgcctgac accaaaggaa aaagaaaaac aacataaatc aaataacgct     29820
     gataaaatgg cttgttttgt tcatggtcat gctcgtgatc atggccgcac ccgcaatcat     29880
     ggtcatggtg atgtccgctt ttttcaggcg acttgataaa tagatatgct tggacggcgg     29940
     tcagaatggc cagcaggaag atcgcaataa aggaaagata ggcatatttc atattgatat     30000
     attttgttag atttcctgag gcatgcagat gataaaagaa aaacgtaaat cccatcagca     30060
     ccaataaacg aaacatccaa tcaccccttt accagtagtg atcccgctaa aacaatcacg     30120
     acaatgtatg taatcagcag gaaaacaaat cgttttttga aggccgcaag catcatcaat     30180
     agattcttaa tatccaccat tgcaccaaag acgagaaagg cgattaacga tcctaatgaa     30240
     aacgtgctgc tgaaggaaga cgcgatgaac gcatcaactt ctgaacaaag cgacaggaca     30300
     aacgccagac ccatcatcac gagggaagag gatacatcat tctgcccgat cgcaagcaga     30360
     gtggatgttt tgacatacgt ctgcatagcg gctgcgataa aggcgccgat gattaaatat     30420
     ttccccacgg agaaaaattc atcaatggca tgccgcaagg tcccgcccag tttttggagc     30480
     aaggtgccgt gatgatgatg gtggtgcccg ggttcatcag gctttaaaag ctggttatcc     30540
     ttaaattgat aggataagat gaccccgatg atcagcgaaa cggcgagagc cagtccgcct     30600
     ctgtaaaaga ccacgctcca tctattcccg aacgcaatat aagtagaaaa taaaacgata     30660
     ggattaatga taggcgcggt cagcatgaaa gcaacgcccg catgcagagg aactcccttt     30720
     aacagaagcc gcctcgtaat cgggatgatg ccgcattcgc aggcgggaaa taaaacgccg     30780
     gccagcgcac cgaataaaac ggcgagaaaa cggtttttcg gcatgattct tgcaatcatt     30840
     tcttcagaaa caaacatttg aatgattccg gaaagtatga cgccaatcag aataaacgga     30900
     atggcttcta ttaaaatgct gataaaaata gaattcagct gaagaaaaga tgattgtgct     30960
     gtcacaataa aacctccgct catgttaagc tgcctttctt atgataccag aaaaaaaggc     31020
     actgcttgtt tgacggagga ggggaaagga tcgtttcact ttggttagga ttccaaaaag     31080
     ccgagtagga tactgcctgt ttctgcagct tcttttccga gccaaatcag gtgtccccat     31140
     gagtgaagca aacagagaac agcgccacga atgtgctctt ttgcatgatg tgcatgtgac     31200
     aagtcaacca atccgtcata aacactttgc ataatcagca cgggacatat gatggcttgc     31260
     aggtctttta aagagacagc ggcggtttgt gacaagtcaa tcagaaatcc ttcacccgag     31320
     cgctgccggc tgttcatttt ccgaaatgct tctatgtctt tttcattcat caaggacttg     31380
     attcgctgaa acggaagcgt gctgaattgg gggctcatag ctcgaaacat caaacgcggg     31440
     aaagcgttat tcaaggaaga aatcagcttc catatccact tttccaccgg cgggcggaag     31500
     agaatttccc ccaatttata ttcagtgtct tttggggtga gccactcttt ggtgactgcg     31560
     gattgcaggg tcaatgtatt tactctttcc ggataatgtg aggcaaagca tatgccgctc     31620
     ggccctcctg ctgagatggc gatcacatgg acactctcga tttgtagatg atctaataat     31680
     ttcacataga aacggcaggc attggcaaga ctttttccaa tttcttttga cgtccgtcca     31740
     tagccaggcc ttgaaggcgt aatgatggaa tacccttgtt caatcaacgc tgtgtatccg     31800
     aattcctcgt aacaatttga atgcccgcca tgcatgacaa ggatcggagt tcccttgcct     31860
     gtcacagaat attctagtgt accgccatcg aaggtgatcg tttcaactcg tcttttcatc     31920
     tgtttcaccc aattggtttt tgcctattat agagttttca gcaattgacc acaaggtaga     31980
     agaaatgaat aaacaaaggc ccttgaaata tgatatactt tgtattgata ttcattctca     32040
     attaaaactt tgatatagat gtgaacggga ggcaggacgg atggctgaga atcaagaggt     32100
     atatgacgtt acgattatag gcggggggcc gatcgggctg tttactgctt tttactgcgg     32160
     gatgcgggag ctgaaaacaa aggtaatcga atttttgccg aagctcggag ggaaggtgtc     32220
     tttattcttt tcctgagaaa atcattcgcg atatcggcgg cataccgggg attgcgggaa     32280
     agcagctgat cgagcagctg aaggagcagg cggcaacgtt tgatcctgat atcgtattga     32340
     atcagcgtgt gaccgggttt gaacgcctag atgacggcac cattgttctg accgggttct     32400
     gaagggaaaa agcactatac aagaactgtg attttggctt gcggcatggg tacacttgag     32460
     gtcaatgagt ttgacagcga ggatgcggcc cgatatgcgg gcaaaaatct tcattatgga     32520
     gtggagaagc tcgatgcgtt taaagggaaa cgcgtggtga tatcaggcgg cggagatact     32580
     gcggtcgatt gggctaatga gcttgaaccg attgcggcgt ctgtgactgt cgttcatcgg     32640
     cgtgaggaat tcggcggaat ggaaagcagc gtgacgaaaa tgaagcaatc atcggtgcgg     32700
     gtgcttacgc cttatcggct ggagcagttg aacggagatg aagagggcat caaaagcgtg     32760
     accgtttgtc atactgagtc tggccagagg aaagacatag aaattgatga gctgatcatt     32820
     aatcatgggt tcaaaattga tctcgggccg atgatggagt gggggctgga gattgaagaa     32880
     ggaagggtga aagctgacag acatatgcga acgaatcttc cgggcgtgtt tgtggcgggc     32940
     gacgcggctt tttatgaaag caagctgaga ttgattgccg gcggatttac ggaaggcccg     33000
     acagcggtca acagtgccaa ggcttatctg gaccctaagg ccgagaatat ggcgatgtat     33060
     tccacccatc ataaaaaatt ggtgcataaa taaaacagcc cttgaggaaa agggctgctt     33120
     gccatcaggt gtgaaggagt tttttctctg catgttgatt gtggatgaaa gctagcaatt     33180
     catcctgttc ttgtacggct gtgaatccat aaatgccggc agctgagtca tcgcctatgc     33240
     agacgatagg agggcggctt gctgacggtt ccggcaaaat gccaatttgt tcgccaccat     33300
     tgatcaattg ctgaacggac agcttgtttg ggcaaatgac catgtgcagc ggggattcac     33360
     tgatggtacg ctgaatcatg tgggtgaacc ggtcatctat gacgttttca tgagtgatat     33420
     aaaacgaaca ggattcatgc ttttgcatgt tttccactgc atggcggctc ccgacaacaa     33480
     gacgtttctc tgaatcaggc tgaatggcgg tgacaagaaa gccccgtttc tcaagctctg     33540
     tctttgcttg ctcagatgct gcactcagtt tggctgtcag ctggcggatg tcgattttct     33600
     gagaagccag tgctctgaaa aattcacaaa ccgcccggcg cgatgtgaaa aaaacgtctt     33660
     caaaggtgcc aatctttcga agaatttctt cattgacagg catgttttcg gtccgccatt     33720
     tcggccactc gatgagatcg gcgccggaat cgcgcagctt gtctgcaagc gggtcttcat     33780
     cttcgccatg agtcacaacc atcaaatgcc gtccgatgag cggtttgctt tcaaaccagc     33840
     tgtgtgtttg aaagttgacg atgtctccga tgacgataat cgcagggttt gtaatctggt     33900
     gttcctgcac tttttgctga atgttctcaa gtgttccttt cacactccgc tggcggcccc     33960
     acgttcccca ttggatgaca atgacaggga cagaaggcga tttcccgtat gaaataagct     34020
     gctggcaaat ataagacaag ttcttgacac ccatgtaaaa aacaagggtt tgaacgcttc     34080
     gggccagccc ttcccagtca aggttcggcg tgccttttaa tgatttatca tgcgctgtaa     34140
     tcatggcaaa agacgatgca aaatcccgat gcgtgacggg gatgcccgca tatagcggcg     34200
     ctgcaattcc agaggtgatt cccggcacca tttcatagcg aatgccgtgc tcatgaagag     34260
     catctgcttc ctcgccgact ctgccgaata cgctcggatc tccgcccttc aagcgaacga     34320
     cggttaaccc atttaatgct ttttcaacca gcagggcgtt aatttctttt tgtttcataa     34380
     aatggcggtt tggcagtttt ccgcaataaa taaactggca gtccggtgat gcaaattcga     34440
     gcagcttcgg gttggcgagc cggtcatata aaatcacatc tgcttccttg agcgcctgtt     34500
     ttcctttgat ggtgagcagg cctgggtcgc cgggtccggc tcccacgaaa tatacgattc     34560
     cgttcttcat gatcatgtca tccttccgtc actgtaaaaa atgaaggacc actagaaaag     34620
     tgatccggtc ttttgatcaa tatacgagat aaacatgttc tccttcgatc agcgtttcat     34680
     atgttttgac gcatccgtgg tcaggttctt ggacgattcc gtcttctaag gaaattttcc     34740
     agtcgtgcat cgggcagaaa acatattgac cgctgacgat gccttctgcc aggacgccgc     34800
     ccttatgcgg acagcggttt tcaatggcgc ggatgcttcc gtctgaaagc ttgaaaaccg     34860
     cgagctcctt atcttcaata tacactgttt tgcctaattg ttcaggcaat tcttcaattt     34920
     ttccgataca tacttttgtt acgtctttgt ttaccatgtc cattcctcct caatgatagt     34980
     ttttgtcatt atgatgtggt cacgacattt tcaaataatt ctttagaggt ttgtttatcc     35040
     tctaaaaagt ctttccacgg atccttgtgg acagagagtg tttcattcat tcggccgttc     35100
     agctcctgcc gcttttccgg atcgtttaac acggattgga catgggataa accgacgcgc     35160
     tcaagccatg cggacgtacg ctccagatag tttgcggttt ccctgtaata ttgcaggtaa     35220
     gcgcccgcgt attctaagac ttcttcattt gttttcacct tcatcagcaa atcgccggca     35280
     cgcaaatggg ttccgccgtt tccgccgaca taaagctccc agcctccgtc gatgccgaca     35340
     acgccaaggt ccttaatgcc ggattccgca cagtttcgcg ggcaggcaga cacggccatt     35400
     ttgactttgt gaggcgtgtt cagcccttcg aattttttct caagcgcaat gcccagtgcc     35460
     atggagtctt gtgtgccgaa gcggcagaat tgctcgccta cacatgtttt cactgtgcgg     35520
     agcgtttttc cgtacgcgta gcccgatggc atatcaagat cttcccatac cttcggaagg     35580
     tcttcttttt tcacgccgat aagatcaatt cgctggccgc ctgtcatttt cacgagcggg     35640
     atctcatatt tgtcaacgac atcggcgatc ttgcgcaaat ctgtggagtt ggtcacgccg     35700
     ccgtacatcc gaggaacgac tgagtatgtt ccgtcttttt gaatattggc gtgcattcgt     35760
     tcattaacaa agcgggatgt ccggtcatcc tcgtatttgg ttggattgat catgcctaag     35820
     tagtagttca gagcgggtcg gcatttagaa cagccttctg gcgttttcca gccgagcaca     35880
     ttcatgactt ctcttgtatg tgacagccct ttggctttga tttcttctac gacttcatct     35940
     ctcgacaatg tggtgcagcc gcaaatggct tctttttgcg ctgacgcatc aaagtctgat     36000
     ccgagcgtat gctggaggat ttcttctacg agcggcttac agcctccgca tgagcgggat     36060
     gcgccggtgc atgctttgat ttcgtccgtt gacgagcagc ccttttcctg tatggcttga     36120
     ataatcgcac cttttgacac gccgttacag ccgcagatga tttcatcgtc gctcatcgct     36180
     gcggttatgc ttgtgcctgc ttcctggctg aggggctgta agattgatat tttagaggtt     36240
     tcagagatat cggcttcttt ttgaatcata gaaaacaggc gattgccttc gctgctgtcg     36300
     ccgaataaaa cagcaccgac aatttgattg cctctcagga caattttttt atagatgccg     36360
     tcctgctcat cgaagacttt aatcgctttt ttctcctctg attcgttaaa gtcaccggca     36420
     gagaagacct cgacgcctga tacctttaac tgtgtggaga gaacggagcc ctcatacggt     36480
     tttgtttcga tgccgcacat atgctttgcc agcacttttg cctgttcata cagcggcgcc     36540
     acaagcccgt aggcgattcc tcggtgctcg gcacattcgc cgaccgcgta aatgtgcggg     36600
     atttcagtct gcatataatc gttgacgatg atgccgcggt taaccggaat gccgctctcg     36660
     gccccgagcg ttgtatttgg gcggatgccg acagccatga cgactaaatc agcttcaatg     36720
     cttgtgccat ccttgaatcg gaggccttcg acacggtcgt caccgacaat ttcttctgtt     36780
     tgcttttcaa gtaaaaaggt cataccttgt ttttctaact cgttttgcag caggcgtcct     36840
     gccgttgcat caagctggcg ctccatcagg aatggggcaa ggtggatgac ggacacgtcc     36900
     atgccgagat tcagcagtcc gcgagctgct tccaaaccaa gtagtcctcc gccgatgacg     36960
     gcagcttttt tatattgttt tgacgcggcg agcattgtgt ctgtatcttt tatgtcccgg     37020
     aaagctgtga cgcctttttt gtctgcgccc ggaatcggaa ggataaaagg gaccgatcct     37080
     gtcgccagga tcaattcatc gtaaggctgg attctgtctg catctgtgat gactgttttg     37140
     ttttccgtgt ccactttgat gactgtttca tttgtataca attgaatgtt gttttcttcg     37200
     taccagtccc aatcgtttaa cgtaatatct ttaatatctg tatcgccttg aagcactttt     37260
     gacaaaagga ttcggttgta attgggatgc ggttcggcac cgaaaattgt gatctgaaac     37320
     tcgtctttag caacactcag tatctcttca atggccctta ccccggccat tccattacca     37380
     acaagaacta gctgtttttt tcccatcaga tgatccgctc cttatcaaat gttttttcca     37440
     gcgtagcaca gcaaaaagga atatttaaga tacatgttat aaaatgtaac aaaatatacg     37500
     aaaagttcta aaaattttat gaaaaattta aataggtatg attcggacgg cgcatacctt     37560
     aaaaccgggc attttacagg ctggatctaa ggcttccccg attaaatcat tcacattttg     37620
     agcgtctgcc caatggatgg gaacaaaaac ggtatctttt ctgatttgtt ctgataattt     37680
     gctgcggacg gtgatgcttc cccgcggcga ttctattttt accagtacac ggtcctcgat     37740
     attgtaggtc gctgctgttt gcggatggat ctccataaac gattcaaaat gtctcgcggc     37800
     aagggcggcg ctttttcttg tttggacgcc tgttaagtag tgagacatga ctctgcctgt     37860
     cgttaaataa agcggataat cggctgtcgg cttctctttt ggaacaggtg gttcgtttgg     37920
     aatcacactt aatgccgctt tttgatccgg atgagcaaat gattctgtaa acaagcgccc     37980
     agttccggga tgatcagatt ccggacacgg ccaatgaatg ccgccttcac gtctgagcct     38040
     gccgtatgag atgcctgaat aatcggcaat cccgcctcgg ctcgcttctc tcaattcatt     38100
     gaaaatatcc tccgctgacg tataagaaaa gtagcggccc ttgccgagag cggatgcgag     38160
     atcacaaatg atctgccaat catgctttgc ttcgccgggg catggccggc ttgcttctct     38220
     taatgtcacg cgtccttcta catttgtcat ggtgccttca tcttctaagt aagaggaggc     38280
     aggtaaaatc acatctgcgt atttcgcagt ctcagaaata aacaaatcga ttgcgacaaa     38340
     gaatgtcagt cttcttaaag cctttttcac gagatttgca tttggactgg aaacagcagg     38400
     gttggagcac atgaggaaca gtcctttgat gtcgccgtca ttgatttttt ccatcacttc     38460
     ataggctgag acaccttttc gcgggagatc atcctgatgg attccccaca ctttcgcaat     38520
     atgcgcccgg tgttcttcgt tttcgataga acggtagcct ggaagctgat cggctttttg     38580
     gccatgctct ctggcgcctt gcccgttgcc ttgtccggtg atcgccccgt agcccgagta     38640
     aggtttgccg atttttcctg tgatcagcac catgtttaag aagcctttca cagccgctgt     38700
     tccatcggtt tgctgttcaa tcccgcgggc tgtaaacagc atgccggacg tttccttggc     38760
     aaacttcaca gcagcttttc ttatatccac cagcgagaca ctcgtctgtt cggcgatgtc     38820
     attcaggtcc aacgagtcag tatgctgctt cagctcttcg aatccatttg ttcgtgattg     38880
     aatgaaatcc tcgtttataa gctgttcgtc aatgatgatt ttgacgagac cgttggcaag     38940
     ggcggcgtct gtgccgggtt tgattttcag atgaagatcg gcgattttcg ttgtcgctgt     39000
     ttcacgagga tcaatggcaa tgaagtaagc tccgttttct ttcgcttttt caaaatacgg     39060
     cataatcgta ggctggcatt ccgcaatatt ggtgccggcc agaatgatca cacgggtgtg     39120
     ggggatgtct gataaaggat tcgttaagcc tctgtccgcg ccgaatgttt ggttggctgc     39180
     ggtggctgct gcggacatac aaagtctccc gttgtagtcg atgtattttg tctgtaagcc     39240
     tactcgtgcg aacttcccta acaaatacgc ctcttcattt gtaatcgagg cgcttccgta     39300
     taccgccatg gcgtcatgtc cgtgttcagt ttggatcatt gtcacttggt ctttgatatg     39360
     attcagtgct tcttcccagg aaacaggcat aaactcgccg tttttcttca gcagcggccg     39420
     ggtgatgcgg gaggagttca aggcatgctg gtgagcattc atgcccttga tgcatagccg     39480
     accctgtgtc gtaggattat caatcccgat cgcagtgtac tttttgcgcg tgacgatggt     39540
     ttgttccacg agctgcattt tgcactgcat gctgcaaaac gggcattgag tgtcatatgt     39600
     tttttctgat tggacgtctt gctgtttatc acggaaatat ctaagcagtc gttcagtcaa     39660
     aatgcctcat cctttcttat atgcgcccgt ctctacagtc gggttttgaa tcagtgacag     39720
     atctgtttgg aggctttcca gcagctgtgc ccttaggtct tcttcgaata gcacttctct     39780
     gatatgaacg atcccgagac ggtctatcca ctgatgaaca ccttctaagt aatgatccgt     39840
     ttcccgataa tactggatca gtcctttgat catgccggca gtgctgtctt cgttctcagt     39900
     cacgcaaaac aaagctcctg aacgggcatg agttccccgg acgccgccga tgtgaatgtc     39960
     ccagccagct tgtgtccgaa ttgcgccgac atcttgcagg gcggcctcgg tgcagtctgt     40020
     ttcacatgat aagctgatag aaatgggagc gggtaaggga agcatctcaa gttgtctttc     40080
     gatttgggct gccagctgct gaatcgatcg attttgcccg catgtacatg ctttgatgct     40140
     ttgcagcgcg tgtcggtgtt cattagtgta aacgggcatt ttcaggtctt ttttcatgtt     40200
     cgggagatcc gcaggcttga tcccggaaag cttcagcctt tggccgtgag taatggatac     40260
     gtcgggaatg ctgtatgcct caatgatgtt ggcgatggtt cttagctgct ccgcgtttgt     40320
     ccgcccgccg tacatttgcg gaatcaggat gcatgtctct tcagtggctg gctcaggctg     40380
     gacaaaccca gggtacagca tttccagata gtattgaatc gcaggaacac aagtactgca     40440
     tccgtttttt gttttccagt caagctggtt catcacttct gccggattag tgaatggcct     40500
     gcgctgaagc tcagcgatga tgtcgtcttc tgtaaaatca gtacagctgc aaaacgaagg     40560
     tgtgctggcg ggcttcgtat attcgctgtt ggtcatgtat ctcaaaaggt cttcaacgag     40620
     cggtttgcat cctccgcagg acccagtggc tttggtgcag tgcttgactt cctcaacagt     40680
     tgttaagcta ttcgtgtgca ccgcgtcttc aatcgcgcct ttcgtcactg tgttgcattg     40740
     gcaaatcgtt tcactggaag gcatggattc aaataaaggg ccgcttgtct ccggttcgat     40800
     gatctgtttt ttggcaatgg agatgtctcg ttgtttaagc aggctgtcga gaagccgctg     40860
     cttgtcacgg gtgtctccga ataaaataac gcgcagtttg tcatctacaa aaagcgcttt     40920
     tttataaacg cctgcttgtt cgtcgtagat tttgatgctc gtcgtgcgtt catcctcttg     40980
     gatctttcct gctgaccaca catcgattcc agctattttt aacgccgcag atggtgctga     41040
     gccttgatat tcctcacatg gaacgccgca aatatgactg gcgagcgctt ttccctgctc     41100
     ataaagcgga gccaccaatc cgtacaccgt tccgttatgc tcagcgcatt caccaacggc     41160
     gtagatattc ggttcgcttg tctgcatgaa gtcattcacg atgatcccgc ggttcacttt     41220
     gattccagcg gatacagcca attcaatatt cggtttgacg ccggccgcca tcacaatcaa     41280
     gtctgctttt aatgaagagc catctttaaa atggattcgg tctgccttcg tggcgccgga     41340
     aatggagacg gtgtctttct ccaaaagaaa ggttaggcct ttttgttcca gctctgtttg     41400
     cagcagccgc gccgctgttt gatcgagctg tttttgcata atgccggcgg agtggtgaat     41460
     gacgctgaca tccataccga gatgctgtaa acctactgca gcttccagtc ctaataagcc     41520
     ggctccgatt accgcagcct tttgaaagtg ctgggccatg ttcatcagcg cttggcagtc     41580
     ttctattgtc cgaaatccat agacaccttt tttgtctgcc ccggggatag ggagaatatg     41640
     aggggaggag cctgttgcca ctattaattt gtcatacgac agagtgcgtt tccgatctgt     41700
     gatgacctgc tgctgatctg tatcaatctg aataaccgtt tcgcctgtgt aaagcgtgat     41760
     cccgtgcttg tcgtaccaat ccttgctgtt cagtgtaata tcatcgagtg acgcttcacc     41820
     ctgcaataca gaggataaga gaatgcgatt gtaattggga tgcggctcgc ttccgaaaat     41880
     gacaatctca aacatgtggc gattcagctt taatacttct tcaatacagc ggattccggc     41940
     catgccgttt cccgctaaca ctaatctttg tttcttcatg tatcagacct cctttggcga     42000
     agctcgtaag ttttctccta ttaaaaatta tgtcacaatg cattgttaac gcattaaacg     42060
     tgtcacaaaa acttacacat gtcttttcca gaaaataatg gtcctatatc cttgattcag     42120
     aaaatgtaaa ataatgaggg tctagaaagg ggaatcttat gaagctgtcg gaactgaaaa     42180
     ctagcggtca tccactcact ttgctctgtt cctttttata ctttgatgtc agttttatga     42240
     tatgggttat gcttggggcg ctgggtgttt atatttctca ggattttggc ctgtctcctt     42300
     ttgagaaagg gcttgtcgta gctgtgccga ttttatctgg atctgtgttt cgtatcattc     42360
     ttggtatttt aacggacaga atcggaccga aaaaaacggc agtgatcggg atgctggtga     42420
     cgatgattcc gctgctttgg gggacattcg gcggccgttc cctgactgag ctgtatgcca     42480
     tcgggattct gcttggcgtg gcgggagcaa gctttgctgt agcgctgcct atggccagcc     42540
     gctggtatcc gcctcatttg cagggacttg cgatggggat tgccggagcg gggaacagcg     42600
     gcacgttgtt tgcaaccctg tttggccctc gtctggcaga gcagttcggc tggcacattg     42660
     tcatgggaat tgcgctaatt ccattattga tcgtctttat tctttttgta tccatggcaa     42720
     aggattcccc tgcacagccg tctccccagc cgctcaaaag ctatctgcat gtgtttgggc     42780
     aaaaggaaac atggtttttc tgcctgctgt acagcgtcac atttggcgga tttgtcgggc     42840
     tctcaagctt tttatctatt ttctttgttg atcaatacca gctgtcaaaa attcacgcag     42900
     gggacttcgt tacattatgt gtggcggcgg ggagcttttt ccggcctgtc gggggcttga     42960
     tttcagatcg tgtcggcggc acgaaagttc tttctgtatt gtttgtcatc gtggcactgt     43020
     gtatggccgg agtcagtagc ctgccatctc tctcaatggg ttatggtcct attgtttgtc     43080
     ggaatgatgg ggctcggaat gggaaacggc gcagtattcc agctcgtgcc gcagcgcttc     43140
     cgcaaagaaa tcggcatggt gacgggaatc gtcggtgcgg ccggaggaat cggagggttt     43200
     ttcttgccga acatcttagg atctctcaaa cagatgacag gcacatatgc tatcggttta     43260
     tcacgtttcc tgtatcgcgc tgctggcgtt tgcacttgtg cttgccgcag gctattactg     43320
     gcggaaaagc tggagcgcgg aaagcagccc ggcggatgtt taggattttg acggacacgc     43380
     gtttgtgcgt gtctttttta ttttctcttg attttcaaca gtgaaccgat caaaataaat     43440
     agtaattatt acgatttgtt agtgagagga gttttctgaa tgaatcaaca tacgctgctc     43500
     ccgaaaaaaa cggagcgtct tcaatacttt ggatcggtca gtccgatcaa aggcgagaaa     43560
     ccagtggaaa aagagaaaat gaaggacctg caaaatatca ggaaggatta tttttttgac     43620
     attcagcatg taggtgtagc taatgtgtcc catccagtca caatcacttc tgccatgatg     43680
     cctgccgagc aaacaacggc tgcgaacttt acaatgactt gtaatttgcc gagaaatcag     43740
     aaggggatta acatgagccg gttaacagag ctgctgcaag tctatcatca aaatggctgg     43800
     attctctcat tttcctctct tcagcaattt acgaaagagc ttgcagaaaa catggacaca     43860
     tcatctgcca cagttgaagt gaggtttccg tggtttttcg aacggaaaag cccgaagctt     43920
     gagaaagcgg gtttgatgca tgctgatata ttcatgtctg tcacctatcg caaagatcag     43980
     ccgtttaaac agcgtgccgg catctcagca aaagtaacga ctctgtgccc ttgctccaag     44040
     gaaatcagcg aatacagtgc ccataatcag aggggaacgg tcaagcattt gggccggata     44100
     ttcacccggg ccgcatcgct gccaagtgat gttaaagctg atttgcctca cgccgcagaa     44160
     tcaaatgctt ctgcgagact gcatccggta ttgaagcggc ctgatgaaaa agccgtgaca     44220
     gaaacggcct atgaaaaccc gagatttgtt gaggatctcg cccggctgat tgctgcagat     44280
     ttgtttgagc ttgaatgggt gtcagccttt gagattgaat gccgaaatga agaatcgatc     44340
     catcttcacc gatgcctatg cgaagtgtgt ttttcgaagg aagtggataa aatatgaaac     44400
     tctcattatt cattattgca gttcttatgc cagtcatcct gctgtcagcc tgctccgatc     44460
     atgcagaaga acacgcaagt atcaatacaa agaaaacggt cgaaaacata acggacgttc     44520
     gaaaaacagc aaaaacaagc attgattgga caaagccttc gggcggagaa tacccggata     44580
     ttaaacagaa gcatgtctgg attgatgtga atgtgaagga gcagaaggct tacatcaagg     44640
     aaggaagcaa caccatctat acaatgatga tttcttctgg tcttgatcaa acaaaagatg     44700
     atgctacgcc aaagggcacc ttttatgtag agcctgaacg gggagaatgg tttttctccg     44760
     aaggatacca ggaaggcgca gaatactggg tatcatggaa aaatcacggt gaatttttat     44820
     ttcatagtgt gccaatgact aaggatcaaa aagtcatcaa aacggaagca gaaaaactag     44880
     gaacgaaagt atctcacgga tgtatcaggc tgaccattcc agatgcgaaa tgggtatatg     44940
     aaaatatccc tgaacataca aaagtggtga tcagctgaat tgaaaaccgt tgacaaaaag     45000
     gaaaaaagac catacaattt aagtcgtaac aattacgttt tatgataaat ggcttatcat     45060
     tgtctgtgca tctgtgaaaa gcggaaaggc atcgattaag gatcttgctg tcggcaaagg     45120
     caaggatttg cgatggggaa aaggattaaa cgcggttgga gtctttactg atttagaaat     45180
     cgggcggcag cgagaaatga gcgccaaaag ctgctctaca ccattgtaca tacggcgaag     45240
     tattcaattt aaatcgtaat cattctattt taatggaggc actattatga aaaaaattcc     45300
     ggttaccgta ctgagcggtt atctcggtgc gggaaaaaca acattgctga acagcatttt     45360
     gcaaaatcgc gaaggcttga aaatagcggt tatcgtaaac gatatgagcg aggtgaacat     45420
     tgacgcgggc ttggttaagc aggaaggtgg cctttccaga acagatgaaa agcttgtgga     45480
     aatgtcaaat ggctgcattt gctgcacgct tcgcgaagac ttattaattg aagttgagaa     45540
     gctggcaaaa gacggacggt ttgattatat cgtcatcgaa tcgacaggaa tcagcgaacc     45600
     gatcccggtg gcccagactt tctcttatat cgatgaagag atgggaatcg atcttacaaa     45660
     attctgtcag ctggatacga tggtgacggt tgttgatgcc aaccgttttt ggcatgatta     45720
     tcagtcaggc gaaagccttc tggaccgcaa agaagcattg ggggaaaagg atgaaagaga     45780
     aatcgccgac ctcttgatcg atcaaattga gttttgcgat gtactgatct taaataaatg     45840
     tgatttggtc agcgagcaag agctcgaaca gcttgaaaac gttcttcgta aactgcagcc     45900
     aagagccagg ttcattcgtt ccgtcaaagg aaatgtaaaa ccgcaggaga ttttgcatac     45960
     agggttattt aacttcgagg aagcgagcgg atcggccggc tggattcaag agctgacggc     46020
     aggccatgcg gaacacaccc cggaaacaga agaatacggt atctcttcat ttgtatataa     46080
     gagacgtttg ccgtttcatt ctacacgatt ttaccgttgg ttggatcaaa tgccaaagaa     46140
     cgtggtacgt gccaaaggaa tcgtctggtg cgcatctcat aacaacctcg ctttgctgat     46200
     gtcgcaagca ggtccgtcgg ttacgattga gcctgtatct tattgggtgg cggcgttgcc     46260
     gaagcttgag caggagcaag tcaaacagca ggagccggaa atcctggagg agtgggaccc     46320
     ggagttcggc gaccgcctaa cgcagctagt ttttatcgga actgacctgg atgaagaaac     46380
     gatcacgaaa gagcttgatc aatgcctgtt gactgagtat gaatttgatt ccgactggtc     46440
     gctgtttgag gacccgttta aatggaagct gaatcaatag aaaaaaagcc gtcccatggg     46500
     gaacggcttt ttttaatgaa acgtttgttt aaacataatg agcgtatttt ttctcaagga     46560
     tattctgaaa gaccgcggca atggagcaga tggcccaata aatgagagcg gtcagaatat     46620
     acatggtcat ataatcaaac tctctgcccc cgatgatttt cgcatgctgg agcaattccg     46680
     gcactgtaat catcgcagcg agagaggacg ccttgatcaa gtcgagcaat acattggcaa     46740
     gcggaggcag cgcaatacgt atcgattgcg gcaaaatgat gcccctcatc gtctgccaat     46800
     aggaaagacc cagcgaggat gcggcttccc actgtccttt ttcgacggat gaaatggctg     46860
     aacggttaat ttccgcaatg taggcggcgc tgtttaggct aaagccgatt aaagcagccg     46920
     tgacagcgga aaattcaatg ccgatataag gaaacccgaa ataaaggata aacaaaatca     46980
     ccaaaatcgg aacgcctcgc ataaatgaga tatagagctt cgccggccat cttaacaaag     47040
     caagtttaga cattctggcg agtgatatga acaggccgat cacagttccc gcaaacatgc     47100
     ttacaaaaga gatgagcagt gtataaccaa tgccttttat gacataaggg aacgattcaa     47160
     tggccagctt cgtgttgaaa atatattccc actgaatgct attgatcatg gcgtccgatt     47220
     acaaatcaac gtcctgaacg tcggcatcaa ttttttttga tacatctgct ttattgaaga     47280
     attgtttcga cagtttagtc aaagagccat ccttgctcat ctctttcaat gcttcgttca     47340
     tctttttctg aagtgccgca ttgctttttt tcatgacaag ggcctgtttg ttcggcatgt     47400
     acttgatgtc aggatgaatt gtaatgttga gatccgggaa tgccgcgagc gcaagtgtct     47460
     gcaggtaata gtcgtttaaa atgacgtcag tgcgtccgtt ggcaacatct tttaaatatt     47520
     gctcattcgt cgcattatca taaatcactt ctttggcgcc gtattttctc gcgacctcca     47580
     tgtagacggt tgtagccgcg ccagccgctt tcttcccttt taaatccttg agcgttttaa     47640
     tccctgataa atcgtctttt cggacaattg ccgtgccgta tgaatattta tatggagtgg     47700
     aaaatgcgaa cttctcctca cggtccttcg tcacatcgat gtcattcgcg gctgcgtcaa     47760
     cctgtccgct gttcaccgct gtcagcatcc cgtcaatgcc catctccttg aactcaacct     47820
     tcagccccaa gcgttttgcc gcttcacgaa caacttcaac ctcgtagccc gtcagcttat     47880
     cagagccaga gtcagtatcg tgataagaag tgggatagag cgtacctgat gtagcgacta     47940
     cgattttccc tttatcctta atctgctccc agcctgtatc cttggaatcg gcttcatttt     48000
     tgccggaaca ggctgccaat ataagaaaga aagcccattg tgaaactgaa tataacggct     48060
     ttggaatgca tgaatgattt cacctatagt tcccccaatc tgttaatcaa ctaaaaagat     48120
     agcattgaac ataaggggtt gcaatatgtt gatcgcgttt tcaaaaagtt cgaattgtgt     48180
     atacaaaaag catgggtggg tgtttaaaag cgtctatgaa gggaagaggt gatgaaaaaa     48240
     ggaattgtcc aaggatgaat gccagacgta ccaaggaaac gcatgtgaaa gtgaaggatg     48300
     cagcagaccc gtcactcatc tatgccaata ccggaagaaa tggtcaagag gcatgaaacc     48360
     gatcttcaga ataaatttaa gtcttgctga tgcccctaag gcatatgata tattcgatga     48420
     gaaagaaaat ggaaacattt aaaccataat ggggagtcaa atgaatattt acaaaccagc     48480
     cggattttgg atcagacttg gagctgcatt gttagactac attatagtct ccgtgccgct     48540
     tttgctgatc tattggctga ttacaggaaa agacccaaac gacagcatgt tcatcagttt     48600
     ggttgttctg ctgtattcta ttttgctgcc gatgttttgg cgcggttatc ttatcggaaa     48660
     aaggatctgc ggaatcagaa tcgtaaaaaa agacggatca caggtcagtc tgttaacaat     48720
     gtttttacgg gttattgtag ccggcctggt ttactgtata accttcggac tcggcttgat     48780
     cgccagcctg attctgattg ccgtacgaga agacaaacgg accctgcatg atttaatcgc     48840
     gggaacatat gtcacttatg cgacaccagg tgaagaggaa cttaatgctg acgaagagat     48900
     tagaaagagc gaataatggt tcgctctttt tatttttatg cataaaaaat acaaggcagc     48960
     aaaacatatg aaaaatagga ttggaggaat aaaatggatg aaacgaataa ccatcaacat     49020
     tatcacaatg ttcattgcag cggctgtcat ttctctgacc ggtacagctg aggccgctga     49080
     aaaacagcag cagtctcccg caaatgttac actgacagat cagcaaaaga aagagattga     49140
     acaactggaa gcagagattc ttaaaaagcg caaagacgtg atctcaaagt atgtacaata     49200
     cggtatcctg cctaaagaaa gaggagaaca catcaaaaat cacttggaca aacactttga     49260
     aatgatgaaa caaaacggct ttgttccaaa gcaccatcct catccgcata aatttgaaaa     49320
     aagacattaa gattttaagc atccaatggg aattgggtgc ttttgcgtta tttacaggta     49380
     ggcaatatta gctgagctgt tccgcgacta acatcgagtt gatatgaaac gcgtttcata     49440
     gcctatgata ggtttatcaa ataattcagg agtgataaac actatgatcc accagcatcc     49500
     agaatctttt ccgaaacatt ttttgtgggg ctctgcttct gcagcgtacc agattgaagg     49560
     cgcttggaat gaagatggca aaggcccttc tgtttgggat gtgtttacga aaataccggg     49620
     caaaacgttt aaaggaacca atggcgagat tgcggttgac cattatcacc gatttaaaga     49680
     agatgtcgct ctgatggctg agatggggtt aaaagcatat cgattttccg tcagctggcc     49740
     acgggttttc ccaaaaggaa aaggagagat caatgaagca ggtctagcgt tttacgatag     49800
     tctgattgat gaattgcttt ctcatcacat cgagccggtt ctgactttat atcactggga     49860
     tttgcctcaa gcgcttatgg acgaatacgg cgggtttgaa tccagaaaca tcatagagga     49920
     ttttaatcac tactgtatta ctctttataa acgttttgga gacagggtga aatattgggt     49980
     tacgttaaac gaacagaact acaattttaa tcacggattt attacagcca tgcatccgcc     50040
     tggagtgaaa gacagaaaac gattttacga agcaaaccat attgcgtttc tggctaatgc     50100
     aaaagccatc gaatcattta gagaatatgt gcctgaaggc aaaataggtc ctagctttgc     50160
     ttattctccg gcttaccctt tatcaagtca tccagaggat atactggcat ttgaaaacgc     50220
     cgaagaattt acgaacaatt ggtggcttga catgtattgc tggggaacct acccgcaaat     50280
     tccattccgc tgcttggaaa aacagggatg ggcgccgaca attgaagcag gagatatgga     50340
     cctgctcgcc aaagggaagc ctgattttgt aggtgtcaat tattatcaga cgatcaccta     50400
     tgaacgaaat ccgcttgatg gtgtgtcaga agggaaaatg aatacgacag gccaaaaggg     50460
     aaccaatcag gagacgggga tacccggagt gttcaaaacg aaaaaaaatc cgcatctgac     50520
     aacgagcaac tgggattgga caattgaccc aattgggctg cgtatcggtc ttcgccgaat     50580
     tacaagccgc tatcagcttc cagtgtttat aacagagaac ggtttgggtg aatttgataa     50640
     agttgaggac ggcactgtac aggatgatta tcgaattgat tatttgcgtt cgcatcttga     50700
     gcaatgcaga caagccatca gtgacggtgt cgatttaatc ggctattgca gctggtcgtt     50760
     tactgatctg ttaagctggc tgaacggcta ccaaaaaaga tacggatttg tatatgtcaa     50820
     tcgtgatgaa gaaagcacat ccgatttaaa acgcttgaag aaaaaaagct tttattggta     50880
     tcaagatgtc atcaagacaa acggagaaag tttataaaga gtccctgaga gttattctct     50940
     caggggtttt tcattacaca gaaacagcat caataatata agtgtcggcg tgcaaatctg     51000
     acatttcagc cggcacagtc cagcatgtca attgatagtc tcctttaggc aaatcaaagg     51060
     acagtctttt agacatgatg ctttcaatat gaattccgtt ttctgtgaca tgaaaaggaa     51120
     cagtcacttt tttttcgtag gagtttactg tttctgaact gttcaggcga aaaagaataa     51180
     aggcctttgt atttcgctgt gcctcaaagg aaatggctcc gtctgccgca gcatatcctt     51240
     tttcaatcgc ttcgtcagtc caatccatta caggaggtgt agaatccttt tgaaatacag     51300
     taaattgatg atatgaaatc gaaagttctt gcggcttcca tgatttgatc aatgtgctgt     51360
     tcctcctcta tgtactgttt actgaattgt gaataaaacc tttgtgccgt ctgggtaatc     51420
     ggtaagccga tgcccgaccc aagagcctgc tccgcggttg tcagcgggag aaatgtattc     51480
     tacagaagct ccctcaccgc cttctttgca catggccatt ggccattcat ctctgtcata     51540
     cccctttttg gaaggtacgt cctttaatga ttgctcgcgg cgttcttcag ctccgtctct     51600
     gtcaatagtg cacacctctg agtgcccctc atttatcgca tccttaatat gcttggcagt     51660
     ttcgggatac cggtcagatg ggaaggccat tgtttcatca tattctttcg tttgagacgt     51720
     tttttgatca gctgagaaaa agtctccttt tatcaggccg acagctgcag ctgctatgat     51780
     gacgatgacg agaagtatcg tttttatgat gtccgtcgtg atgttcacct cccgctttta     51840
     aaactgacac aagagtaatc cagaaagcat ttggtgtaaa ggtttaaatt ttatgtttta     51900
     cgatcagttt attgcagaaa tcgtaatttt agcagatcga aatatttgtt ttcagcaaaa     51960
     tacgattgcc aatttacaat aatgatagta agtcatcagc cgttttcggc ttgattaatc     52020
     attttaaatt ggcttatgat accggtaagc tcctcagcta attgagaaag tgtttcagaa     52080
     gctgcggtaa tctcctccat tgcagcaaat tgctcctctg ttaatgcagc cgcttgccgg     52140
     gtatttttag tagattcttt aatgtcggcc gtattggctg caaaggaatc atttatttga     52200
     tgtgcactgg ctgaaatgtt tgttacagat gctgataaat cactaatctc ggcgctgatt     52260
     tcacctgttg cagctgcaat ttccttaaat gcatctctgg tgcgctggat catggtgact     52320
     ccttctgcag cttctgtttt cacatgctca acagatcttg cagaccggtt catatccttt     52380
     tgtatttcta tgatcagttt tgaaatctgc cccgcagact gttgagactc ttctgctaat     52440
     ttccgtactt catcagcaac aacagcaaag ccttttcctt gttcaccggc tctggcagct     52500
     tcaatcgctg cattcagcgc aagcaggttt gtctgatcag caatttgggt gatgaccgat     52560
     aaaatttgct caatttgttt agagcggccg tctaactggt gtatgatttc tccgcttttc     52620
     tgaattgact ggtgaatcgc atccatttgc gcctgtacat ttgcaatttc cttttgtcca     52680
     atgtctgctt ttgattgagc gagctgccct ttgtcagcga taggggcagt atttgcagaa     52740
     atatcccgga tgtctgctga agcttgtttt aatgagcttt cactattttc aattcgggtg     52800
     atctgatctt gggctccatt tgcaatctgc tgtacagctt ctgtgatttt ttctgaagct     52860
     tgatttgttt cctctgctcc ggctgagagc tgctgagagg ctgacgcaag ctgaagggct     52920
     gattgttgta cggtttgtat ggtatcgttc agcttcattc tcatcttatt ataatagacg     52980
     cttagttctg aaagctcgtc accggttttg tctgacacct ctattgtcat atctccgttt     53040
     ccggcacttt caaaggcgct ttttaaagcg gtcagccgct tgttgatttt tctggtgaaa     53100
     accaagacaa ggatgactga taccataatg acgataacaa gaacgatagc gaattgagtg     53160
     aaaagtgatt gtgtaagtga tgctaaaata ctttgattag ctccggtata cagcatgccg     53220
     atgatgttcc cattttgatc ttttaacggc atgtatgcag tctgataaga agaacctgct     53280
     acatctgctt gtccgtaaaa acgctttcct ttctttaaaa cagcggcaat aacttcagaa     53340
     gaagcctggg tgccgacggc tctttcgcca tttttcatga cattggttgc aacacgagta     53400
     tcgccttgga aaatggtaat ggtatcacct gtcttttcac caagcagatc aacaatatct     53460
     tcatttccat tgatttgtgt ttgcccttta tagagcttat tgtttttcac ctgccagtcg     53520
     cctgacatga catcatcaat ataagtgctg cttaaagcga gatcaccttt cgctttttca     53580
     gttgccattt gtttcatgct ttctgtaatt tccttaagca tcacagtgcc aactgatgcc     53640
     gaaaacaaaa gaatcaccac gaaaacgagg caaagaattt tagttcctag cttcatctta     53700
     aatcgtttta tcaacataat tcctcccttt acgatttgca ggtcatatta cttatcgggt     53760
     ttttgggttt aaagttttat tttagaaaaa ataaaaccgg cctgatcttc aggccggttg     53820
     tgtgatgcta ttcaaggttt gcgtggtgag tgaacatagt ttcagaatcg agaccttttt     53880
     tctccatgag ttttaaaatc actgcatcat agaagagcag caaagtttgt tcaaataatg     53940
     atcccattgg ctgaatggtt ttatagcttc cgttagactg gtctttaggg gaaccaggca     54000
     ttctgatgat gaggtccgct tgttttccga tgcttgattc cggattgatg gttaaagcgg     54060
     caacaattcc gtgtaagctt tttgcttttg ctgcggtatg aatcaagctc tttgtctcgc     54120
     ctgatcctga gccgataata actagatctc cttcggcgag cggcggagtg agaatctcac     54180
     ctactatatg ggcgttgaag cccatgtgca tcagtctcat cgcgaaggat tttgccatca     54240
     ggccagaccg ccccgcaccc gcggtgaaaa tttggtggga tgaaagaatg tgatcggcaa     54300
     gctggtcagc ttcttcatta gaaatataag ctgctgaatt gtgtaactca ttgagaattt     54360
     ccgctacgta ttcagtcgtt ttcatcggag ttatccttgg acaatcagct gcttcatttt     54420
     tgaagctgtt tccgccttat cagctgcgct tgtaattccg cccccgacaa tgacaaggtc     54480
     aggcttttgc tggatcactt ctggcagtgt atcaagtttg atgccgccgc gattgcggtt     54540
     tttgcgtttt ttacggtatt tttgattgtc gttaattctt cgaaagagtt tttgccctct     54600
     gcttgaagat catagccagt gtggacgcag atgtagtcaa caccgagtgc gtcaatttct     54660
     ttcgcacggg attcgatatc tgtcacgtta atcatgtcca ctaagatttt cttcttttgt     54720
     tttttggctt cttctactgc gcctttaatc gttgcatcgt ctgtagcccc taaaacggtg     54780
     atgatgtcag cgcctgcttc cgacgctttc ataatttcgt agcctccggc atccatgatt     54840
     ttcaggtctg caagaacctt caattgagga aatgcttctt ttatttcttt aacggctctt     54900
     aggccttcat tgatgacgac cggtgttccg atttcaacta cgtcgatgta ttgttctacc     54960
     tctttgacaa gctcaatggc ttccgggatg ttgacgaggt ctaatgcaag ctgtaattcc     55020
     attgttgatc cactcccttt tcgaattatt gttcattcta taggttcctt cttttgttga     55080
     gaagtaggca ctttgaagtc aacaagttac ttggaggata ctgtgaggag agacaatcag     55140
     atttctttcg cttgatttta tgagtgagta taatgaaaaa agagtctgca aaaaagtaag     55200
     taagtgatga tacgtatcta acatacaaaa aggttactaa ggggggattc tatttgagcc     55260
     ggatggacga caaaaggttt aattgtgaga aggaattaac gcttgcagtg attggcggta     55320
     aatggaaaat gctcatttta tggcatttag gaaaagaagg cacaaaacgg ttcaatgaat     55380
     taaaaacatt gattcctgat attacgcaga agatcctcgt gaatcagctg agagagcgtg     55440
     agcaggatat gattgttcac agggaagtgt atccagttgt cccgccgaag gttgaatatt     55500
     ctctgacccc gcacggagaa agcctcatgc ctattcttga agccatgtat gagtggggga     55560
     aaggctatat ggaagtgatt gatatcgaca aaaatgtcat gaaagaatcg ttgtaagacg     55620
     ctcttcgcaa gggtgtcttt ttttgccttt ttttcggttt ttgcgcggta cacatagtca     55680
     tgtaaagatt gtaaattgca ttcagcaata aaaaaagatt gaacgcagca gtttggttta     55740
     aaaattttta tttttctgta aataatgttt agtggaaatg attgcggcat cccgcaaaaa     55800
     atattgctgt aaataaactg gaatctttcg gcatcccgca tgaaactttt cacccatttt     55860
     tcggtgataa aaacattttt ttcatttaaa ctgaacggta gaaagataaa aaatattgaa     55920
     aacaatgaat aaatagccaa aattggtttc ttattagggt ggggtcttgc ggtctttatc     55980
     cgcttatgtt aaacgccgca atgctgactg acggcagcct gctttaatag cggccatctg     56040
     ttttttgatt ggaagcactg ctttttaagt gtagtacttt gggctatttc ggctgttagt     56100
     tcataagaat taaaagctga tatggataag aaagagaaaa tgcgttgcac atgttcactg     56160
     cttataaaga ttaggggagg tatgacaata tggaaataac tttttaccct ttaacggatg     56220
     cacaaaaacg aatttggtac acagaaaaat tttatcctca cacgagcatt tcaaatcttg     56280
     cggggattgg taagctggtt tcagctgatg cgattgatta tgtgcttgtt gagcaggcga     56340
     ttcaagagtt tattcgcaga aatgacgcca tgcgccttcg gttgcggcta gatgaaaacg     56400
     gggagcctgt tcaatatatt agcgagtatc ggcctgttga tataaaacat actgacacta     56460
     ctgaagatcc gaatgcgata gagtttattt cacaatggag ccgggaggaa acgaagaaac     56520
     ctttgccgct atacgattgt gatttgttcc gtttttcctt gttcaccata aaggaaaatg     56580
     aagtgtggtt ttacgcaaat gttcatcacg tgatttctga tggtatgtcc atgaatattg     56640
     tcgggaatgc gatcatgcac atttatttag aattagccag cggctcagag acaaaagaag     56700
     gaatctcgca ttcatttatc gatcatgttt tatctgaaca ggaatatgct caatcgaagc     56760
     ggtttgaaaa ggacaaggcg ttttggaaca aacaatttga atcggtgcct gaacttgttt     56820
     ccttgaaacg gaatgcatcc gcagggggaa gtttagatgc tgagaggttc tctaaagatg     56880
     tgcctgaagc gcttcatcag cagattctgt cgttttgtga ggcgaataaa gtcagtgttc     56940
     tttcggtatt tcaatcgctg ctcgccgcct atttgtacag ggtcagcggc cagaatgatg     57000
     ttgtgacggg aacatttatg ggcaaccggc aaaatgcgaa agagaagcag atgcttggca     57060
     tgtttgtttc tacggttccg cttcggacaa acattgacgg cgggcaggcg ttttcagaat     57120
     ttgtcaaaga ccggatgaag gatctgatga agacacttcg ccaccaaaag tatccgtata     57180
     atctcctaat caacgatttg cgtgaaacaa agagctctct gaccaagctg ttcacggttt     57240
     ctcttgaata tcaagtgatg cagtggcaga aagaagagga tcttgccttt ttgactgagc     57300
     cgattttcag cggcagcgga ttaaatgatg tctcaattca tgtaaaggat cgatgggata     57360
     ctgggaaact caccatagat tttgattacc gcactgattt attttcacgt gaagaaatca     57420
     acatgatttg tgagcgcatg attaccatgc tggagaacgc gttaacgcat ccagaacata     57480
     caattgatga attaacactg atttctgatg cggagaaaga gaagctgctt gcgagggccg     57540
     gcggtaaatc tgtgagctac cgtaaggaca tgacgatacc agagctgttc caagaaaagg     57600
     ctgaactgct ttctgatcat ccagcggttg tatttgaaga tcgcacattg tcctatcgaa     57660
     cgttacatga gcaatctgca cgcatcgcca atgtgctgaa acagaaaggg gttggcccgg     57720
     acagtcctgt cgcggttttg attgaacgct ctgaacggat gattacagct atcatgggaa     57780
     ttttaaaagc cggcggagcc tatgtggcga ttgatccggg ttttcctgct gagcgcattc     57840
     aatatatttt ggaggactgc ggggcggatt tctacctgac tgaatcgaag gttgcggcgc     57900
     ctgaagccga tgctgagctg attgacttag atcaggcgat tgaggaaggt gcagaagaaa     57960
     gcctgaatgc agatgtgaac gctcggaacc ttgcctacat tatttacaca tcgggaacaa     58020
     ccggacgccc gaaaggcgtt atgatcgagc atcgccaggt tcatcatttg gttgaatctc     58080
     tgcagcagac gatttatcaa agccccaccc aaaccctccc catggcattc cttccgccgt     58140
     tccactttga tgcgtcagtg aagcagatct tcgcgtcgct tcttttgggc caaacccttt     58200
     atatcgtacc gaagaaaaca gtgacgaacg gggccgccct tactgcatat tatcggaaga     58260
     acagcattga ggcgacggac ggaacaccgg ctcatttgca aatgctggca gcagcaggcg     58320
     attttgaagg cctaaaactg aagcacatgc tgatcggagg agaaggcctg tcatctgttg     58380
     ttgcggacaa gctgctgaag ctgtttaaag aagccggcac agcgccgcgt ttgactaatg     58440
     tgtacgggcc gactgaaacg tgcgttgacg cgtctgttca tccggttatc cctgagaatg     58500
     cagttcaatc agcgtatgtg ccgatcggga aagcgctggg gaataaccgc ttatatattt     58560
     tggatcaaaa aggccggctg cagcctgaag gcgtggcggg tgagctttat atcgcgggag     58620
     acggtgtggg ccgaggctat ttacatttgc ctgaattaac ggaagagaag tttttacaag     58680
     atccattcgt gccgggcgat cgcatgtacc ggaccgggga cgtggtgcgc tggcttccag     58740
     atggaacaat cgaatattta ggcagagagg atgaccaggt caaagtccgc ggataccgga     58800
     ttgagcttgg ggaaattgaa gccgtgattc agcaggcgcc agacgttgca aaagccgttg     58860
     ttttggcacg ccctgacgaa cagggaaatc ttgaggtttg cgcatatgtt gtgcagaagc     58920
     ctggaagcga atttgcgcca gccggtttga gggagcatgc ggccagacag cttcctgact     58980
     atatggtgcc ggcttacttt acagaagtga cagaaattcc gcttacacca agcggcaaag     59040
     tcgaccgccg caagctgttt gcactagagg tgaaggctgt cagcggcact gcctatacag     59100
     cgccgcgaaa tgagactgaa aaagcaatcg cagccatttg gcaggacgtg ctgaacgttg     59160
     agaaggcggg gatctttgac aatttctttg aaactggcgg acattcatta aaagccatga     59220
     cccttttaac aaagattcat aaggaaacag gcattgagat tccgcaacaa tttttgtttg     59280
     agcatccgac gattacggct cttgcagagg aagctgatca cagagaaagc aaagcttttg     59340
     cggtgattga acctgctgaa aaacaggagc attacccgct tcattggcac agcagcgaac     59400
     atatatcgtc agccagttcg aggatgcggg agtcggctat acatgccagc agcagcaatt     59460
     ctgaaggctt tagatattca aaagctggag cgcgcatttc agggattaat ccgacgccac     59520
     gagtcattga gacatcattt gttcttgaaa acagcacgcc gagacagaaa attcacgtat     59580
     gcgttgattt caacatcgaa atgattgaaa gaggcggccg ctcagatgag gcaattatgg     59640
     cttcattcgt tcggacattt gatttggcga aagctccgct gttcagaatc ggtttgctgg     59700
     ggcttgaaga gaaccgtcat atgctgctgt ttgacatgca ccatttgatt tctgacggtg     59760
     tatccattgg cattatgctg gaggagttag cacgcattta taaaggcgaa cagcttcctg     59820
     atcttcgtct ccagtataag gactacgctg tatggcaaag cagacaggct gctgaagggt     59880
     acaagaagga ccaggcttat tggaaggaag tctttgcagg cgagctcccg gtgcttcagc     59940
     ttctgtccga ttacccaaga ccacctgttc aaagctttga aggggatcgg gtgtcaatca     60000
     agctggatgc gggggtaaag gatcgcctca atcgtttggc tgaacaaaac ggcgccactt     60060
     tatatatggt gatgctttcc gcttactata cgcttttgtc aaagtatacg gggcaggatg     60120
     acatcattgt cgggacaccg tcagcgggca gaaatcactc cgatacagag ggcattatcg     60180
     ggatgttcgt caatacgctt gcgattcgca gtgaggtgaa gcagaatgag acgtttaccc     60240
     aattgatctc gcgtgtccgc aaacgggtgc tggatgcctt ttctcatcag gactatccgt     60300
     ttgagtggct tgttgaagat ttgaacatcc cgcgtgatgt tagcaggcat ccgctgtttg     60360
     acacgatgtt cagccttcaa aacgcgacag agggcattcc ggctgtcggc gatctttcct     60420
     tgtctgttca agagaccaat ttcaagattg ccaaatttga tttgacggtg caggcgagag     60480
     aaaccgatga aggcattgag attgatgtgg attacagcac aaagctgttt aaacaaagca     60540
     cggcagacag gctgcttacg cattttgcgc gtttgcttga agatgctgcg gctgatccag     60600
     agaagccgat ttctgagtat aagcttcttt ctgaagagga ggctgcttcg caaattcagc     60660
     agtttaaccc gggcagaaca ccttatccga aagataaaac aattgttcag ctgtttgagg     60720
     agcaagcggc gaatacgcca gaccacactg cgcttcaata tgaaggcgaa tcactcactt     60780
     atcgtgaact gaatgaacgg gccaatcgtt tagcccgcgg cattctttct cttggagctg     60840
     gcgaaggcag aactgcggct gtcttatgcg agcggtcaat ggatatgatt gtgtcgatct     60900
     tggcagtatt aaaatcaggt tcggcttatg ttccgatcga tccggaacat ccgattcagc     60960
     ggatgcagca tttcttccgt gacagcggag caaaggtgct tctcactcag aggaaattaa     61020
     aggctttggc ggaagaagcg gaatttaagg gcgttatcgt gctagccgat gaggaagaaa     61080
     gctatcatgc cgatgcgcga aatctcgcac tgcctcttga ttctgcagca atggccaacc     61140
     tgacgtatac ttccggaacg actggaacac ctaaggggaa tatcgtgaca catgccaata     61200
     ttctccgcac ggtgaaggaa acgaattatc tcagcattac agaacaggat acgattctcg     61260
     gtctttccaa ttacgtgttt gacgcgttta tgttcgatat gttcggctct ttgttaaacg     61320
     gagccaagct ggtgctgata ccgaaggaaa ccgttttgga catggctcgc ctgtcccgcg     61380
     tcattgaacg ggagaacatc agcattctca tgattacaac cgctttgttc cacttgcttg     61440
     tggacttgaa tccggcatgc ttgtcaacgc ttcgcaagat tatgtttggc ggggaacggg     61500
     cttcggttga gcatgtcaga aaagctttgc aaacggttgg aaagggcaag ctccttcata     61560
     tgtatggacc gtctgaaagc acggttttcg cgacgtatca tccggttgat gaattggagg     61620
     agcacacgct gtctgttccg attggaaaac cggtcagcaa tacggaagta tacattcttg     61680
     accgtacggg acacgtgcag cctgccggga ttgccggaga gctttgcgtc acgggcgaag     61740
     gactcgtgaa aggctattac aaccgtccag aactgactga ggagaaattt gttccccatc     61800
     cgtttacatc cggcgaacgc atgtataaaa cgggagacct tgcgagatgg ctgccgaatg     61860
     ggaccatcga atttatcggg cgaatcgacc atcaggtgaa gattcgcgga caggccatcg     61920
     agcttggaga aatcgaacat cagctgcaaa cccatgatcg tgttcaggaa agtgttgtgc     61980
     ttgccgttga tcaaggagcg ggagataaac tgttgtgtgc ttactatgtc ggagaaggag     62040
     acatctcatc acaagagatg agagagcatg ctgcgaagga cttgccggca tatatggttc     62100
     ctgcggtgtt tatccaaatg gacgagctgc cgctgacagg gaacggaaaa attgaccgga     62160
     gagcgctgcc gattcctgat gccaacgttt caagaggtgt ttcatatgtt gcgccacgca     62220
     atggaacgga acaaaaagtc gcggacattt gggcacaggt acttcaggca gaacaagtcg     62280
     gcgcttatga ccacttcttt gacattggcg gacattcatt agcaggcatg aagatgcctg     62340
     ccttggttca tcaggaactg ggcgttgagc tgtcactcaa ggatctcttc cagtcaccga     62400
     cggttgaggg cttggcacag gtgattgcct ctgctgaaaa agggacagcc gcaagtatca     62460
     gcccggcaga gaaacaagat acgtatcctg tttcttcacc gcaaaaacgg atgtacgtgc     62520
     ttcagcagct tgaggatgcg caaacgagct ataacatgcc ggcggttctg cgcctgacag     62580
     gtgagcttga tgttgaaagg cttaacagcg tcatgcagca gttaatgcag cgtcatgaag     62640
     ccttgagaac cacgtttgaa ataaaagatg gagaaacggt gcagcggatc tgggaagagg     62700
     ctgagtgcga gatagcctat ttcgaagccc cggaagaaga gacagagcgg atcgtttctg     62760
     agtttattaa gcctttcaaa atcgaccaac ttccactgtt cagaataggg cttatcaagc     62820
     attcagacac tgagcaggtg ctgctgttcg atatgcatca tattatttct gatggtgcat     62880
     ctgtcggtgt gctgattgag gagctttcaa agctgtacga cggagaaacc cttgagccgc     62940
     tccgtattca atataaggat tatgccgtgt ggcagcacag gttcattcag tctgagcttt     63000
     acaagaagca agaagagcat tggctgaagg agctcgacgg agagctgccg gtgctgacgc     63060
     ttccgactga ttacagtcgg cctgccgttc aaacatttga gggagaccgc attgcatttt     63120
     cattagaagc aggcaaagct gatgctctgc gcaggcttgc aaaagaaacg gattccacgc     63180
     tttacatggt gcttctggct tcatacagtg cgtttttatc aaaaatttgc gggcaagacg     63240
     atatcatcgt cggttcacct gtggccggac gatctcaagc ggacgtcagc cgcgtcatcg     63300
     gaatgttcgt caatacattg gcgctgcgca cgtatccgaa gggtgaaaag acgtttgctg     63360
     actatcttaa cgaagtgaaa gaaactgcac tcagcgcttt tgatgcgcag gattacccac     63420
     ttgaggattt gatcggaaat gttcaggttc agcgtgacac aagcagcaat ccgttattcg     63480
     atgcagtttt ttcaatgcaa aatgcgaata taaaggattt aacaatgaaa gggattcagc     63540
     ttgagccgca tccgtttgaa cggaaaacag ccaagtttga cctcacgctg acggctgacg     63600
     aaaccgacgg agggcttaca ttcgtactcg aatacaatac agctctgttt aagcaggaaa     63660
     cgattgaacg atggaagcaa tattggatgg agcttttaga tgcagttact gggaacccga     63720
     accagccgct ttccagcctg tcactggtca ccgagacaga aaagcaagcg cttcttgagg     63780
     cttggaaggg caaagcgctg cctgtgccga cagacaaaac ggttcatcag ctattcgaag     63840
     agactgccca gcgccacaaa gaccgcccgg ctgtcacata caacggccag tcttggacgt     63900
     acggcgagct gaatgcgaag gcaaaccgtc tcgcgcggat tctgatggac tgcggcatca     63960
     gcccggatga ccgcgtcggc gttctcacga agccgtcgct tgaaatgtcc gccgcggtgc     64020
     tcggcgtctt gaaagccgga gcggcgtttg tgccgattga tcctgactat ccggatcagc     64080
     ggattgagta tattttacag gacagcggcg cgaagcttct cttgaaacag gaaggcattt     64140
     cagtgccgga cagctatacg ggagatgtca ttcttctcga cggaagccgc acgattctaa     64200
     gcctgccgct tgatgaaaac gacgaggaaa atccagaaaa tccagaaacc gctgtaaccg     64260
     cggagaactt ggcgtacatg atttacacgt ctggaacgac cggacagccg aagggtgtca     64320
     tggtcgagca ccatgcgctt gtgaacctgt gcttctggca ccacgacgcg ttcagcatga     64380
     cagcggagga ccgcagtgcg aagtacgcgg gctttgggtt cgacgcttcc atttgggaga     64440
     tgttcccgac ctggagcatc ggtgccgaac ttcacgtcat tgaggaagcg atccgcctcg     64500
     atatcgtccg cctgaacgat tattttgaaa cgaacggcgt aacgatcacg ttcctgccga     64560
     cacagcttgc ggaacagttc atggagcttg agaacacatc acttcgcgta ttgcttactg     64620
     gaggagacaa gctgaagcgc gcagtgaaaa agccgtacac actcgtcaat aactacgggc     64680
     cgacagagaa tacggtcgtt gccacaagcg cagaaatcca tccggaggaa ggctcgcttt     64740
     ccatcggaag ggccattgcc aatacgagag tatacattct cggcgagggc aatcaggtgc     64800
     agccggaagg cgtagccgga gagctttgcg tggcggggcg cggactggca cgcggctatc     64860
     tgaatcgaga agacgaaacc gcgaagcggt ttgtcgctga tccgtttgtg ccgggtgagc     64920
     gcatgtaccg caccggcgat ttggtgaaat ggacgggcgg cggcatcgaa tacatcgggc     64980
     ggatcgacca gcaggtcaag gtccgcggct accggatcga gctctcagaa attgaagtcc     65040
     agctcgccca gctttctgag gtgcaggatg cggcggtgac agctgtcaaa gataaaggcg     65100
     gcaacacagc gatcgcggcg tatgtcacac cggaatcagc tgacatagaa gcactgaaat     65160
     cagcactgaa ggaaaccctg ccggattaca tgatcccggc gttctgggtg acgctgaacg     65220
     agcttccggt tacggcaaac ggcaaagtgg accgcaaagc cttgaatgag ccggacatcg     65280
     aagcgggaag cggagaatac aaagcgccga cgaccgacat ggaagagctg cttgccggca     65340
     tctggcagga cgtgcttgga atgtctgaag tcggtgtcac cgacaatttc ttctcgcttg     65400
     gcggagattc catcaaagga attcaaatgg cgagccgctt gaaccagcac ggctggaagc     65460
     tggaaatgaa agatctcaac cagcacccga cgatcgaaga gctcacccag tacgtagagc     65520
     gtgccgaagg caaacaggca gaccaaggcc cggtggaggg cgaagtcatc ctgacgccga     65580
     tccagcgctg gttctttgaa aagaacttca cgaacaagca ccactggaac caatctgtga     65640
     tgcttcacgc caagaagggc tttgatcctg aacgggtgga gaaaacattg caggcgctga     65700
     tcgagcatca tgacgcgctc cgcatggtct atcgtgaggg acaggaagac gtcattcaat     65760
     acaacagagg tcttgaagct gcttcagctc aattggaggt catccagatt gagggccaag     65820
     ctgcagatta cgaagaccga atagagagag aagcggagcg tttgcaaagc agcatcgact     65880
     tgcaggaagg cggcttgtta aaagcaggct tgttccaagc ggaagacgga gatcacttgc     65940
     ttcttgccat tcaccactta gtggttgacg gcgtgtcgtg gcggatttta ctggaggatt     66000
     tctccgcggt atatacacag cttgagcaag gcaatgaacc ggttctcccg cagaaaacac     66060
     attcatttgc agagtatgca gagagattgc aagacttcgc gaactccaaa gcctttttga     66120
     aagaaaaaga gtattggtca cagcttgaag aacaagctgt tgcggcaaag cttccgaaag     66180
     accgcgaatc tggtgatcag cgaatgaaac atacaaagac aattgaattc tcgctgactg     66240
     ctgaagagac agaacagctc accacaaagg tgcatgaggc atatcacaca gaaatgaatg     66300
     atattttgct gacggcattc ggattggcaa tgaaggagtg gacgggtcaa gatcgagtaa     66360
     gtgttcattt agaggggcat ggacgtgaag aaatcataga agacctgacc atttctcgca     66420
     cagtcggctg gtttacaagt atgtacccaa tggtgctcga tatgaagcat gcggatgatc     66480
     tgggctacca gctgaagcaa atgaaagaag atatcagaca tgtgccgaat aagggagtcg     66540
     gatcaggcat tctgcgctat ctgacggcac cggaacataa agaagatgtg gcgttctcga     66600
     ttcagccgga tgtcagcttc aactatttag gtcagtttca ccaaatgtcc catccacctt     66660
     tctttaccac atcacacctc ccatcaccac actcattaag ccctgaaaca gaaaaaccga     66720
     atgcgctgga tgttgtcgga tatatcgaaa acggaaaact gacgatgtca ctggcctatc     66780
     attctcttga atttcatgaa aaaacagtac aaacattcag tgacagcttt aaagcgcatc     66840
     ttctcagaat cattgaacat tgcctatctc aagatggtac ggaactgacc ccgagtgatc     66900
     ttggtgacga cgatttgacg ctggatgagc tggataaatt aatggaaatt ttctaataga     66960
     ggtggcatat gagcaaaaaa tcgattcaaa aggtgtacgc actgacacca atgcaggagg     67020
     gaatgctgta tcatgcgatg cttgatccgc attcttcctc gtactccaca caattagagc     67080
     ttgggattca cgccgctttt gatcttgaaa tctttgagaa aagcgtcaat gaactgattc     67140
     ggtcatacga tattctccgt acggtatttg tgcatcagca gctgcaaaaa ccgcgtcagg     67200
     tcgtgttagc ggaacgcaaa acaaaagtgc attatgagga tatcagtcat gcagacgaaa     67260
     accgccagaa agagcacatt gagcgttaca aacaacaggt tcagcgccaa gcctttaacc     67320
     tggcaaaaga catattgttc aaggtagcgg ttttccgcct tgctgcagat cagctgtatc     67380
     ttgcttggag caatcatcat attatgatgg acggctggag catgggcgtc ctcatgaaaa     67440
     gcctgttcca aaactatgaa gcgctcagag caggcaggac accggcaaac ggtcagggca     67500
     agccttattc cgattacatc aagtggcttg gaaaacagga caatgaagaa gcggagagct     67560
     actggagcga gcgcttggcg ggttttgaac agccaagcgt gctcccgggc cgcctgcctg     67620
     tgaaaaaaga cgaatacgtc aataaagaat attcatttac atgggacgaa acactggttg     67680
     cccgtattca gcaaaccgca aatctccatc aagtgacagg gcctaaccta tttcaggccg     67740
     ttttgggcat tgttctcagc aaatacaact ttacggatga tgtgatcttc ggaacggtcg     67800
     tctcgggacg accgtctgaa atcaacggaa tcgaaacgat ggcggggctg tttatcaaca     67860
     ccattccagt gcgggtgaaa gttgaacgag atcgtgcatt cgctgatatt ttcacagctg     67920
     ttcagcagca tgcagtagag gcagagcgtt acgattacgt gccgctctat gagattcaaa     67980
     aacgctcagc tcttgatggc aatctcttaa accatctggt cgcgtttgaa aattatccgc     68040
     ttgatcaaga gcttgaaaac ggcagcatgg aagaccgcct cgggttttcg attaaggtag     68100
     aaagcgcatt tgaacaaacg agcttcgatt tcaacctgat tgtgtatccg ggcaaaacgt     68160
     ggaccgtcaa aattaaatat aacggagccg cctttgattc cgcttttatc gaacggacag     68220
     cggagcacct tacccgcatg atggaagcag ctgtcgatca gccggccgct tttgtgcgtg     68280
     agtacgggct tgtgggagac gaagagcagc ggcaaattgt cgaggtgttt aacagcacga     68340
     aagccgaact ccctgaagga atggctgttc accaagtgtt tgaagagcaa gcgaaacgga     68400
     cgccggcgag caccgccgtc gtatatgaag gaaccaagct gacgtaccgc gagctgaatg     68460
     cagcggctaa ccgtctggcg agaaagcttg tcgaacatgg gcttcaaaaa ggggaaacag     68520
     cagcgattat gaacgaccgc tcagtagaaa ccgttgtcgg catgctggct gttttaaaag     68580
     caggcgccgc atatgtgccg cttgatccag cgcttcctgg ggatcgtctt cgtttcatgg     68640
     cagaggacag ctccgttcga atggttttga tcggaaattc ttatacaggg caggcacatc     68700
     agctgcaagt gccggttctt acactggaca taggctttga agagagtgaa gcggctgaca     68760
     atctcaacct gccatccgcc ccgtctgatt tggcgtacat catgtacaca tccggttcaa     68820
     cgggcaaacc gaaaggcgtc atgatcgaac ataaaagcat tctgcgcctc gtcaaaaatg     68880
     ccgggtacgt tcctgttact gaagaagacg caatggcgca aacgggagct gtcagctttg     68940
     atgccggaac gtttgaggta ttcggcgcac tgctgaatgg cgcagcactt tatccggtca     69000
     aaaagagaca cgtgcttgat gcgaaacaat ttgctgcatt cctgcgtgag caaagcatca     69060
     caactatgtg gctgacatca cctttattca accagcttgc tgcaaaggat gcgggtatgt     69120
     tcggcacact gcgccattta atcatcggcg gagatgccct tgtcccgcat attgtcagca     69180
     aagtaaaaca ggcatcgccg tcgctttcat tgtggaacgg atacggcccg acagaaaaca     69240
     cgacgttttc aaccagtttt ctgatcgacc gcgagtatgg cggctctatc ccaatcggga     69300
     agccgatcgg aaattccact gcctatatta tggatgagca gcaatgcctg cagccaatcg     69360
     gcgcgcctgg tgagctttgc gtaggcggaa tcggtgtagc gcgtgggtat gtcaatctcc     69420
     ctgagctgac ggagaagcaa tttctggaag acccgttcag accgggtgag agaatttacc     69480
     gcactggtga cttggcaaga tggctgccgg acggcaatat cgaattttta ggcagaatcg     69540
     acaaccaagt gaaggtgcgc ggcttccgaa ttgagcttgg cgaaattgaa acaaaactga     69600
     acatggctga gcatgtgaca gaagccgcgg tgatcatacg caagaacaaa gcagacgaaa     69660
     atgaaatttg cgcgtacttc acggcggatc gtgaagtggc tgtgagtgag ctgagaaaaa     69720
     cactgtctca gtctttgcct gactatatgg tccctgccca cctgattcaa atggacagcc     69780
     tgccgctcac gccaaacggg aaaatcaaca aaaaggaact gcctgcaccg caatcagaag     69840
     ccgtgcagcc ggaatacgca gcaccaaaaa cagagagtga aaagaaatta gcggagatct     69900
     gggaaggaat actcggcgtc aaagcaggcg ttaccgataa cttctttatg atcggcggcc     69960
     attctttgaa agcgatgatg atgacggcga aaattcaaga gcattttcat aaggaagttc     70020
     cgataaaagt gctttttgaa aagccgacta ttcaagaact ggcactgtat ttggaagaga     70080
     acgaaagcaa ggaggagcag acgtttgaac cgatcaggca agcatcttat cagcagcatt     70140
     atcctgtatc cccggcccag cggagaatgt atatcctcaa tcagcttgga caagcaaaca     70200
     caagctacaa cgtccccgct gtacttctgc tggagggaga agtagataaa gaccggcttg     70260
     aaaacgcaat tcagcaatta atcaaccggc acgaaatcct ccgtacatcg tttgacatga     70320
     tcgacggaga ggttgtgcaa accgttcata aaaacatatc cttccacctg gaggctgcca     70380
     agggacggga agaagacgcg gaagagataa tcaaagcatt tgttcagccg tttgaattaa     70440
     accgcgcgcc gctcgtccgt tcgaagcttg tccagctgga agaaaaacgc cacctgctgc     70500
     tcattgatat gcatcatatt attactgacg gaagttcaac aggcattcta atcggtgatc     70560
     ttgccaaaat atatcaaggc gcagatctgg aactgccaca aattcactat aaagattacg     70620
     cagtttggca caaagaacaa actaattatc aaaaagatga ggaatactgg ctcgatgtct     70680
     ttaaaggcga actgccaata ctggatcttc ccgcggattt cgagcggcca gctgaacgga     70740
     gctttgcggg agagcgcgtg atgtttgggc ttgataagca aatcacggct caaatcaaat     70800
     cgctcatggc agaaacagat acgacaatgt acatgttttt gctggcggcg ttcaatgtac     70860
     tcctttccaa gtacgcgtca caggatgata tcattgtcgg ctcgccgaca gctggcagaa     70920
     cacatcctga tctgcaaggt gtgccgggta tgtttgtcaa cacgggggca ctaagaacgg     70980
     caccagcggg agataaaacc ttcgcgcaat tccttgaaga ggtcaaaaca gccagccttc     71040
     aagcattcga gcaccagagc tatccgcttg aggagctgat tgaaaagctt ccgcttacaa     71100
     gggatacaag cagaagtccg ctgttcagcg tgatgttcaa catgcagaat atggagattc     71160
     cttcattaag attaggagat ttgaagattt cctcgtattc catgcttcat catgttgcga     71220
     aatttgatct ttccttggaa gcggtcgagc gtgaagagga tatcggccta agctttgact     71280
     atgcgactgc cttgtttaag gacgagacga tccgccgctg gagccgccac tttgtcaata     71340
     tcatcaaagc ggccgcggct aatccgaacg ttcggctgtc tgatgtagat ctgctttcat     71400
     ctgcagaaac ggctgctttg ctagaagaaa gacatatgac tcaaattacc gaagcaacct     71460
     ttgcagcact ttttgaaaaa caggcccagc aaacacctga ccattctgcg gtgaaggctg     71520
     gcggaaatct gttgacctat cgtgagcttg atgaacaggc gaaccagctg gcgcatcatc     71580
     ttcgtgccca aggggcagga aatgaagaca tcgtcgcgat tgttatggac cggtcagctg     71640
     aagtcatggt atccattctc ggtgtcatga aggcgggggc agctttcctt ccgattgatc     71700
     ctgatacacc tggagaacga atccgttatt cattagagga cagcggagca aaatttgcgg     71760
     tcgtgaatga aagaaacatg acggctattg ggcaatatga agggataatt gtcagccttg     71820
     atgacggtaa atggagaaat gaaagcaagg agcgcccatc atccatttcc gggtctcgca     71880
     atcttgcata cgtcatttat acgtccggta cgaccggaaa gccaaagggc gtgcagattg     71940
     agcatcgtaa tctgacaaac tatgtctctt ggtttagtga agaggcgggc ctgacgaaga     72000
     ggcgggctga cggaaatgat aagactgtat tgctttcatc ttacgcattt gaccttggct     72060
     atacgtgcat gttccctgta cttctgggcg ggggcgagct ccatatcgtc cagaaggaaa     72120
     cctatacggc gccggatgaa atagcgcact atatcaagga gcatgggatc acttatatca     72180
     agctgacacc gtctctgttc catacaatag tgaacaccgc cagttttgct tttgatgcga     72240
     actttgaatc cttgcgcttg atcgtcttgg gaggagaaaa aatcatcccg actgatgtta     72300
     tcgccttccg taagatgtat ggacataccg aatttatcaa tcactacggc ccgacagaag     72360
     caacgatcgg cgccatcgcc gggcgggttg atctgtatga gccggatgca tttgcgaaac     72420
     gcccgacaat cggacgcccg attgcgaatg ccggtgcgct tgtcttaaat gaagcattga     72480
     agcttgtgcc gcctggagcg agcggacagc tctatatcac gggacagggg ctcgcgagag     72540
     ggtatctcaa caggcctcag ctgacagccg agagatttgt agaaaatcca tattcgccgg     72600
     gaagcctcat gtacaaaacc ggagatgtcg tacgaagact ttctgacggt acgcttgcat     72660
     ttatcggccg ggctgatgat caggtgaaaa tccgaggcta ccgcattgag ttgggagaaa     72720
     ttgaaacggt catgctcagc ctcagcggaa ttcaagaagc ggttgtacta gcggtttccg     72780
     agggcggtct tcaagagctt tgcgcgtatt atacgtcgga tcaagatatt gaaaaagcag     72840
     agctccggta ccagctttcc ctaacactgc cgtctcatat gattcctgct ttctttgtgc     72900
     aggttgacgc gattccgctg acggcaaacg gaaaaaccga cagaaacgct ctgccgaagc     72960
     ctaacgcggc acaatccgga ggcaaggcct tggccgcacc ggagacagcg cttgaagaaa     73020
     gtttatgccg catttggcag aaaacgcttg gcatagaagc catcggcatt gatgacaatt     73080
     ttttcgattt aggcggccat tcattaaaag ggatgatgct gattgccaac attcaggcgg     73140
     aattggagaa aagcgtaccg cttaaagcac tgttcgagca gccgacagtt cgccagctgg     73200
     cggcttatat ggaggcgtct gctgtttcag gcggccatca agtactcaaa ccggctgaca     73260
     agcaggatat gtatccattg tcatccgcac agaaacgaat gtacgtgctc aatcagcttg     73320
     accgccagac gataagctac aacatgccat ctgttcttct aatggaagga gagcttgata     73380
     tttggcctgc gcgactcact cctcagcttg tgaaccgtca cgaatcattg cggacgtcat     73440
     ttatggaagc taatggtgag cctgttcagc gcatcattga gaaggcggag gttgatcttc     73500
     atgtgtttga agccaaagaa gacgaagcgg accaaaagat taaggaattt atccggccat     73560
     tcgacttaaa cgacgcaccg ctcattcgcg cagctttgct tcgaatagaa gcgaaaaaac     73620
     atttgctgct tttagatatg catcatatca tcgcagacgg cgtctcaaga ggcatctttg     73680
     taaaagaatt ggcgctgctt tacaaaggag agcagcttcc ggagccgacg cttcattata     73740
     aagatttcgc cgtttggcaa aatgaagctg agcaaaaaga acggatgaag gagcatgagg     73800
     cgtactggat gtcagttctt tcaggcgagc tgccagagct tgatctcccg ctcgattatg     73860
     cccgtccgcc tgtgcaaagc tttaaaggag atacgatccg tttccgtacg ggaagtgaga     73920
     cggcaaaggc ggtagaaaaa ctgcttgccg aaaccggaac gaccttgcac atggtgctcc     73980
     atgctgtttt ccacgtcttt ttaagcaaaa tttccggaca gcgggatatc gtcatcggct     74040
     ccgttactgc cggccggacg aatgctgatg ttcaggacat gccgggaatg ttcgtcaata     74100
     cacttgccct gagaatggaa gcgaaagaac agcaaacatt tgcggagctt ttggagctag     74160
     caaagcagac gaacctgtca gcccttgagc atcaggagta tccgtttgaa gatctggtta     74220
     atcagcttga tctccctcgg gatatgagcc gaaacccatt gtttaatgtg atggtgacga     74280
     cagaaaaccc tgataaagaa gagcttacat tgcaaaatct gagcatttca ccttatgagg     74340
     ctcatcaggg aacttctaag tttgatctga cactgggcgg atttactgat gaaaatggca     74400
     ttggcttgca gctcgaatat gcgacagatc tgttcgcaaa agaaacagct gaaaaatgga     74460
     gcgaatacgt tctgcggcta ctaaaggctg ttgcggataa cccgaaccag ccgctttcca     74520
     gtctgttact ggtcaccgag acagaaaagc aagcgcttct tgaggcatgg aagggcaaag     74580
     cgctgcctgt gccgacagac aaaacggttc atcagctatt cgaagagact gtccagcgcc     74640
     acaaagaccg cccggctgtc acatacaacg gccaatcttg gacgtacggc gagctgaacg     74700
     cgaaggcaaa ccgcctcgcc cggattctga tggactgcgg catcagcccg gatgaccgcg     74760
     tcggcgttct cacgaagccg tcgcttgaaa tgtccgccgc ggtgctcggc gtcttgaaag     74820
     ccggagcggc gtttgtgccg attgatcctg actacccgga tcagcggatt gagtatattt     74880
     tacaggacag cggcgcgaag cttctcttga aacaggaagg catttcagtg ccggacagct     74940
     atacgggaga tgtcattctt ctcgacggaa gccgcacgat tctaagcctg ccgcttgatg     75000
     aaaacgacga gggaaatcca gaaaccgctg taaccgcgga gaacttggcg tacatgattt     75060
     acacgtctgg aacgaccgga cagccgaagg gtgtcatggt cgaggaccat gcgcttgtga     75120
     acctgtgctt ctgggaccac gacgcgttca gcatgacagc ggaggaccgc agtgcgaagt     75180
     acgcgggctt cgggttcgac gcttccattt gggagatgtt cccgacctgg acgatcggcg     75240
     ctgaacttca cgtcattgat gaagcgatcc gcctcgatat cgtccgcctg aacgattatt     75300
     ttgaaacgaa cggcgtaacg atcacgttcc tgccgacaca gcttgcggaa cagttcatgg     75360
     agcttgagaa cacatcactt cgcgtcctct tgaccggagg agacaagctg aagcgggcag     75420
     tgaaaaagcc gtacacactc gtcaacaact acgggccgac agaaaatacg gtcgttgcca     75480
     caagcgcaga aatccatccg gaggaaggct cgctttccat cggacgggcc attgccaata     75540
     cgagagtata cattctcggc gagggcaatc aggtgcagcc ggaaggcgta gccggagagc     75600
     tttgcgtggc ggggcgcgga ctggcacgag gctatctgaa tcgagaagac gaaaccgcga     75660
     agcggtttgt cgctgatccg tttgtgccgg gtgaacgcat gtaccgcacc ggcgacttgg     75720
     tgaagtgggt gaacggcggc atcgaataca tcggccggat cgaccagcag gtcaaggtcc     75780
     gcggctaccg gatcgagctc tcagaaattg aagtccagct cgcccagctt tctgaggtcg     75840
     aggatcgggc ggtgacacgt gtcaaagata aaggcggcaa tacagcgatc gcggcgtatg     75900
     tcacaccgga aacagctgac atagaagcac taaaatcaac actaaaggaa accctgccgg     75960
     attacatgat cccggcattc tgggtgacgc tgaacgagct tccggttacg gcaaacggca     76020
     aagtcgaccg caaagccttg cctgagccgg acatcgaagc gggaagcgga gaatacaaag     76080
     cgccgacgac cgacatggaa gagctgcttg ccggcatctg gcaggacgtg cttggaatgt     76140
     ctgaagtcgg tgtcaccgac aatttcttct cgcttggcgg agattccatc aaaggaattc     76200
     aaatggcgag ccgcttgaat cagcacggct ggaagctgga aatgaaagat ctcttccagc     76260
     atccgacgat cgaagagctc acccagtacg tagagcgtgc cgaaggcaaa caggcagacc     76320
     aaggcccggt ggagggcgaa gtcatcctga cgccgatcca gcgctggttc tttgaaaaga     76380
     acttcacgaa caagcaccac tggaaccaat cggtgatgct tcacgccaaa aagggctttg     76440
     atcctgaacg ggtggagaaa acattgcagg cgctgatcga gcatcatgac gcgctccgca     76500
     tggtctaccg cgaggaaaac ggggacatcg ttcaggtgta taaaccgatc ggtgagagca     76560
     aggtcagctt cgaaatcgtg gatctgtacg gctccgatga agagatgctg agaagccaga     76620
     ttaagcttct cgcgaacaag ctgcaaagca gtctcgatct gcgaaacggg ccgcttttaa     76680
     aggcggcaga atatcgcaca gaagctgggg atcacctgct cattgctgta caccatctcg     76740
     tggtcgacgg tgtgtcatgg cggattttgc ttgaagactt tgcttcaggc tacatgcagg     76800
     ctgagaaaga agagagcctt gtcttcccgc aaaaaacaaa ctccttcaag gattgggcgg     76860
     aagaactggc ggcattcagc caatcagcgc atcttttaca gcaggctgaa tactggtcgc     76920
     aaattgccgc tgaacaggtt tctcctttac ctaaggattg tgaaacagag cagcggatcg     76980
     tcaaggatac atcatctgtc ctatgtgaat taacggcaga agacactaag catcttttaa     77040
     cagatgttca tcagccatat ggaactgaaa tcaacgatat tcttctcagc gcgctcggtt     77100
     tgacaatgaa agaatggaca aagggggcca aaattggcat taaccttgag ggacacggcc     77160
     gggaggacat tatcccgaat gtgaatatct ccagaacggt cggctggttt acggcacaat     77220
     accctgttgt gctcgacata tctgacgcag atgcctcagc tgtgatcaaa acagtcaaag     77280
     aaaacctgcg ccgcattccg gacaaaggtg ttggctacgg cattcttcgt tatttcacag     77340
     aaacagcgga aacaaagggc ttcacaccgg agatcagctt caactatttg ggccaattcg     77400
     acagtgaagt caaaaccgat ttctttgaac cgtccgcttt cgatatgggg cgccaagtaa     77460
     gcggagaatc agaggcgctg tacgcattaa gcttcagcgg catgatcaga aacggccggt     77520
     ttgtgctttc ctgctcctac aatgagaagg agtttgaaag agctacagtc gaggaggaaa     77580
     tggaacggtt taaagaaaac ctcctgatgc taatccgcca ttgcacggaa aaagaagaca     77640
     aggaattcac accaagcgac ttcagcgccg aagaccttga aatggacgag atgggagata     77700
     tctttgacat gcttgaggag aatttaaaat aaaacgcaag ggaattacag aaggcgggag     77760
     cgaaacatat gagtcaattt agcaaggatc aggttcaaga tatgtattac ctatcgccga     77820
     tgcaggaagg gatgcttttt catccgatcc tgaatcccgg ccaaacgttt taccttgaac     77880
     aaatcacgat gaaagtaaaa ggcagcttga atatcaaatg tcttgaagaa agcatgaatg     77940
     tgatcatgga ccggtacgat gtatttcgta ccgtgttcat tcacgaaaaa gtaaaaaggc     78000
     ctgtccaagt cgtattgaaa aaacggcagt tccatataga agaaatcgat ctgacacact     78060
     taacgggcag cgagcaaaca gccaaaatca atgagtacaa agaacaggat aagatcaggg     78120
     gttttgattt gacgcgggat attccgatgc gggcagccat tttcaagaaa gctgaagaaa     78180
     gctttgaatg ggtgtggagc taccaccaca ttattttgga cggatggtgc ttcggcatcg     78240
     tcgtacagga tctatttaag gtatacaatg ctctgcgcga acaaaagccg tacagcctgc     78300
     cgcccgtcaa accgtataaa gactacatca agtggcttga aaagcaggat aaacaagcat     78360
     cactgcgtta ctggcgcgaa tatttagagg gctttgaagg acaaacgacg tttgcggagc     78420
     aaagaaagaa acaaaaggac ggctatgagc cgaaagagct gctcttttca ctgtcggagg     78480
     cggaaacaaa ggcctttacc gagcttgcaa aatcgcagca taccactttg agtacggcgc     78540
     tgcaggcagt ctggagcgta ttgatcagcc gctatcagca gtctggcgat ttggccttcg     78600
     gtacagttgt ttcagggcgt cccgcggaaa tcaaaggcgt tgaacatatg gtcgggctgt     78660
     ttatcaacgt tgtcccgaga cgtgtgaagc tgtctgaggg tatcacattt aacggcttgc     78720
     tcaagcggct gcaggagcaa tcgctgcagt ccgagccgca tcaatatgtg ccgctttatg     78780
     acatccaaag ccaggccgat cagccgaaac tgattgacca catcattgtt tttgagaact     78840
     atccgcttca ggatgcgaaa aatgaagaaa gcagtgaaaa cggctttgat atggtggatg     78900
     ttcatgtttt tgagaagtcg aattatgatc tcaacctgat ggcttccccg ggagatgaga     78960
     tgctgattaa gcttgcctat aatgagaatg tgtttgatga ggcgtttatc ctgcgcttga     79020
     aatctcagct tcttacagca attcagcagc tcatccagaa tcctgatcag cctgtcagca     79080
     cgatcaacct cgttgacgac agggagagag aatttttgct aaccggctta aacccgccgg     79140
     ctcaagctca tgaaacaaag cctctgacgt attggttcaa ggaagcagtg aacgccaatc     79200
     cggatgcacc ggcgcttacg tattccggcc agaccctgtc ttatcgcgaa ttagatgagg     79260
     aagcgaaccg cattgcacgc cggctgcaaa aacacggtgc gggcaaaggc tctgttgtag     79320
     cgctgtacac gaagcgctca cttgaactgg tgatcggcat tctcggtgta ttaaaggcgg     79380
     gagcagccta tctgccggtt gatccgaagc tgccagagga ccgaatctcg tatatgctgg     79440
     ctgacagtgc ggcagcctgt cttctgacgc atcaggagat gaaagaacaa gcggctgagc     79500
     tgccgtatac aggcacaacg ctcttcattg atgatcaaac acggtttgaa gaacaggcaa     79560
     gcgatcctgc aaccgcgatt gatcctaatg atccggcata tatcatgtac acgtccggca     79620
     caaccggaaa gccaaagggc aatatcacca ctcatgccaa tattcaagga ttggtcaagc     79680
     atgtagacta catggcattt tctgatcagg atacgttctt gtctgtttcg aattacgcct     79740
     ttgatgcatt tacctttgat ttctatgctt ctatgctgaa tgcggcacgg ctcattatcg     79800
     cagatgaaca tacgctgctt gatacagaac ggctcacaga tctgatcctg caagagaatg     79860
     tcaatgtcat gtttgcgaca accgcactat ttaatcttct cacagatgcg ggagaggatt     79920
     ggatgaaggg gcttcgctgt atattattcg gcggagagcg cgcgtcagtg cctcatgtca     79980
     gaaaagcgct gcggatcatg gggccgggca agctgattaa ctgctacggg ccgactgagg     80040
     gaacagtgtt tgcgacagct cacgtcgtgc atgatctgcc ggattccatc tcctcattgc     80100
     cgatcggaaa gccgatcagc aatgccagtg tttatattct gaatgagcaa agccagctcc     80160
     agccattcgg ggcggtcggt gaactgtgca tcagcggaat gggcgtgtca aaagggtatg     80220
     taaatcgtgc tgacctcacg aaggaaaagt ttatcgagaa cccgttcaag ccgggagaaa     80280
     cgctttaccg tacaggggat ttagcgcgct ggctgccgga tggaacgatt gaatacgccg     80340
     gccgtattga cgaccaggtc aaaatacgcg gacaccggat tgagcttgaa gaaatcgaaa     80400
     agcagctgca ggaataccca ggtgtgaaag atgcggtcgt tgtggcggac cgccatgagt     80460
     ctggcgatgc atcaatcaat gcctaccttg tgaaccgaac gcagctttca gctgaagacg     80520
     tgaaggcgca cctgaaaaaa cagcttcctg cttacatggt gccgcaaacc tttaccttct     80580
     tggatgagct tcctttaacg acgaacggga aagtcaataa acggctgctc ccaaaacctg     80640
     atcaggatca gctggcggaa gaatggattg gaccgcggaa cgagatggaa gaaacaatcg     80700
     cacaaatatg gtctgaggtt ctcggcagaa agcaaattgg cattcatgac gatttctttg     80760
     cgctcggagg gcattccttg aaggccatga ccgccgtccc gcatcaacaa gagctcggga     80820
     ttgatcttcc agtgaagctt ttgtttgaag cgccgacgat cgccggcatt tcagcgtatt     80880
     tgaaaaacgg gggctctgat ggcttgcagg atgtaacgat aatgaatcag gatcaggagc     80940
     agatcatttt cgcatttccg ccggttctgg gctatggcct tatgtaccaa aatctgtcca     81000
     gccgcttgcc gtcatacaag ctatgcgcct ttgattttat tgaggaggaa gaccggcttg     81060
     accgctatgc ggatttgatc cagaagctgc agccggaagg gcctttaaca ttgtttggat     81120
     attcagcggg atgcagcctg gcgtttgaag ctgcgaaaaa gcttgaggaa caaggccgta     81180
     ttgttcagcg gatcatcatg gtggattcct ataaaaaaca aggtgtcagt gatctggacg     81240
     gacgcacggt tgaaagtgat gtcgaagcgt tgatgaatgt caatcgggac aatgaagcgc     81300
     tcaacagcga agccgtcaaa cacggcctca agcaaaaaac acatgccttt tactcatact     81360
     acgtcaacct gatcagcaca ggccaggtga aagcagatat tgatctgttg acttccggcg     81420
     ctgattttga catgccggaa tggcttgcat catgggaaga agctacaaca ggtgtttacc     81480
     gtgtgaaaag aggcttcgga acacacgcag aaatgctgca gggcgaaacg ctagatagga     81540
     atgcggagat tttgctcgaa tttcttaata cacaaaccgt aacggtttca taaatgaagt     81600
     gatgaaagga ggagacagcc aatgagccaa ctcttcaaat catttgatgc gtcggaaaaa     81660
     acacagctca tctgttttcc gtttgccggc ggctattcgg cgtcgtttcg ccctctccat     81720
     gcttttttgc agggggagtg cgagatgctc gctgccgagc cgccgggaca cggcacgaat     81780
     caaacgtcag ccattgagga tctcgaagag ctgacggatt tgtacaagca agaactgaac     81840
     cttcgccctg atcggccgtt tgtgctgttc ggacacagta tgggcggaat gatcaccttc     81900
     aggctggcgc aaaagcttga gcgtgaaggc atctttccgc aggcggttat catttctgca     81960
     atccagccgc ctcatattca gcggaagaaa gtgtcccacc tgcctgatga tcagtttctc     82020
     gatcatatta tccaattagg cggaatgccc gcagagcttg ttgaaaataa ggaggtcatg     82080
     tcctttttcc tgccttcttt ccgatcagat taccgggctc ttgaacaatt tgagctttac     82140
     gatctggccc agatccagtc gcctgttcat gtctttaacg ggcttgatga taaaaaatgc     82200
     atacgagatg cggaagggtg gaagaagtgg gcaaaagaca tcacattcca tcaatttgac     82260
     ggcgggcaca tgttcctgct gtcacaaacg gaagaagtcg cagaacggat ttttgcgatc     82320
     ttgaatcagc atccgatcat tcaaccgtga tcaaaagcgg acagcttcgg ctgttccgct     82380
     ttttttgtgt tgaatgccaa tttctgcatg gtataatagt cgaaatactc aaataaaggc     82440
     aggtcgaaac atgcgcacgt ctcccaggtc gaaatggttt gtattcctgt ttacgtttgt     82500
     tttcgccatc ggaatgaact cattcagaaa ttcctttcaa ttttttatgc tgccaatggc     82560
     agacgccttc catgccgaca ggtcgctgat ttcggtttct gtcagcattt ttatgatcac     82620
     aaccggcatc gtccagtttt ttgtcggttt ttttatcgac cgtttcagtg tcagaaaaat     82680
     tatggcgctg ggagctgttt gcatcagcgc aagctttttg gtgcttcctt attcaccgaa     82740
     tgttcatgtg ttttccgcca tttacggtgt gcttggcgga atcgggtatt cctgcgcggt     82800
     cggcgtgacg acccagtatt tcatcagctg ttggtttgac acacacaaag gtctggcgct     82860
     tgctattttg accaatgcca actctgcggg cctcgtcgtc tctccgccgc ccatttgggc     82920
     tgcggctccg tatcatgccg gctggcagag cacctatacc attttgggaa tcgtcatggc     82980
     ggctgttctc gtgccgctcc tcgtctttgg gatgaagcac ccgccacatg cgcaagcgga     83040
     aactgtgaaa aaatcttatg attggcgagg gttttggaac gtgatgaagc aatcccgcct     83100
     cattcatatc ctgtacttcg gcgtgtttac ttgcggattt acaatgggaa ttattgatgc     83160
     tcacctcgtc ccgatactga aggatgcgca tgtctctcat gtcaacggaa tgatggccgc     83220
     gttcggggca tttatcatca ttggcggatt attggcgggc tggctgtcag atctcctcgg     83280
     cagcagaagc gtcatgctat ccatcttatt tttcattcgg ctgctcagcc tcatttgcct     83340
     gctcattccc attctcggaa ttcatcacag cgacctttgg tacttcgggt ttatcctgtt     83400
     attcgggctc agttacacag gcgtgatccc gctgaccgcg gcgtcaattt cggaaagcta     83460
     tcaaacagga ttgatcggat cgctgttagg catcaatttc tttatccatc aggttgccgg     83520
     agctctcagc gtgtatgcgg gcggtttgtt ttttgacatg actcatggtt atttactgat     83580
     tgtcgctgtg tgcatcgtgt ttgtgggttt atcggctgta atagagctgg tgccgttttt     83640
     agataaacag aaggcaaaag aaacccacca ttcaatataa aaggatcagc actgtcaatg     83700
     ctgatccttt ttaaatttga gtttttttgt ttcggtattt ttaaggataa tctccttgaa     83760
     tctgttcatc tcctcttcgg agtgaaaaaa atgtttgggg atcgcaatat attggccact     83820
     tgatgtattg accctgaaga tatttttata ttcgaaaaca gctgtaattt catcccaatt     83880
     gaaaatgagg tcatattttt tagaacatat acgaattcct tcttggttca gagtatatgt     83940
     tcttttggat ttcatccgtt cgttcttctt gtatgctctg gaaaacttca catatagaag     84000
     aaggaggagc agcagtgtaa acagaacgga catcacgata atcaacatac tgttcataaa     84060
     caagttaagc gcgtcacttc cataaacgat acggggccat ccgttaatga agttaactgc     84120
     agcaaatatg gcgcaaaaca atagaaagta aaagcatgat atttttgcga tttgataaaa     84180
     aaagatttct cttacatcct taaaagtgat ttctcctgga agattgatac tttcactagc     84240
     atattgaatc atacggtaaa cctacacctc taaccatgtt tttcctttta gtctagcata     84300
     atttctcatt tttttgcagg cataccaggg cgctttgttt ttttctccag attgatattg     84360
     ctccccacca cgccaatcat aatacaaaca gccccggcaa gatgatacca ggccaggctt     84420
     tcgttgagaa tcacaaatcc tgcaatcatc gtcacaatgg tagatacatg attaaaagcg     84480
     ctcattttaa acgcctcaat tcgcgacagc gtatagttag acagaaatga agtgacaagt     84540
     gaagacagca cgcccaaata cacaatggcg agaacgaagc cgggctcccg gaacggcaga     84600
     aaataagtgc cgactgttcc cgccgctccg tgacgcacaa gggcgatggc gttgaagacg     84660
     acaaagccga tggctgacat gatgtaggtg agctcggtca gcttgaaccg ctgcgtcatt     84720
     tttctggcag cagtattgta catcgctgaa gacaaagcgg acaataggat cagcaaagac     84780
     ccttttaagc tggctgattc cacgtcaacg cctttcatca caaaaataaa catgacgccg     84840
     gcaacggata aaaccgtgaa ccccttttgc gtccacgttg ggcgttcctt taaaacataa     84900
     gcggcaaaga ccatcgtgaa aatcggaatg gctgcctgaa taattcccgc ttcagaggag     84960
     gacgagtaca caaggccgaa tgcctgaaag ctgaaaaata acgcgggata cagcagggcg     85020
     agcggcaaaa tgtcaatgac gtcctttacg aggattgata gctttaccca gccgaataag     85080
     atcggtacag tggccgcagc aaacgcaatg gtgaaccgat gcgccaaaat atcaaacggc     85140
     tctgctgttt gcagtgcgat ttttacgaat agaaaggata aaccgataat gaacgaatat     85200
     aaaatagccg ctatataagc gggggtttgc tgatgtttaa ccataatggg aagggctcct     85260
     ttacctgaat tgcagcgccg gtcgctccct ttattgtatg gccgcggtca gaacggtaca     85320
     atgagaaaaa caatgaactg taccggtaca aaacaggggg agaaggcatg gagaaatata     85380
     tgagtctatt aacgaggata gaggagatga tgcaaagcac ctcatatcaa gaaggagaca     85440
     ggcttccatc tatccgtcag ctgtccgccc gctaccaagt cagcaaaagc acagtgatcc     85500
     gcgcgctgca ggagctggaa aagcgccacc ttatctattc tgttccgaaa agcggctatt     85560
     atattgtgaa aaagtcaggg aaatcaaaaa gcgggcagcc tggccccatc gactttgcca     85620
     catctgcgcc ggatcccgat gtgtttccgt atcttgattt tcagcactgc atcaacaaag     85680
     cgattgatac atacaaaaac gatttgttta tttatgggac gccaaagggg cttccatcac     85740
     tcatccgcgt actccgaaag ctcttggcca ctcaacaggt atttgcggat gaacggcata     85800
     ttttcattac atcaggtgtc cagcaggcgt tatccttgct ttgtgccatg ccgttcccaa     85860
     atgggaaaga gaagatcgcc attgaacagc cgggctacca tttgatggtc gaacagcttg     85920
     agacacttgg gattcccgcc atcggggtga aacgaacgga agaagggctt gatatagcca     85980
     aggttgagcg gttatttcaa acagaatcga ttaaattttt ttatacgatg ccgcgcttcc     86040
     ataacccgct tgggtgctca ttgtcagagc gtgataaaca ggagcttgtg agactggcag     86100
     aagcgtatga tgtctatctc gttgaggatg attacctcgg tgatctggag gaaaataaaa     86160
     aggcagatcc gctgtacgca tatgatctgt cctcacatgt catctatttg aaaagcttct     86220
     cgaaaatgat gttccccggc ctccgcgtgg gggcggctgt tttgcccgaa gcgctgactg     86280
     acacgttcta tgcgtacaaa aagctgaacg acatcgactg ttcgatgatt tctcaagcgg     86340
     cattggagat ttacctgaaa agcggtatgt acggcaggca taaggagaaa atcagagatt     86400
     cttataaaga gcggtcgctg aggctacatc aagccattcg aactcacagg cagctgggaa     86460
     gcggacgctt tacgttctcc agcgggcagg caccctgtat gcacacccat ctggtgcttc     86520
     ctcaggatct gcccgcctca agagtgattc atagactgga aaaacaaggg gttctccttg     86580
     aggcgataga ccgtcattat ttatcagatt atccgaaaga aaatctatta aaaatcaata     86640
     tttccaatgt gaaaacggaa gatattgagc gcggtgtcaa gctgttgatg agccatttat     86700
     aaaagctctt cgtacgagac cattgtgata tcctcgggga aatcagggtg tgcggcgcat     86760
     acagccattt tgtagccggg atcgacctca tacgttttga tatagcatgg ggaatggctg     86820
     tccggaagct caatggatac ttgtccgtcc tgatgcaggc gcactgaaaa ggaatcaagc     86880
     ggaagcgata agcctttgcc ttccttgttt gataaagctt tctttcattg accatagatg     86940
     ataaaaatag tctgtctgct cgtccttgtc ttttgctaaa aggtcgctgt actctgtttt     87000
     tgaaaagaag cgcttgggca tctcaaggct gatcggtttc gttttttcga tatctatgcc     87060
     gatcggctgt gaatcaaacg caccaatgac ccagcggccg gagtgagaaa tgttgaaatg     87120
     agcgtcggga agatcaggga tgcacggctt cccgtattcc tgcgtgctaa agcggatatc     87180
     ggatttgtcc aactgatact gcctgcttat gactgagcga acgagcacat ctcccagcag     87240
     ggtgcggtga gcatcttctt tatgataaaa tctccggcat ttctcccgtt tttcaggtga     87300
     tatgaaagtc atgaaccgtt cattttcttc ctgtgaaagc gggcggtcca tataaattcc     87360
     gtaaatcttc attctagatc ctccgtctgc aaaagattgt caaaaccatc ctatcatact     87420
     tccacaagac tcatatagag gagaaaataa aaaaacaaag ccaaggcggc tttgttttag     87480
     tgtacaggcg gagatgcttt cacagcggct gtccgccttg ccacagcata attcagcagc     87540
     tggattgact ggggcaatga aaagcgcaaa ataagtccgg tgaggatggc ggtcaaaatg     87600
     gtgccaaaac cgatcggccc acccatgccc catgccgcaa acaaaatggt tatttccatg     87660
     ccgttccgca cccattgcac attccagccg gttttttcgg taatcagcat catcagtgaa     87720
     tcacgcggcc ccgcgccaag gcctgctgat acataaacac cgacgccgta accgatcagc     87780
     accacgccta gagagaagac gatgatcgag cctgtgtagg tcgagggggc aggcagaatg     87840
     aaattgaaaa aatctataaa tacaccaatg agcaccatat tcaggagggc cccaattttc     87900
     ggccaagctc tcgtaaacaa tgacgtgaat ccgacgatga gcgctccaat aatgatggac     87960
     cactggccga cggtaagccc gaagtgctga aacaggctgt aatgaaatgc atcccacgga     88020
     ctaatgccga gtgcttttcc ttctatcgtc agggatacac caaaagccaa aatgatcaaa     88080
     ccggcaaaat aaaatgtcca gcgcagaaca agttcttgct tcacgtgagg tcccttcttt     88140
     cgtaaaaatc agtcgattgt cattgtagca catctgacag aagggcggaa taggcgaaag     88200
     gggctcaaca aaaaaacagg cgcgcaggcg ccctgtttca gcgtgttggc aaacccttgc     88260
     attcgttgtc aggcctgtgc ttcggtgctc acgaatttaa cattagctgt gctccaatgc     88320
     tcgcccttcc tagacttcaa aggttttcaa tcacgctgaa aatcacaaaa tcctaaaacg     88380
     aatatcgttt taggattttg tcaataatct gaaacagggc gctgacgctc tgtttttctt     88440
     attacagcgg gttcaaaatc cggtttaaga accgctgtgt ccgttcttct tttggtgcgg     88500
     agaaaatttg ctccggcggt ccctgctcca cgataacgcc gccgtcgatg aagatgactt     88560
     catccgcaac ctcctgcgcg aacttgattt cgtgggtcac gacgaccatg gtccagcctt     88620
     cattggccaa gtccttgata accttcagca cctctccgac aagctcggga tcaagcgctg     88680
     aggtcggttc gtcaaacagc atgagctcag gctgtatcgc cagtgcgcgg gcgatgccga     88740
     cgcgctgctg ctggccgccg gaaagctgga acggatataa atccattttg tccttcaatc     88800
     cgactttatc aagaagctga atcgcttctt ttctgacttc ctctttgttc cgtttttgca     88860
     cctgaacagg gccctccatc acgttttcga gggctgtgcg gtgcgggaac aggtgatacg     88920
     cctgaaacac cattggggat tttcggcgaa gctttaggat atccgcctgt ttcacctttt     88980
     tggagaaatc gatggagaaa tcatcaaatg caagctctcc gcgattcggg atctccagag     89040
     cgttcaggca gcggagcagc gtcgttttcc ctgaacctga aggcccaagt atggcgatga     89100
     cttttccttt ttcaatcttc atatctatct tttttaaaat ttcattttca ccgaatgatt     89160
     tgtttaatcc tttaacggta agcatactcg gaacctcctt atttggccac gtagcggtca     89220
     agacgccgtt cgatgacatg ctggacgagt gagagcagga agcagataat ccaataaata     89280
     aaggctgctt caatatagat cactaaaatt tgatcaagat tccgcgcgcc gatttcctgg     89340
     gcttttctga acagctcagc gaccagaatt tgagaggcga gggatgtatc tttaatcagg     89400
     ctgataaagg tattggataa tggcgggatc gacacacgaa acgcctgcgg caaaatgacg     89460
     cggaacagcg ttttttgatg tgtcatgcca attgtgtagc cggcttccca ttgccctttc     89520
     ggcacggata aaatagatgc ccgaatgatt tcagatgcat aggcgccgac gtttaatgaa     89580
     aaggcgataa ctgcgcttgg aaatggatct aatgtgacgt taaaggccgg gaacagatag     89640
     aaaatgatga acaattgaac gagaagagga gtgccgcgta ttgcggatac gtatacgctg     89700
     aacacccatc tcaaaggtct cactttcgac attctggcaa gcgccgtaat cagcgccagg     89760
     atcattccga atataaagga aagaatcgta aggggaatcg tatagtagat tccccctgaa     89820
     agtatcggcc agaatgactg ctgcaccaga tcccacggga tcgccgtgcc aagcgtcaat     89880
     gccggcagat tatttagaaa catcttcgcc gaaccatttt ttagaaattt tagaaagagt     89940
     cccgtcctct ttcatttctt ttaatgcttt gttgacttga tcaacaacct cgccgcttcc     90000
     tttacggaac gtgaaatatg ttgactgagg ctcacctgtt tcaaacgcga ttttcacgtt     90060
     tttattgcca gatgttttta agtagttcaa tacggcaagc ttatcgttgt atgtcatatc     90120
     gacgcgcgct tgctggatca tttgaagggc ctgcgccatg ccttcaacgc cttctacttt     90180
     agcgccggca tttgtagcta atttgttgta gttgcttgtc agtgattgag ctgacgtttt     90240
     tccttttaca tctgcttcag acttaatatc gttgttgtct tttttcgtta cgacaacggc     90300
     tcttgatgtt gtgtatttat ctgagaaatc atatttgtct tcacgatctg tttttccgac     90360
     ttggttggca acaacgtcaa accgtttgga attcaggccg gcaaacatac tgccccattg     90420
     tgtttcctta aagtcgactt taagcccgag gcgttttgcg acttctgtga taacttcgac     90480
     atcatagcca gtcagtttat cagtgtcttt gtcgtggtaa gtgaacggct catatgttcc     90540
     ttccgttccg actgtgagca cacctttttt cttaattgaa gcccaaagat cgccatcttt     90600
     ggcattatct tttgactgat tgtcatttcc tgctccgcaa gctgcaagag ctgcaatact     90660
     tacgaccatg aataaagcca ataatgcttt tttcatctta ttccccactt ttctggttga     90720
     ttttattgaa ataaaaaatt agcttacaaa tctaaaggat aacttttttt tagtatgagt     90780
     aagtatttgg ttttcataag acaaaatctt ttaaaataaa tccaaaaatt gctgtgccgg     90840
     tttaggcaaa taactgtccg ttctccacat gacagccggt gtcataatga agggattatt     90900
     ttcgatatgg acggtgtgaa cgtgatttct catatgaacg ggaatcattg tgacaggcaa     90960
     aatagacgcg ccgaatccgg atgacacgag gctgagcaaa gttgcagagt cgtggcattc     91020
     acaaacaatg cgcggctcca ggttcaaacg atgaaattca ttcatgacct gattatagac     91080
     gccttttccg ttgacaggcc gcagcaggat cagcggaaat gaaggaatgt ccaccatctt     91140
     aatggtgtct ccgcacggat atccggcttc atctgaaagc acgagcacac atggaatgtc     91200
     atcaagctgc ttgaattgta ctgtgtcact tttgatcagt gttgtcgtga ccgccgcatc     91260
     gatttgccgg ctttccagca gttccaacag tgtcgcgggt tcattttccc aaatattaaa     91320
     ggtgagatgg gggtatctct ctttgatctg tgttactttt tcaagcatca gagccgcgca     91380
     ataaatcgtt gatcccacgg caagtgtacc ggctacttcc tccttcagct cctgtacctc     91440
     aatgactgca tcttcaaacc tatgcagaat ctcttttgct ctttttagaa aaacagctcc     91500
     ttcatatgta agagtcattt gttttttctt gttacggtca aacagaacaa caccaagttc     91560
     gtcctccagc tgtttgagct gcctgcttaa aggcggctgc gccatgtgaa gctttttggc     91620
     tgcggacgta attttctgtt cttgggcaat ggtaatgaag tatcgaagct ggcgaatatc     91680
     caaaagaaag cgcctcctta tcataccttt taggtattaa ttatagattt aatagatatt     91740
     tttcatatgg atatatcagg agtatgattg aaatgaaagc agaattcaag cgtaaaggag     91800
     ggggcaaagt gaaactcgtt gtcggaatga caggggcaac aggggccatt ttcggggtca     91860
     ggctgctgca gtggctgaag gccgccggag tggaaaccca tctcgttgtg tctccttggg     91920
     caaacgtcac gatcaaacac gaaacaggct atacgttaca agaagtagaa caactggcca     91980
     catacactta ctcacataag gatcaggcgg cagccatttc aagcgggtcg tttgataccg     92040
     atggaatgat tgttgcgccg tgcagcatga aatctctcgc aagcattcgc acaggaatgg     92100
     cggataatct gctgacacgt gcggcggatg tcatgctcaa ggagagaaaa aaactcgtcc     92160
     tcttaacgag agagacgcct ttgaaccaaa ttcatctcga aaatatgcta gcgcttacga     92220
     aaatgggcac catcattctt cctccgatgc cggcatttta taatcggccg agaagcttag     92280
     aggaaatggt tgaccatatt gtttttagaa cgttggacca attcggcatt cggcttcctg     92340
     aagcgaagcg ctggaatggg attgaaaaac aaaaaggagg agcttgatca tggcttatca     92400
     agatttcaga gaatttctcg ctgcccttga aaaagaagga cagctgctta cagtgaatga     92460
     agaggtaaag ccggaaccgg atttaggggc ctccgcacgg gcagccagca atcttggcga     92520
     taaaagccct gcgctcttat ttaacaacat ttacggctat cataacgcgc gaattgcgat     92580
     gaatgtcatc ggctcttggc caaaccatgc catgatgctg ggcatgccga aagacacacc     92640
     ggtaaaagaa cagttttttg aattcgcaaa gcgttatgac cagtttccga tgccggtcaa     92700
     acgtgaggaa acagcgccat ttcatgaaaa tgaaatcaca gaagatatca atttgttcga     92760
     tatactgcct cttttcagaa ttaaccaggg tgatggaggc tactatttag acaaagcatg     92820
     tgtcatttcc cgtgatcttg aggaccctga caacttcggc aaacaaaatg tcggcattta     92880
     cagaatgcaa gtcaaaggaa aagaccgcct tggcattcag cctgtcccgc agcacgatat     92940
     tgcaatccat ctgcgccaag ctgaagaacg cggcatcaac cttccggtca ctattgcgct     93000
     cggctgtgag ccggtcatta caacggcggc atcgactccg cttctctatg atcaatcaga     93060
     atacgaaatg gcaggtgcga ttcaaggcga accatatcgc atcgtcaaat caaagctgtc     93120
     tgatcttgat gttccgtggg gcgctgaagt ggtgcttgaa ggtgagatta ttgccggaga     93180
     gcgcgaatat gaagggccgt tcggtgaatt cacaggccat tattccggcg gacgcagcat     93240
     gccgattatc aaaattaaac gcgtctatca cagaaacaat ccgatctttg aacatttata     93300
     cttaggcatg ccttggacag aatgcgatta catgatcggc attaacacat gcgtgccgct     93360
     ttatcagcag ttaaaagaag cgtatccgaa cgaaattgtg gcagtgaacg ccatgtacac     93420
     acacggttta atcgcgattg tttccacaaa aacccgctat ggcggatttg cgaaagcggt     93480
     cggcatgcgc gcactcacaa cgccgcacgg actcggctac tgcaaaatgg tcatagtcgt     93540
     tgatgaggat gtcgatccat tcaaccttcc gcaggtcatg tgggcgcttt cgaccaaaat     93600
     gcatccgaaa catgatgcgg tcatcattcc ggacttatct gtcctgccgc ttgatccggg     93660
     atccaatcca tcaggaatca ctcacaaaat gattctcgac gccactacac cggttgcgcc     93720
     ggaaacaaga ggccattatt cacagccgct tgattctccg ctaacaacga aagaatggga     93780
     acaaaaacta atggacttaa tgaataaata aggaaaggat gttcgaaatg catacatgtc     93840
     ctcgatgcga ctcaaaaaag ggagaagtca tgagcaaatc gcctgtagaa ggcgcatggg     93900
     aagtttatca gtgccaaaca tgctttttta catggagatc ctgtgaaccg gaaagcatta     93960
     caaatcccga aaaatacaat ccagcgttta aaattgatcc aaaggaaaca gaaacagcaa     94020
     ttgaagttcc ggcggtgccg gaaccgaaag gcttgatccg cgtgaactgt atgtcagacc     94080
     gtctctttga gctgcttgac gggagctgcc tgaatgagaa gcagcatgag gccttcgttc     94140
     tgcaaacagt atcagaggat ggctggccgc atgccgctat gatcagtgca ggtgaaatca     94200
     tcgcgctgag ccgaactgat atccgaatcg ctctgtggaa aaacacaatg acttcggcca     94260
     acatccttcg cacaggaaaa gcacagttca cggcgtggtg gaagggagcg gcctattatg     94320
     taaagcttga atgcgcgcct ttaccgcctt tgaaagatgc cgaatatgaa agagaccgtt     94380
     tttcctgccg catcgtttca gtgaaagagg acgttgcgaa atacgctgat ttgacttcag     94440
     gtgtccgtat acagcttcac agccctgaag aggtgctgag cagatggaaa aagaccctgg     94500
     aagatttaaa acggtaatat cgatagctga cgccatgcgt caggcttttt ttatataatg     94560
     aaaacaaaag ggggcgtgag aaatggaacg tgcggggatc tgtcactcgg acggctttga     94620
     tttagcttat cgaattgagg gcgagggcgc acccatcctt gtgatcggga gtgcggctta     94680
     ctatccgcgc cttttttcct cagatatcaa acagaaatat caatgggtct ttgtcgacca     94740
     taggggattt gctaagccta agcgggagct tcgtgcggag gattcgaggc ttgatgctgt     94800
     cttggctgat atcgaaagga tgagaacatt tcttcagctt gaggatgtta ctaccctggg     94860
     acattccggg cacgctttta tggctttaga gtatgccagg acatatccca aacaagttcg     94920
     gaaggtggcg ctctttaata ctgcgcctga taacagtgaa gaaagacagc gaaaaagcga     94980
     atcatttttc atggaaacag ccagtcttga gagaaagaaa cgctttgaaa aagacatcga     95040
     gaatttgccg caggacatcg acaaagatcc tgaaaggcgc tttgtgcaca tgtgtattcg     95100
     cgctgaagcg aaaagctttt atcaagagcg gccgcatgct gctgccttat gggacggtgt     95160
     attcacgaat atgccgatca ttgatgaatt atggggcaat acatttgccc ggattgatct     95220
     tcttcagcgg ttagctgatg ttcgtatgcc ggtgtatatc ggattaggga gatatgatta     95280
     tttggttgcg cccgtttcgc tatgggatgc tgttgacggt ttatatcccc atgttgataa     95340
     ggttattttt gaaaagagcg gccatcagcc gatgctggaa gaaccggaag cctttgatca     95400
     aagcttcagg aaatggcttg atcaataaaa aacagcccgc agatcaacat ccgcgggctg     95460
     tttctgatta taagacccct ttcatcgcgc gtttgatcac cggcgagagc agcaggagaa     95520
     tgccgccaag aacgatagaa atcaaaccga tggtgccgaa gtacattgtt tcaggaattt     95580
     tatcaaacaa tccggctact tgggcattga tcgcttgggc tgctgcgttc gtcagaaacc     95640
     acatactcat tgtctgtgca gagaaggcag ctggtgccag tttcgttgtc acggataaac     95700
     cgactggaga caggcacagc tctccaagca cgacaagcag gaagctgaga acgagccaaa     95760
     gcgggcttac gagtgcttct tttccttgca tagcagggaa taccataatg ataaatgaca     95820
     atccggctaa aataattccg attgagaatt taactggtgt agacggctga cgtttgccaa     95880
     gcttcatcca gagccatgcg aatattggcg caaaaatgac aacaaacaat ggatttaatg     95940
     attggaacca tgatgactga agttcgaatc cgcccaatga aagtcttatg cgttcatcag     96000
     cgtataccgc aagaatggtc gctccctgtt cctgaatggc ccagaacatg acagcaccga     96060
     taaacaaagg aacgtaagcg gcaagacggg atttttctgt tttgtccgct tttttgcttg     96120
     taaacatgat gatgaaataa atcacaggaa tcaaaatacc gagaatactt acaaggtcaa     96180
     tgaaacgttt gatcgtcagc acgcctgttt gtacagagat aatcactgcg atcgccacaa     96240
     tgataacacc gattccggtg ccaattgcag attttttaga cagcggattc ggcacattgg     96300
     aacctgcaag cccgaggttt ttctttcttg tcaaaggaaa tacgataagt ccgagaagca     96360
     ttccgaccgc ggcagctccg aatccgagat gatagttgta cttctgtccg agtgttccga     96420
     caattaacgg cgcgagtaaa ccaccgaggt taatccccat gtagaaaata ctgaaacctg     96480
     agtcgcggcg cgggtcttct ttcgtgtaaa gatccccaac tacgcttgaa acgtttggtt     96540
     ttaataagcc tgttccgaca atgataagca ccatactgat atagaatgct atcgaactgc     96600
     ccggataggc gagtgcaatg tggccgaaca taatgaatat gccgccgtaa aacacggtgt     96660
     ttgcggtacc gaatacccgg tcagcgagcc atccgccaat aatggtggac atgtatacga     96720
     gtgatccgta aatcgacata atggcaaccg cagtgccctt gtcaaagccg agccctccgt     96780
     ttaccgtctc tgtatacaaa tagtaaagta agattgctct cattccatag taagagaaac     96840
     gctcccaaaa ttcggtgaaa aatagtgtaa atagtcctcg cgggtgacca aagaaccctt     96900
     tttgcgggac gcttttaatg atactttcgt tatcaatcga agccatgtca gccaaaccct     96960
     ttctaaaaaa agtgtattat aaaaatcata ttcttatata atacttgtgt caatataatt     97020
     tatactcatt tcaaatagtt ccatattgga aaaattataa atacctaaaa atagtgattt     97080
     cctcctaatt tttaaacttt ttatcgtgag attttcttac acaactattc ctttatattt     97140
     ttttaataaa attttagaga aatgtacaag cagatcgggc ctttgtgagt aacatgatag     97200
     taatcataga gaaggaggct cgcaattggc tgaattcata ttaaatgcag cggatttcgg     97260
     tgttcctaga gatggtaaaa cggattcgac agaacggatt aatcagtgcc tcagtacagc     97320
     tgtttcgaaa ggctatcata ctgtctggtt tccaaaggga acatatttaa tagacgcaac     97380
     gcttggcgga gatcttaatc agaggtttcg aaacgcgggg atcattgttc ccggcaacct     97440
     tgagattatg atggaccccg aatgtatcat gaaagtgata ccgaatagtt cgtggggtta     97500
     ttccgcattt tatgtaggca agcaagagaa tataactatt tccggaggac aaattatcgg     97560
     cgaacgggat gagcatacgt atgcctcggc ggggataagg tcaacccatg aatggggctt     97620
     tggcatatgt attgaaggat gctcgaatgt tgtcattgat gatgtgaaaa tttccgattt     97680
     taccggcgat gggatcatag tcagcccaag gggattaaag accaatcaag attatcgaac     97740
     gtcagagcaa attatcatcc gccgctgtga ggttcggcgg tcgaggagaa ataacatttc     97800
     cattaccgga tgtgacatgg tcacggtgga ggaatgcttg attgaagatg ccggaacggg     97860
     gaatggaaca gcgccgaaat tcggaattga cattgaagga tatggcgaag gtgacgttga     97920
     ttatgaggaa ccgattaatg tatcaattcg caataaccac tttgttggaa acgtttcaag     97980
     ttctgtgacc aattttaacg ggtatggcat tttaatagaa ggaaatcact cagacaatac     98040
     aatcagctac ggatatggga cgcaaacagt gatcaagggc aatattctga gacgccctga     98100
     agacgcggcg gctgcgccaa gagtcgggat aaccggactc ggtgtatcac aaggaaaaga     98160
     gaccagtgat gcagtgatcg ctggcaacct cattaccgga ttttcaactg gaattgatgt     98220
     caggggaaag agcgttcttg tgacgaacaa caaaatcagc aactttgaaa acacagggat     98280
     attggtttat cagtcctccg acgtaaaggt agacggaaac caaattcaaa acggactgtc     98340
     tgaaacaagg cgcagcatcg gtcttcgcgc agtgctgtca gatgacatcg catttctgaa     98400
     taactgtctc attcaagtcg ttgacggtgt gaacgtttcc ggcggaaata tgatcattaa     98460
     agataatctc ctgagaaaat tcagccgggg catttggatt gctcaaggga acgcggtgat     98520
     tgaagggaat acactgaatc ctgacgcgtt tgaagcagtg ccggaatcat attctgtttc     98580
     cgtcacaaac aatgccggcg ccatcatcaa aaacaataca tttaaagagt tcaaaaatta     98640
     ccccatttat tgctccacaa gtgcaaaaac ctcaattatc ggcaaccact tagagcgatc     98700
     cccgcttttg gtcaccatct atatcagcgc aggtgtgcat gagatttttg ataataccat     98760
     ttcagtcaac agaacagccg ggaatccgat tgtgatttat ctcaatggct ctgcaggctc     98820
     tatcatctct ggaaacacca tcaataacct ctccgcgggc actgcgacag ctattcaaac     98880
     aaacacgtca accaattcca aaatcatcgg caaccgcatt tttaaaggga ccatcaacaa     98940
     acacagcagt gatacaatag acggcaatat gattgtctga aaaaagcgcc cccctttagg     99000
     ggttcttttt tttcgattta tagatcacgt acatttctct cacaagtact aacacaaaaa     99060
     ataaaagcac gacccattcc gcaaatgttg tcatcttaaa gctggacata ttgttataaa     99120
     cggcttttgt taaactgaac ccttgaagca tgtccatcaa cacagaaata gctagtaaac     99180
     aaattaatat gaatccggtc acgcccaata tcttcatgct tcatcatcct ccgctcttag     99240
     tgtctatctt tggcggagaa gttataccgc atctaaccct aatgcataat ctcaatttta     99300
     aaaggaagaa tatgagaaaa cgacaaggaa aggtatttgt gtatgccttt attttctaag     99360
     cgaaagaaca ataccgattc aaaagacaag cagaatacag acgaaaggaa tcaggaacag     99420
     cagcaagaaa aagaaaggcc ggttctcatt tctccaagtt tagcaaagaa tatagcggaa     99480
     acgaaaaagg aagtcggaag cagctctgac gtcatcattc gcgagattaa aatcggggag     99540
     caggatcatg tccacctagc tgttatctat atttctgggc tggtcgataa taacacgatc     99600
     catgagtcgt taattgaccc attggtacag gatgagtcta tccagaatac tcatgcgatc     99660
     cagcaaattc ttgaaaaaac gctcccgctg ggcggggtga aagcggaaaa gagctgggac     99720
     aagctttttt ccgagttaat gcttggcaat gcgctcattt ttgctgatgg ccatgatgaa     99780
     gctttgattt gcagcactca agggggagag cagcgctcca tccaagagcc gagcacccag     99840
     gtgtcattcc gcggcccgcg ccaagggttt acagagtctc tgcaaaccaa tatttccatg     99900
     atccggcgat acattaaaaa tccgaattta tgggttgaaa aaatgaaaaa aggttctgtt     99960
     acgaatacgg atatcgctct catgtacatt caaggaatat gtgatgaaaa ggtgctgaag    100020
     gaagtgaaac agcgcctgga aaaaatagat attgacagta ttttggaatc tggatatatt    100080
     gagcagctga ttgaagatga aacctttacg acgtttccga ctatgtatca tacagaacgc    100140
     cctgatgttg tagcgggtaa tctgttagaa ggaagattcg cgattattgt ggacggaaca    100200
     ccgtttgtgc ttattgcccc agccttattt gtccagtttt ttcagtctgt tgaggattat    100260
     tattcgcgtt ttgacattgc gacaagcata agaattcttc gtgttttagt ctttttcatt    100320
     tcgcttgtgg caccagctgt atacgtggca gccacgacgt ttcatcaaga aatgataccg    100380
     actcagctgt tagtggtcat tgcggcccag cgggaaattg tcccgtttcc ggctgttgtg    100440
     gaggcgctga cgatggaggt tgcttttgag attctgaggg aagcgggagt caggctgccc    100500
     cgggttgtcg gctcggcagt gtcaatcgta ggcgcgctcg taatcggcca ggctgccgta    100560
     caggctggta tcgtctctcc ggcaatggtg attatcgtgg cactcaccgc gattgcgagc    100620
     ttcgcaacac cggcgtttgc aatggcgatt tcagcccggc ttattcggtt tatctttatt    100680
     attgcctcag ctgttatggg tttttacggg ctgattttag ggatcattat gatgtttgtc    100740
     cacttatgca gtcttcgttc attcggcgtt ccatatatgt cgccgcttgc acctttttct    100800
     tcacaaggcg taaaggacgc gcttttccgg gttccgtggt gggccgatga aaaaaggccg    100860
     gaatcggtca gcaaggaaga taaggtgcgg caggggaaag atcaacgccc agagccggcc    100920
     gcttcacgag gaatggtgaa caaagatttg gaagaagggg atcagaatgg tacgtaaatg    100980
     tctattagcc gttctcatgc ttttgagcgt cattgtgctg cccggctgct gggataagcg    101040
     ggagctgacg gatcttgcga ttatctcggc gattggcatc gatcggacaa acgacagcaa    101100
     ctacgtgctg catcttcaaa ttatcaatcc aggaaatgtt gccggcggcc ttcagggagg    101160
     cggtgctgga gacaggccgc ctgtatctgt ctattcgatt gaaggtaaca atataacgga    101220
     agcactcaga aaagcctcca tgaaggtatc acggcggctt tattttgccc ataccaatct    101280
     agtcgtgatc aatgaaaagc tggcaaaaga agaaggtttg gattttgtat tagataatct    101340
     tgaccgggac acagaattca ggacaacagc aacattcgtc gttgcccata aaacaaaagc    101400
     agaaaatatt gtgaaaatct tgacgccgat tgataaaatt ccgtcaaata aagtcaataa    101460
     aacactcgat ttcacggagg cacaatacgg gcgggtggtc aaaatcaata ttcaggacgt    101520
     tttgaaaaca cttgccgcca acactatggc accggtcatc cccggatata tgatgattgg    101580
     tgacgataaa aaaggagtca gcatggaaaa cacgcaggcg actgacccga aagccattct    101640
     tcaggcagat ggtttggcgg tttttgataa ggcaggatat ttaaagtatt ggctggaaga    101700
     tgatgaaagc gtgggggcag tctggcttat gaataagatc cagcatacgt ttattaatgc    101760
     tgactggggc aagacgaagg atgcggtcag cttgcaggtt acccatcaag atacaaagct    101820
     ggtaccgaaa atgcggaacg gacgcccgta catccatgtg aaagtgtcgg ttgaaggtat    101880
     tatagatgct gtcaaatacc ctttccaatt gtctgatccc aaggtgctgg ccgctattga    101940
     aaaagcgctc aacaaagagc ttgaaaagga aatcagccat actgtgaaaa agattaagaa    102000
     gaataaaata gattttatcg gttttggtga cacgatatat agaaagtatc cggagcagtg    102060
     ggagaaaatg aaggacactt gggacaaaga atatttgccg gaactgccca tcgatgtgaa    102120
     ggccgagacg tatatcagaa ggacgggatt gcgaaacaat ccgatcaaac accagtttaa    102180
     agatgattag gtctgaagaa aggggaagtg acagatggaa aaagccagaa taagcataag    102240
     gcagttgttt gtcatgatta tcatttttga actgggcagc tccttattga ttacaccggg    102300
     atcaatggcg ggcagggatg cttggatagc agttttatta ggctgtgcga tcggactgtt    102360
     tcttttctat ttgtatcaag gcatttatca atgttatccg aattcttctc cgaaagaata    102420
     tatggatgat atgctgggaa ccaagctgag ctggctgttt tcatttctct atatcttgta    102480
     ctttgcctat attgccgcaa gggtgctgcg tgactttgga gaaatgctgc tgacgtttgc    102540
     ttatcatgat acacctatca ttattgtaaa tgctttatta atggtagtaa gcatatatgc    102600
     cgtaaggaaa ggaattgaag tactcgcacg cgcggccgaa cttcttttcg gggccatgta    102660
     tttactgggc gcgatcggcc ttgtgctgat tattgtctca gggactatag acccgcacaa    102720
     tttaaagccg gttttggcaa acggcatttc tcctgtcctt cactctgttt tcacacagac    102780
     catgtacgtt ccatttggtg aagttgtttt atttgtgatg attttcccta acctgaatga    102840
     cagaaaagat gtgaaaaaaa tggggatgat cgccatggct attagcggat tgattgtggc    102900
     gctcaccgtg gcgattaata ttagcgtgct tgatgttgat cttacactca gatcccagtt    102960
     tccgctttta agcacgatcc agacaatcaa ggtcgaagaa tttttagacc ggctcgatgt    103020
     cttttttatg ctggcgctga tcatcggcgg cttctttaag gtcagcctct acttatatgc    103080
     cactgtggtt gggacatcta cgctctttaa ggaaaagaac ccctctcaat tggcttatcc    103140
     gatgggattg ggcatcttaa tcctttctat aacgatcgcg actaactttt cggagcactt    103200
     gaatgaaggc ctgaacgtgg tgccgctgta tattcatttg ccttttcaat tattgtttcc    103260
     gctctttctg tttattgtgg ccgtttggaa aaagaaacga agagagaagt caaaagggga    103320
     ggaagcaaaa aaatgataaa aagagcgggg ggatgcggcc gccgctcttt ttatgttcac    103380
     ttctatataa aagggggata tagggtgcgc ccctgtctgc actggcagag gcgcgttttg    103440
     ttatacgact gcgacgtttt ccttcacagt aaaacttcct cttgaaagtc tgatattgat    103500
     gtctgacact tttgcaattt gttcatcgtg cgtcaccata atgacgcatt tatcttcctt    103560
     gtgcgccaga tcctgaaaga gccgtacgat ctcttttgat gtgtcctcat caaggtttcc    103620
     ggtcggttca tcggctacga taagatccgt gtcacagcag aaagcccttg taattgatac    103680
     ccgctgctgc tgtccgccgc tcagtgtgag cactttttgc cgggcttgtt tttcgttgat    103740
     gccaaccttc tgcagcatgt caagcgcata tgattctttg ttcttttctt tagaacctgt    103800
     gatttccata gcggttgtga cgttctgcaa agccgtcata tacgggagca ggttgtacgc    103860
     ctgaaagacg attgatacat attgatttct gaaattggtt aagccgattt tagaaaccgc    103920
     ttttccgtcg taaaggatgt ttccttcttt tggtgcgtca agtccgcctg ccagagacag    103980
     gaaagtggtt ttccccgtcc ctgatgttcc gacgattgtg tagaattttc ctttttgaaa    104040
     gctgatgtta atatcctgaa acaatggctg gcttttgttt ttataccagt agccgacttg    104100
     ttgaaattgt aataagctca taggttccgc ctctttctat tcctgttttg tcaatatcgt    104160
     tttcggatga agccgcagta ctgaaattga cggcagcaat gttgcaatga ttgcgattag    104220
     gatgccgatc ccgccaagta taagcatgtc gttcatagaa accgcgacgt tcagtgaatc    104280
     gataacgtcc acgttggatg aactgtggcc gaacattttg ccgcccatgc cgccaccgcc    104340
     gccgggcatt tgtccgcttg cggtttgcgt tgaatcggtt gatgaactga tttgctggga    104400
     taaaagctga tttccaagct gattcgcgac gagatttccc gtcacagatg caaggccgat    104460
     agcgataacg gccacaatca gaatctcagt caagaactgt ccaatcaatt tccatcgttt    104520
     ttcaccgatg gccattaaca cgcccatttc gtatttgcgc tccctgattg acatcatgac    104580
     aatcaggcca agaatgacgg cgcctgccac tgatacaaga tacaccacgt ttttagagaa    104640
     agaagccaca ttttcaatcg gtccgaccat ttgctggtaa agctgatcgt ttgtattcag    104700
     tgtgtacgta tcaaagtcaa ttgatgtttt cttcgctgct tttacgaaag tatccatatt    104760
     tttcgcgtcg tccatatagt aaacagctga gtcaatcgta tttttatagt cgtcgccttt    104820
     caatgccgct gttgctgtgt aaggcgtata aagcttgtta taaggattta agaaagagaa    104880
     attttgggct tggtcatcac ctgaagatgt tgttttataa ataccgacga tcttcagttt    104940
     tactgttgta tcctcatccg ttgctgattc aattgtgatc gaatcgccaa cgcttaaatc    105000
     attttcttcc gctaatgttt cgttgatcac tgttactttt ttgccgacat ctgattttgt    105060
     aatcgcgcgt ccgtctgtga tttttgaatc tccgtcagag aaatcatcga ctaacgctgt    105120
     gctgatgaca ccttcaatag aaagatcagc ttgaaccatt tgcggtccgc cttgtcctcc    105180
     gccttgactg tttttagcgt ttgagcttga actgctggag ctggaatcac ttgaactaga    105240
     gctttcaatc gcatcaaagt ttcccgcgtt ggctgaagct gatgtggtgt aattgtagct    105300
     cttcacatga tcaagcgctg caagcttatt cgcatcagac actttgatcg gtgtggattc    105360
     gaacgtgcgc ttttcaccgc tgtcctgctg tttttccatt tgcttttggc ggtcaacctg    105420
     aagtgtcacg cttccaccga gttcctgtct ggccagttcg cttgactttt gtgctgccga    105480
     ctggatggcg aggcctgata gaacaaagac acatatgact gtaaacacaa ataattgcaa    105540
     taacgttttt ccctttttag ccttcatatt ccaaaaggcc cgtttgataa agttcattta    105600
     tgttcctccg tataggtatt tttattgata agaccgcctc tggggcgcgt ccccttgctg    105660
     ataaattaat agtagtccaa aggtatgaaa aaaatatgaa caatctattt ctagttgatg    105720
     aaataaaaac taacaattgt gaaacgcaaa accttctgtt taaaatggtg ctattatata    105780
     aaaaagcatc aaaacaaccg gaggatataa tgaaaatatt aatgatagaa gataatgtta    105840
     gtgtatgtac gatgacggag atgttctttt ttaaagaagg ttttgaagcc gaattcgttc    105900
     atgacgggtt agaagggtac cagcgtttta cggaagaaaa ttgggatcta atcattttgg    105960
     atatcatgct tccatctatg gacggcgtga ccatctgcag aaaaataaga gagacaagca    106020
     cggtgccgat tatcatgctg actgccaaag acactgaatc agatcaggtc atcggttttg    106080
     agatgggggc ggacgattat gtcacaaagc cgttcagccc gctgacattg gttgcccgca    106140
     tcaaagccgt catcagaaga tataaggcga caggcaaagc ggttattgat gaagatatga    106200
     ttgaaacgga atgctttacc attaataaga agacgagaga agtattatta aacggagagc    106260
     ctgtagaaaa tctcacgccg aaggaattcg atctgcttta ttaccttgtc caaaatccgc    106320
     ggcaggtgtt ctccagagaa cagctgcttg agcaggtatg gggctatcaa ttttatggag    106380
     atgagcgaac ggttgacgtt catatcaaac ggctgcggaa aaagcttgcc agcgaggaca    106440
     agcctttcct gtatactgtg tggggagtag ggtataaatt tgatgaagat taaatattta    106500
     tatcagctgc tgctaagcca tatcagcatt ttgattttag cgtttgtcat tatcatttct    106560
     ctgttttccc actttgtgaa ggaatttgcc tatcagaaca aagtagagga attgacgtca    106620
     tatgcggtgc agattgcaaa tgaattccaa tccggccagg tggacatgcg caggctctat    106680
     ccttatcagg acattttaag cacaagaaag acgcaattta tcatctttaa tgaagagcag    106740
     cagccttatt ttcttcctga aggctttcat cacccaccaa gggaacagct gaagaaatca    106800
     gaatggaata agctgaaaaa agggcagact gtcacgatca gggcagatgg ccgttttgat    106860
     gatgaagtgt cccttgtggc gcagcctata tttgttcaga acgaatttaa aggcgccgtt    106920
     ctgctgattt ctccgatcag cggtgttgaa cagatggtca atcaggtcaa cctctatatg    106980
     ttttacgctg tgatcagcac gcttgtgatt acgattcttg tgagctggct tctgtccaaa    107040
     ttccatgtca agcggattca aaagctgaga gaagcgacag ataaagtggc ttccggcgat    107100
     tatgacatcc atttggaaaa cagctacggg gacgaaatcg gcgtactggc gtctgacttt    107160
     aatatcatgg cgaaaaaact aaagcagtca agggatgaaa tcgagcgcct tgagaagcgg    107220
     agaaggcagt ttatcgctga cgtgtcacat gaattaaaaa caccgctgac gacgatcaac    107280
     ggtttggttg aagggttgaa cagccatacg attcctgagg ataaaaagga taaatgcttc    107340
     tcgctgatca gtgaggaaac gaagcgcatg ctgcggctcg taaaagaaaa tctggattat    107400
     gaaaaaatca gatcccagca aattaccttg aacaagctag acgttcctct gatcgaggtg    107460
     tttgaaatcg tgaaagagca cttgcagcag caggcggaag aaaaacaaaa caagctgatg    107520
     atccaagtag aggatcacgt catcgtacat gccgattatg accggttcat tcaaattctc    107580
     gtcaacatta cgaaaaacag catccaattt acgcaaaacg gtgacatttg gctgcgcgga    107640
     atggaaggtt ataaagagac gattattgaa attgaagaca cgggtatcgg cattccaaaa    107700
     gaggatattg agcatatttg ggagcgattc tataaagcag atatttcaag aacgaacaca    107760
     gcatacggtg aatacggact cggtctctcg atcgtcaggc agctcgttga aatgcaccag    107820
     ggcacagtag aaatcaagag tgaagaaggg aaaggcacaa agttcatcat ccgccttcct    107880
     ttaacggcaa aacagcaata gcatacaggg cggcgcatca actgatgcat ccgccttttt    107940
     tgcacaccgc ttcggtttat tgcgtgctcc cgaaaacaaa gattgcgtgt ttttcgggtt    108000
     gggacggcct ataaacatga taaaatatga cataaacagt ttttgatggg agagggtgaa    108060
     ggaatgaaga gtggggtaat tccttcttca gcggtcggtc aaaaaattaa cgagtggtac    108120
     agatatatcc ggacattcag cgtgccggat gccgaagtgt taaaagctga aatccagcag    108180
     gaactgaaac acatgcagca tgattccaac ttgctgcttt attattcact aatggaattc    108240
     cggcaccagc ttatgctgga ttatcttgag ccgttagaga aattaaatat cgaagaccag    108300
     ccaagcctgt ctgaattatc aagaaacatt gacagcaacc aggcagatct caaagggctg    108360
     ctcgactatt acgtgaattt ttttcgcggg atgtatgaat ttgataagcg ggaatttatt    108420
     tctgccatta catactataa acaggcggag aaaaagctct cctttgtcgc agaccatatt    108480
     gaacgggctg aattctattt taaaatcgcg gaagcttatt attatatgaa gcaaacgtat    108540
     ttttcattga ttaatataaa aaacgcctat gaaatttacg tggagcagga aacctataat    108600
     gtgagaatca ttcagtgcca tttcgtcttc ggggtcaacc tgatggatga aagaaatttc    108660
     gaacaagccg cacgccattt caaattggcg ctcaacatgg cccaagcaga acaaaaagcc    108720
     cagctggttg gaagagcata ctacaatctc gggttatgct attacaatca agaccttcta    108780
     gaccctgcca ttgattactt tgaaaaagcg gtctccacat ttgaaagcag caggatcgtc    108840
     aattctctcc cgcaagccta ttttttaatc accctgattt attataaaca gggaaaacat    108900
     gataaagctt cggaatatca caagcggggc tatgaatatg ctaaagaaac agacgatgca    108960
     gactatgccg taaaattcga gtttttgcaa tccctatatc tggatcagcc caatgaagaa    109020
     ggaatcgaac gatgtttcca gtacttaaaa aataaaaata tgtacgctga tatagaggat    109080
     ttagccctag aagtagcaaa atattactat gaacagaaat ggtttaaact gtctgcttcc    109140
     tactttctac aagttgaaga ggcaagaaaa caaatacaaa ggagtgaagg tttgtatgaa    109200
     attgaaatct aagttgtttg ttatttgttt ggccgcagcc gcgattttta cagcggctgg    109260
     cgtttctgct aatgcggaag cactcgactt tcatgtgaca gaaagaggaa tgacgtaaga    109320
     acaagcccct tctcattagc gagaaggggt ttttcttttc aaaaaaacac cgcaagacat    109380
     agtcttgcgg tgccgccttc atggagatta cgtttattta gtagcctcct acaaatgcag    109440
     ttcccacaat gatcaagagg ataaataaca caacaatcaa agcgaaagaa gttccgtaac    109500
     ctgacatttt gtgcacctcc ttgcgagatt gcttcagcaa atgctgcaaa actgtggcgg    109560
     acagggtccc gcagagacgg tcagcagctt agaagccgcc aacaaacgca gtccctacga    109620
     taattaatag aataaacaat acaacgatta aagcgaaaga actgatgccg ccgtaaccgc    109680
     cgccgttaga gtatcctgac ataaggtttc acctccctat gaaggatact ataagatatg    109740
     ctgaaccgat ccatttggca gggataatag tggacaagag aaaaaatgaa gaattcggct    109800
     atatgaaggt gatataaaaa aatagcgggc gctgccgccc gctatttatg tacgattaag    109860
     agatcagcac gcccgcgaaa aattcctggt ataacgcttg aacggctttt ctttcttcgg    109920
     cttcttttac gccaaacatc atgctcactt cagaagaccc ctgattgatc atttcgatat    109980
     tcacctgtgc ctctgataat gctttggcgg ctcttgccgt tgtaccgaca ttgtggcgca    110040
     tcgcttcccc tacaaccata atcagggcga gatgatgctc gacgatgact tcatcggcat    110100
     gcaaatcctc ttcgatccgt ttgatgacgc tgcgttcagt ggcggcatcc atttgcccct    110160
     gccgtaaaat gattgtcatg tcatcgattc ccgatggaac atgctcatac gtcaaaccat    110220
     gctcctccag gatttgaagg gctctgcggc caaaaccgat ttctctgttc atgagatact    110280
     tgctgatata aatgctgcaa aaaccggtgt cgctggcaat gccgacgaca ggcccgtttg    110340
     tgttatcccg cttgctgacg acgcgggtgc cttcggctga ggggttgttc gtatttttga    110400
     tctgaacagg aatccccgct ctgaatgccg gaatgagcgc ttcatcatga aacactgaaa    110460
     aacccgcgta ggacagctcc cgcatctctc tatatgtcag ctcgctgatt tcctttggat    110520
     tctcaacgaa ggacggattg acagaataca cagcgtctac gtctgtaaag ttttcgtaca    110580
     aatcggcttg tagtccgttg gcaagaatcg aaccggtaat atcagaaccg ctccgtgaga    110640
     atgtgatcac atcgccatcc ttgctgaatc cgaaaaaacc gggaaaaatg atgagtccgt    110700
     cacgttcccg aagacgatag aggttttgat aggattcagg aagaacttgc gcgttgccgg    110760
     gttcatttgt cacaaagagg ccggcatcct tcgggtttac atattccgct ttgacgcctt    110820
     tataacggaa gtaagcggcg atcagtttgg cattgttatc ctctccgctg gccttgactg    110880
     cgtcaaggta ttgttcggga ttgcttttgt ctccttctaa aagcgtaaac agatcatctc    110940
     tgattttttc gataatgctt tgccccagct gaagctcatt ggcgatgaga gcgtaccgtt    111000
     ccacaacagc ttccgccagt tcaggtgcgc tgcctgttgc caaatattgt tctgcacatg    111060
     cgattaagag atcagtcact ttcgtatcct cggcatagtg ttttcccgga gctgaaacga    111120
     ctacagcttt ccgtgccgga tctgaggtaa cgatgtgaaa caccttgtca agctgggcgc    111180
     ctgaagcaag tgagctgcct ccgaatttaa cgaccttcat gtttacatct cctaatgttt    111240
     aaaattttca cacaaattta gtatttatta tctctctttc agtactgtaa atcaaggggg    111300
     aatttctttc tcaggagaac atttgtattt ttcacgagga ataatgttag gtttgctgac    111360
     cgtatgcctg cgttataaag ataaatatgg taaacagcct aacgttttgg gatggaaaat    111420
     ggttagaatg attagtaaaa ttgataaatg actaggttaa tatttttaaa gaatattgac    111480
     taaccctata aaaatggtaa tatgtaaatg ataatgataa tcaattacta tatggccata    111540
     ttgttttgag tccttgcgga gtaggagata cgttcttttt gctgtaagga tgtaaggagg    111600
     cagcatgaag ctacgttact tatttattct acttatcata ttagcagtca catctgtatt    111660
     tatcggtgta gaagatctgt cgccgcttga tctcttcgat ttaagcaaac aagaggcgtc    111720
     aacgctgttt gcaagccgtt tgccgcgatt gatcagcatt gtcattgcgg gattaagcat    111780
     gagcatctgc ggtttgatta tgcagcagat cagcagaaat aaattcgtgt caccgacgac    111840
     ggcgggcacg atggattggg cgaggctcgg cattttaatt tccttgctgc tgtttacatc    111900
     cgccagtcct ttaatcaaaa tgctggtcgc gtttgtcttt gcccttgcag gaaattttct    111960
     gtttatgaaa atccttgaaa gaatcaagtt taacgacacc atctttattc cgcttgtcgg    112020
     tttaatgctc gggaatatcg tcagttcaat cgcgacattt atcgcatata aatatgactt    112080
     gatccagaat gtgtcatcat ggctgcaggg agacttctct ttagtcgtga aaggaagata    112140
     cgagcttctt tatctgagta ttccgctcgt catcattgcc tatgtgtatg cggataaatt    112200
     cacattggcc ggtatgggtg aaagcttttc tgtcaacctc ggcctcaagt ataaacgggt    112260
     tgtgaacatc gggctcatta tcgtgtccct gatcacgtct cttgtcattt tgactgtcgg    112320
     tatgctgccg tttctcggtt taatcatccc gaatattgta tcgatttaca gaggagacaa    112380
     tctgaagagc agcctgccgc atactgtgct gttgggagcg gtttttgtgc tgttttgcga    112440
     tatactgggc agaatcatta tcttccctta tgaaatctcg attggcctga tggtcggaat    112500
     catcggcagc ggcattttcc tgtttatgct gttaaggaga aaagcctatg cgtaaccaga    112560
     tgaaaatagc tttgctcgtt ggtttagcca ttgtatgtat tggcttgttt ttgttttatg    112620
     acttaggcaa ttgggattac accctgccga gacgaatcaa aaaagtcgct gccattgtgc    112680
     tgactggggg agcgattgcg ttttcgacca tgatctttca aacgattacg aacaaccgca    112740
     tcctgacgcc gagcattttg ggccttgatt ctctctacat gctgattcag actggcatta    112800
     tctttttgtt cggttctgcg aatatggtca tcatgaataa aaacatcaac tttatcatct    112860
     ctgttctgct gatgatcctg ttttctcttg ttttgtatca gatcatgttc aagggtgagg    112920
     ggagaaatat ctttttcctt ctgcttatcg gaatcgtgtt tggcacgctg ttcagcagcc    112980
     tgtcttcttt tatgcagatg ctgattgatc cgaacgagtt ccaagttgtg caggacaaga    113040
     tgtttgccag ctttaacaat atcaatacgg atttgttatg gctcgcgttc atcatcttcc    113100
     tgctgacagg cgtttatgtc tggcgtttta caaaattttt cgatgtgctg tcgctcggac    113160
     gcgagcacgc cgtgaatttg ggcattgact acgacaaagt ggtgaagcag atgctgatcg    113220
     tggttgcgat tttggtttct gtttcaacag cgctagtcgg gccgattatg tttttaggcc    113280
     ttctggtcgt caacctggcg agagaattcc tgaaaacata taagcattca tacttaatcg    113340
     caggctccgt tttcatcagc atcattgcgc tggtcggagg gcagtttgtg gttgagaaag    113400
     tgtttacctt ctcaacgacg ctgagcgtca ttattaattt tgccggcggg atttatttta    113460
     tctacttgct gttaaaggag aataaatcat ggtagaggtc agaaatgtaa gcaaacaata    113520
     tggcgggaaa gttgttcttg aagagacgtc agtcacgatt caaaagggca aaatcacctc    113580
     gtttatcggt cctaacggcg ccggcaaaag tacgctgctg tctatcatga gccgcctgat    113640
     caaaaaggat tccggcgaga tttacataga cggacaagag attggagcat gtgacagcaa    113700
     agagcttgcc aagaaaatga gcattttgaa gcaggcgaac caaatcaata tcaggctcac    113760
     gatcaaagac ctcgtcagtt ttggcaggtt tccgtactca cagggccggc tgacagagga    113820
     agactgggtt catatcaacc aggcgcttag ctatatgaag ctggaagaca ttcaagacaa    113880
     atacttggat cagctgagcg gcggacagtg ccaaagggca tttatcgcca tggtcattgc    113940
     ccaggacaca gattatatct ttctggatga accgctgaac aatctggata tgaaacactc    114000
     agttgaaatt atgaaactgc tgaaacggct ggtagaggag cttggaaaaa cgatcgtgat    114060
     cgtcattcac gatatcaatt ttgcttcagt ctattctgac tatatcgtcg ctttgaaaaa    114120
     cggccgaatc gttaaagaag gaccgcctga agaaatgata gaaacatcag tgcttgagga    114180
     aatctacgat atgaccatcc cgattcagac gattgataat caaagaatag gtgtttattt    114240
     ttcttaatat atagaagagg tgaggagcat gaaaaagttc gcgttactat tcatcgcttt    114300
     ggtcactgcc gttgtcattt ctgcatgcgg aaaccaaagc acaagcagca aaggttctga    114360
     tacaaagaaa gaacaaatca cagtgaaaca ccagctcgac aaaaacggca caaaagtacc    114420
     gaagaaccct aaaaaagttg tcgtatttga ctttggaagc ttagatacat tagataaact    114480
     aggacttgat gatatagtag cgggcctgcc gaaacaagtc cttcctaaat atctgtccaa    114540
     attcaaggat gacaaatacg ctgatgtcgg cagcttaaaa gagccagact tcgacaaagt    114600
     ggcagaatta gatcctgatc tgatcattat ttcagcaaga caatctgagt cttacaaaga    114660
     attctctaaa attgcgccga cgatttacct tggtgtagat acagcgaagt acatggaatc    114720
     atttaaatca gacgctgaaa caatcggtaa aatctttgat aaagaagaca aagtgaaaga    114780
     tgagctcgca aacattgatc actcaatcgc agatgtaaag aaaaccgctg aaaagcttaa    114840
     caaaaacggt ctcgtcatca tggcgaacga tggaaaaatc agcgcgttcg gccctaaatc    114900
     aagatacggc ctgatccatg acgtattcgg cgtggctccg gctgatcaaa acatcaaagc    114960
     gtctacgcac ggacaaagtg tttcttacga gtacatttca aaaacaaacc ctgattactt    115020
     gtttgttatt gaccgcggta cagcaatcgg agaaacatca tctacaaaac aagtcgtgga    115080
     aaacgattat gtgaaaaacg taaacgcagt gaaaaatggt catgtcatct accttgattc    115140
     tgctacttgg tatttatcag gaggcggact tgagtctatg acgcaaatga ttaaagaagt    115200
     gaaagacggt ttagaaaagt aaaaccaaaa agagcctccg ctaaatagcg gggctctttt    115260
     tttgttaatc agcgtgccgg ctgctgttcg gcagggcgct gaggtttctt taatgtgaat    115320
     gagagaagga agccgacaag tgcaatgacg gcagccacta taaaagcggc gttcatgccg    115380
     tgcagggcgg cgtgcttcac atttgtcgtg cctgcatgtg ccgcctggtt gctcatcacg    115440
     gaaaccaata gtgcggttcc gatcgagccg ccgacttggc gaatcgtgtt gttcatcgca    115500
     gttccgtgcg gaatcaagtg gcgcggcagc gcattgattc cggctgttgt caccggcatc    115560
     atgatcatgg cggtgcctaa gagacgaacg gtgtataaaa cgacaatcca agcgagtgac    115620
     gtatggtcag tcagctgcat aaacggcaga gatgtcagga agatgatgca gaaaccggca    115680
     atcgccagcc ctcttccgcc gacacggtca aaaattctgc cgataatcgg cgacataaag    115740
     cccatcacaa cggctcccgg caggagcata agccctgtat caaaagctgt gacgtctctg    115800
     acattttgtg tataaagcgg caggatggtt tccgtaccga tcaataatgc aaagacgagg    115860
     gttcccagca gtgttgttaa gctgaaaacg ccaaacgtga agacgcggaa ttccagcatc    115920
     ggttttttaa gcttcatttg tcttgtgata aacaagagca gcgcgatgac acccaccagc    115980
     agtgaaatca agacggttga actggaccag ccataagagc cgacgcttga gaagccgtac    116040
     agaaggccgc cgaacccaaa tgttgaaagg atgactgata aaatatcaat ctgtgttttt    116100
     cttaaagtcg tcacgttttt catcaggatg ctggcaagaa tcaaatcaat cacagcaaac    116160
     ggaagaataa tataaaacaa tgatctccaa gagaaagctt cgacagccca tccggaaaga    116220
     gtcggtccga tcgcaggcgc gaatgagatg accaatccga ccatacccat agcctggccg    116280
     cgcttttcaa tcggaaagat tgtcaggaat acagtctgca tgagcggcat cataatgccg    116340
     gctccagccg cttgaatgat acgcgctgtc agcagaaccg ggaagttcgg cgcgaacgct    116400
     ccgacgactg ttccggcagt gaaaatgctc attgctgtga tgagcagcgc ccggcttgtg    116460
     aatttctcaa ttaaaaacgc ggtaatcgga attaaaatcc cgttggttaa cataaatgat    116520
     gttgtcagcc attgtgcttg gttggcatcg acattgaaat ccctcatgat atggggaagt    116580
     gcagtaatca acaatgtctg gttcaaaatc gccacaaacg ctccggctaa caaaatgccg    116640
     acaatgacag aacggttaaa aggtttttgt tcaatacttg tgttcaatac atatcccttc    116700
     ttttctctaa gtaattaaca gtgtttttaa catggaaacg ggctgtgtta aaacaccggt    116760
     ttgttccaga tagccaatca gtgatttgag taaaaaagcg cggggttctt ccttcttcgc    116820
     ttcttcctcc agcatagcgg ctgcggatgt cagttcatct acgtcatagt ccgcggcgga    116880
     cagggaagag atgcctttat gtaattcctt caggctttcc gataatagga ctgatttatc    116940
     ctttggcttg taggaggatg ctgaatgaat ataaagctcg atggcttcgg gcggaagaag    117000
     agactggcgg gtttccctgt ttttgataat ctgattgagg gtgctgatga taaactctgc    117060
     gatcgggtca agctcaagcg gtttttcctc gattttgatc agcattaaaa actcacgcat    117120
     catgccgtga agaatgataa ccaaatccca cacaaacggg agaatggttt ctccatacgc    117180
     ctggatcagc gaatcgcggt gccagcagat aatcgtcgat ctggtctgat ggatatgctg    117240
     tttgacccgg tcattgtgca gcctggggtt tccgtaggtc agcatattga aaaactgctg    117300
     attccgcctg aagccctcca gttccatttt gaccttttgc gtcaaacgct cctccggtgt    117360
     aagtgctgta ttttcctgaa gtcttgaggc cgcggccacc atttgcttct ggttaaatga    117420
     cagcagctcc aaaagcagat cttctttaga ttggaacagc ttatatatcg aagcttttga    117480
     catcttacat tcttctgcga tcgcctgcat ggaaaccgac gtaaaatcct tttccgaaaa    117540
     aagctttcgc gcggctaaca agatatctgt ttttttatca agcatctcat ggcttccttc    117600
     tttcttgaac attagaaaac ccattggttc acagaaaacc aatgagtaac aatgaaaaaa    117660
     ttttaccaga taaacaaaat agaagtcaat ggattttaac cgggtaaatg aaaggcctgc    117720
     cggaaaatcc gacaggccga ataagagctt atttttcaac tttaaatcct tgtttttcaa    117780
     gcatttcacg gatgtgcgga tagtacaggc gctcatagta ggaagcgatg ctctgtgacc    117840
     agtttcttgt ttcttttccg tttgtccgtt tattcatgta ttcagacatc tgttcgtcgt    117900
     atgcctgaat gtgagacgtc agctcatcct gattcaaata agtttcctga tgattgacag    117960
     cttcctgcgg caagcgcggt tttttcgctg aacggtcggc aggatgccca atgacaaggc    118020
     cggataaagg gaacacgtat ttcggaagct caagcagttc gatcagctct tgagggtttc    118080
     cgcgaactgc accgatcgga actgtgccaa gtccgagtga ctcagccgct gctgttgctg    118140
     tgccgagggc aataccagcg tctactgcgc cgacaagaac agattccaat ccatttgtga    118200
     tttccatttt gaaatcatgc agatcttcaa gcgcaatttt ggcccggtta aaatctgcgc    118260
     agaacagcag gaaaacagga gcttgatcga tccatggctg gccgcctgcc agctcggaga    118320
     ttttcttttt gcgctcttta tcctggactg tgatcacagt cacttgctgt ccgttgatag    118380
     aagaaggggc tgattgcacc gcttcaatga tttggtccaa ttgctcctga gctacaggct    118440
     catctgtgta gctgcgaatc gagcggtggt ctgttaaaga tttaatcact tcattcatat    118500
     gagacaccct tcctttactc gctaagctct gtgcggacaa catcaagagg agcgctcagc    118560
     agttcttttc cttttgcgac aaacccttgg aaatgcgcag tttcgttatg gaatttcatt    118620
     gccgcttcat ctttccattt ttcaagcatg acaaatgtat tttcttcgcc tactttttcg    118680
     aataggtcgt attgcgcgtt gccttcctca gctcttgaat gctgaacaag tgattgagcc    118740
     tcgctcaaaa attcctcgcg tttttctggt tttactttga tgtaagcttg taatacgatc    118800
     atgtaaatct cctccgtcgt tatgcgaatt tattgttcga atttcatcga actaaatgta    118860
     acatgtattc taaatgaggt aaaggaaaaa cccttatata gtaaaattgt cattctaatt    118920
     gttgtatgat acatttgtgt catgaacatt ccaaaccatc cagaaacaga aacattgcag    118980
     ctgacaaagg ttcttcatgc acttagtgat ccgcttcgtt tagagctcgt caagcaatta    119040
     gctgaagcaa aagaaaaaac gtgcagcacc tgtgcagatg tgcaggttgc caaatcgact    119100
     ttgtcgcatc attttaaagt tttgagagaa tcaggcatcg ctcaagttcg gatagaagga    119160
     aagcgccggt attattcgct tcgcgctgaa gaccttgaaa aggcatttcc gggactgctt    119220
     gaagccgtgc tgaatgtaga ccaggaccgc tggtgaatca atcccctgta acggggattt    119280
     ttttatgtcc gtaaaccgct ttgaaaagcc gctgcacacc ctcctgaata tcttcttcct    119340
     tcagccgtgc aaagccgata atgagagcag gcctgcccgt ttgccgcttg ttttccttca    119400
     agttaaatcg gctcattccg aatatttcaa gctgcagccc ggcagcatgt gacaggatgt    119460
     cttgttcggt gcgcctggta tcaaattcgg taacaaaatg cagccccgca tttgcccctt    119520
     ttacggtaac ctctccgctg aactctgctt ctaaagcggt gatcaggcgt tctctctttt    119580
     ctttataatg ctgcttcatt ttttttatat gcttctgata ttcaccagac tcgataaatt    119640
     cctgcagggt gagctgtgtg agtgatgagc aagtctgcag atcatagccc cgctgtttgt    119700
     atgccctcaa cagctcaggc ggcaacacca tatagctgat ccgtaagccg gggagaaggg    119760
     actttgaaaa ggttcccata tagatgacat tttgaaaacg gtcgaggctt tgcagcgccg    119820
     gaatactgtc tacatcatat gtgaattcac tatcataatc gtcctcaatg atatatcggc    119880
     gcggctcctc ggctgcccag ttcagcagct gaattcttct ggatacaggc ataatcgttc    119940
     cggacggaaa ctgatgcgac ggggtggtca ccagcacatc tggctgctgt ctggtgattt    120000
     cagcaatcga catgcctttt tcatccagca tgatcgtctt tacttgtttt ccggcattct    120060
     tcaaaagctg atacatgcgc ctgtagccag gctcctccat cgcatacacg gcttccttgg    120120
     gtaaaagctc agtcaacagc tgcatgagca cctgtgtgcc tgcccctatg atcatttgtt    120180
     ccggcctgca ttttacaccc ctcgtcaggg aaatgagcct cgtaatggcc gctctcactt    120240
     catatatccc ttgcggatgt gacatatcgc cgagcgtgcg gtatgagcgg gaggccgctt    120300
     tttgctcgca gcggaaccag cttttgatcg gaaaatggtc tgtatcggaa ctcatgtgtg    120360
     aaaacgatat ccaatcgctc tggtcgatgt gaatctcttt taggtcatcc ggcagtgcaa    120420
     atggagggtg ctcctcggcg gaaaacatgt ctagttcctc cacgaagaaa ccctttcgtt    120480
     caatggcgta caaatacccc tcagccagca gctgctgata ggctgaattc actgaattta    120540
     cgctgacctt gagattttca gccagctccc gcttggaggg aaccttcgag tgcggcagca    120600
     gattgcggct gaggatttct tttttcagct tttgataaat ttgctgatag atataatcgg    120660
     cttgttctga acgatcgagt gtaatcgtga tatccatttt gtagtttctc cttctgatac    120720
     catcaaaaag ttataattgg tacttttcat cataccaaag agaagtcaga atgataagaa    120780
     aataccgaca gggggatatt cacatgagtc aaacaacagc aagcatcaca actgcacaat    120840
     ggcagcaaaa acgggatcaa tttgtgtcaa aaggtgtgag caacggcaac cgcagtctgg    120900
     cggtcaaagg agaaggggcc gagctgtacg atctggatgg ccggagattt attgattttg    120960
     caggcgccat cggcacgtta aatgtcggac actcgcatcc gaaggtggtt gaggctgtga    121020
     agcggcaggc ggaggagctg attcatcctg gttttaatgt catgatgtac ccgacttata    121080
     tcgaattagc agaaaaactg tgcggcatcg cgccgggcag ccatgagaaa aaagcgattt    121140
     ttcttaactc aggggcagaa gcggtcgaaa acgctgtgaa aatcgccaga aagtatacaa    121200
     agcgccaagg cgttgtctcg tttacacgcg ggtttcacgg gcgcacgaat atgacgatga    121260
     gcatgacaag caaggtaaaa ccttataaat tcggtttcgg gccttttgcg ccagaggttt    121320
     atcaagcgcc gttcccttat tattatcaga agccggccgg catgagtgat gaaagctatg    121380
     acgatatggt cattcaagca ttcaatgatt tctttatcgc ttcagtggcg cctgaaacgg    121440
     tggcgtgtgt cgtgatggag ccagtgcagg gagaaggcgg atttattatt ccttcgaaac    121500
     ggttcgtaca gcacgtcgct tcattctgca aagaacacgg cattgttttt gttgctgatg    121560
     aaatccaaac cggctttgcc agaactggca cttatttcgc aattgagcac tttgatgtag    121620
     tgcccgatct gatcacggtt tctaaatcgc ttgcggcagg cctgccatta agcggtgtga    121680
     tcgggcgtgc ggaaatgctt gatgcggcag cgccagggga gctgggcggc acgtatgccg    121740
     gcagcccgct cggctgcgcg gcggctttgg cagtcttgga tattatcgaa gaagaaggac    121800
     tgaatgagcg atctgaagaa attggcaaaa tcattgaaga caaggcgtat gagtggaaac    121860
     aagaattccc gttcatcggt gacatccgca gactcggggc gatggccgca atcgaaatcg    121920
     tcaaggatcc tgacacgcgt gagcctgata agacaaaagc agcagcgatc gcggcctatg    121980
     cgaatcaaaa cggattactt ttgctgacag cgggaattaa cggtaatatc atccgctttt    122040
     tgacaccgct cgtcatctca gacagcctat taaatgaagg gctcagcatc ttggaggcgg    122100
     gcctgcgagc ttaatcattg gaaagaaaat ggccgggtct gctatcattt taagtaatca    122160
     tgaaaagaaa ggaatgttca atatgccaga tcaattaacg gtctacaacc cggctacggg    122220
     cgaggagatc aaaacgattc ctcagcaatc agccacagag gtagaagaag ccattgaacg    122280
     ttcacatcaa gcgtttaaaa cgtggtctaa aacatcagcg aacgaaagaa cgtctctttt    122340
     gaaaaaatgg tatgagctga ttgttgaaca taaagaagag cttgcagatt taattacaaa    122400
     ggaaaacgga aaaccatacc aggaagcagt cggcgaggta ctttacggcg caggctatat    122460
     cgaatggttc gcagaggaag cgaagcgtgt gtacggaaga acggtcccgg ccccgacaac    122520
     tggtaaacga attgttgtca cacgccagcc ggtcggcccc gttgctgcta tcacgccctg    122580
     gaatttcccg aatgcgatga ttacacgcaa agcggcgcct gctcttgccg ccggctgtac    122640
     atttatcatc aagccggcgc cggacacacc gctgtctgct tatgaactag cgcgcctcgc    122700
     atatgaagcg ggcattccga aggatgttct tcaggttgtg atcggcgatg gagaagaaat    122760
     cggaaatgtg ttcacaagca gtccgaaaat ccgcaaaatc acgttcacag gctcaacacc    122820
     tgtagggaaa atccttatga aaaacagcgc tgacaccgta aagcacgtct caatggagct    122880
     cggcggacac gccccgctga tcgtagatga agatgcggac attgaccttg ccgttgaaca    122940
     ggcgatggcg tccaaatacc gaaacgccgg ccaaacctgc gtatgtgcca accgcctgat    123000
     cgttcatgaa tccattaaag atgaatttgc tgcgaaactg agcgagcaag tgtctaagct    123060
     gaaagtcgga aatggacttg aggaaggcgt caatgtcggc ccgattatca acaaacgagg    123120
     cttcgaaaaa atcgtcagcc aaatagatga tgcggttgaa aaaggcgcga aagtgattgc    123180
     tgggggcaca tatgaccgaa acgatgacaa agggtgctac tttgtgaatc cgacagtgct    123240
     caccgatgtc gatacgtcca tgaacatcat gcatgaggaa acattcggcc cggtcgcccc    123300
     gatcgtcacg ttttctgata ttgatgaagc gattcagctt gccaacgata caccgtatgg    123360
     cttggctgct tacttcttca cagaaaacta ccgccgcggc atctatattt ccgagaatct    123420
     agagtatggc attatcggct ggaatgacgg cggaccgtca gcggttcaag cgccattcgg    123480
     cggaatgaaa gaaagcggca tcggccgtga aggcggttca gaaggtatcg agccgtacct    123540
     tgaaacaaaa tatttgtcca tcggtttata aaagaatgca cgctcctgag agctgccgga    123600
     ttttccggca gctctttttg tgttccggcg aataatcaca acaattccag ccaaaataac    123660
     agcaaataca ttttgaaaga aggttcccca acaatggatt tattattggc tcttctcccg    123720
     gctttgtttt gggggagcat tgttctcttc aatgtgaaat taggcggcgg gccgtacagc    123780
     cagacactgg gaacgacgat cggggcactc attgtttcta tcgttattta cttttttgtt    123840
     cagcccgttc tgtcccttcg catttttatt gttggaatcg tatccggctt attttggtca    123900
     cttggacagg ccaaccagtt gaaaagcatt caattgatgg gcgtgtcgaa aacaatgccg    123960
     atttccacag gaatgcagct cgtttccacc tcgctgttcg gtgtgatcgt gttccgcgaa    124020
     tggtcaacac cgattgcgat tacgcttggc gttctcgctt tgatctttat cattgtggga    124080
     atcattctca cgtccttgga agataagaat gataaaaaag agggcgagcc aagcaatttg    124140
     aaaaagggca ttttgattct ccttgtttcg actcttggtt atttggttta tgtagtcgtg    124200
     gctagattat tcaatgtgtc cggctggtcc gcgctgctgc cacaggcaat tggcatggtg    124260
     gtcggggggt tagttttaac ctatagacac aaacccttta acaagtatgc gatcagaaat    124320
     attctcccag ggttaatctg ggcaggcgga aatatgtttt tgtttatttc tcagccgcga    124380
     gtcggcgttg caacgagctt ttccctttca caaatgggaa ttgtcatttc tacgctcggc    124440
     ggtattttca tcctgcgtga aaagaaaacg aaacgccagc taatagcaat tgcgatcggg    124500
     attatcctga ttattgccgc cgccgtattc ttaggaatcg ccaaaacaaa ttcataacaa    124560
     atggaggagg atgtatatgt atccggattt aaaaggaaaa gtcgtcgcta ttacaggagc    124620
     tgcttcaggg ctcggaaagg cgatggccat tcgcttcggc aaggagcagg caaaagtggt    124680
     tatcaactat tatagtaata aacaagatcc gaacgaggta aaagaagagg tcatcaaggc    124740
     gggcggtgaa gctgttgtcg tccaaggaga tgtcacgaaa gaggaagatg taaaaaatat    124800
     cgtgcaaacg gcaattaagg agttcggcac actcgatatt atgattaata atgccggtct    124860
     tgaaaatcct gtgccatctc acgaaatgcc gctcaaggat tgggataaag tcatcggcac    124920
     gaacttaacg ggtgcctttt taggaagccg tgaagcgatt aaatatttcg tagaaaacga    124980
     tatcaaggga aatgtcatta acatgtccag tgtgcacgaa gtgattcctt ggccgttatt    125040
     tgtccactat gcggcaagta aaggcgggat aaagctgatg acagaaacat tagcgttgga    125100
     atacgcgccg aagggcattc gcgtcaataa tattgggcca ggtgcgatca acacgccaat    125160
     caatgctgaa aaattcgctg accctaaaca gaaagctgat gtagaaagca tgattccaat    125220
     gggatatatc ggcgaaccgg aggagatcgc cgcagtagca gcctggcttg cttcgaagga    125280
     agccagctac gtcacaggca tcacgttatt cgcggacggc ggtatgacac aatatccttc    125340
     attccaggca ggccgcggtt aaacataaaa agcgacccag acatgacatc tggatcgctt    125400
     tctttattag gcacgctttt tctttacaag tgctgctaca gataaaataa tggcagccgc    125460
     agacagcacc atcgctgtaa tgtctagagc tgaagaacct gagttttcgg aatcgtcttc    125520
     tgttttcgtg gcgccgtgct catctgtcac ttgctttgca gacgtgatgt ttgtaatgga    125580
     atgaggtgta tcggcatcct cgtcacctgt ccactcaaca atgctgccgt ctttgtaata    125640
     ttggtatgcg tcccaagcag cttcctccgc tttgtcaggg tttttggcaa caaaggtaaa    125700
     ctgctggaac tggccttcct gaatgcctcc gtcagtcgcc tcccatgtca cggatactga    125760
     tttgtcatca tgtttttgag tggaaacctt ccagcccgga attggctcat attgctggaa    125820
     ttcaacatcc ttcggcattt tgaggacaac cttcgttgtc ggcagatttt tctcagaagg    125880
     aaccttcatt gtatacgttt cccaagagcc tgcagcagac tcagccggtt ttacagaaac    125940
     atgcgcgctg gcaggggccg taaagaataa gagggagccg acaatagccg gacatagtgt    126000
     caatgcgatt tttttcaaca acgtaaacac tccttaattg gtctttgtaa acatgatatt    126060
     gatttcgtta aagtcgccgg tcaggccgtg gactttgatc ttccagtttc ctttttcatt    126120
     aatcgacagg ttttgatctt ggaagacgcc ttttgttttt tcttttaatg taaaggtgct    126180
     tttgttttcg ctgcctgaca ggcccgtttt ataaacggtt aacgtgattt gctggatgtt    126240
     tttcacggga tcaccgttat ggtcggtgac ccgcagctca aaaacatttt ttccaggctg    126300
     gtttgggctg atgctgagag aaacgctttg tccgttctct atcgctttgg tttggtagaa    126360
     cggttccggc gctggctcag gcgggcttgg caggcttgta aacacggccg ctgtgatcaa    126420
     tacagcgatg ccgattgccc actccgcttt caacgttcgg ctgattcctg tgcggcgctg    126480
     ctttctggta agcagaaaat gaattgcgcc taagaccagc atgaaaacaa acagcccgct    126540
     tttcactaaa agagcttgtc cgtacgctgt atggaacagt gaatccattg aacgaatgat    126600
     gaaaaatcca ttgagcaagc ctgaaaacaa aatgacgccg actgcagtga gcgcccatgg    126660
     ggagaaccgt ctgaccgtct cccacgcgag cgttttgtca ggctgcctcc attcttttga    126720
     gagcagcaaa acgagtgccg ctattccgcc gacccagatg gaagcggaag ttaaatgaag    126780
     gaaatccatc aaaatgccga ccgttttttc ttcaacgaca gcagcatgcc cggtaaacgc    126840
     cttggcaagc aggagaccga aaaagaaaat gagcggcgct gtccaatagc caaaggatga    126900
     aaagcggttt ttccgtatcg cagggatgac agacagtgcg agcagcacga acagcgcagc    126960
     ctgtatgatc caaatggagc cgcctgctgt ctcaaacagt gtttctctga tgtagcccgg    127020
     ctggaatgcg ctgccccagc cgccgcctgc gttcgctttt gtctgaatcg gaagctgaag    127080
     caaaagcgcc agccccaatg ctgcgatcga gccggtcagg atacgtctcg tccgtttgac    127140
     gagctgttct gatttccctt tataccagaa aagatggaag aaaaccgttc cgataaacag    127200
     agataaggct gtatacagaa tcgcgcgatc tgctgctgtt cccggattca gcgctgaatc    127260
     ggctgctttt tggctgctga atccgccatc cgctttcccg atactgaacg gaatgacgcc    127320
     ggaaacagga tgtccatccg cggatacggc attccattcc gctctgtaca catctttagg    127380
     cagattcttc ttcagcttca ctgtcatgat gtgatgatta tcttttttga tttcagtctt    127440
     gtccgtatcc aaacggtcgc cgtttgaatt atagacttta atgtaatgaa acccttcttc    127500
     aaccggttca ttaaattcga tttccacctg cgcaggggcg ctttttaatt cgctgttttc    127560
     cccaggtgaa gatttgacaa tataggcgtg agcaaagctt gttttcggca ggaaaacaag    127620
     aaaaagcaga aggatgatcc accatctgtt tcgcttcatc actcagacac caccttccgc    127680
     tgtatgtgtt gtgttatttc ttggtgcagg tgcagcgttt ctttcggtct tgaagcatgt    127740
     cttccagcgc ttggtcgaaa gtgcagacgg ctccgccgaa tcctttttga aatcgttcgg    127800
     catggtcaag tgtcgcaaac ggaatggcct gcggctggca gcagtgcagg tttaattcag    127860
     catttacgac gaaataagcc gaaccggcac tgacggttgt ctgtaacaga aaatctctgc    127920
     aaatcaagtg tgaaacctct tccgttttat ccgcgtaacg caaaaacgcg caatgtgcgc    127980
     agcatagctg ttcaatgtct tggtttaccg taatcagctg aaccgaatga gcttgattga    128040
     cgggcttcaa gcaatagctg cacatatgat ctgtttgagg tgttcggacg gggagcgtga    128100
     tgccgccggc cgttttaatg acctgatttg actgaaccag ctgattgaca tctctatata    128160
     ccgtcatttc cgaaacgccg aaccttgcgc tgatgtcaga aattctaagc gagccttctt    128220
     ctttcagcca cttcagtatg tgttgctgtc tattaatcgg aagcattcat acaccctctt    128280
     cattaagatc tatttaagcg tagaggattt tagagacgga gacaagtaag tggatgataa    128340
     aaaatgtgaa aatgtgttga acagcaacaa aacgaaacag aagggactct ggtataatag    128400
     acagatggaa tagaaagtga ggaataccct atgaaagaaa caccatgccc gaactgcggc    128460
     aaacctttga caggcgatat ggtcagatca tcaaatgtgc cttgtcaatt tcgctgcggc    128520
     cactgccggg aacggcttta tgaatataaa gtttcagctc cgattatgct ggtatcatta    128580
     gcggccatcg tgctgcttat ttatcttttg atgctcctcc gcaatgcggc aggctcagtg    128640
     ctgccagctg tacagcacgt gccgatggct gtatttgcgc ttgtgtgcgc gtatcccgtt    128700
     tttattgtga gtgagcggat gattgcaaag tacgtgattc aaaatggcaa catcatttat    128760
     agaggaaaga gaaaaggctc ctgaaaccag gagccttttt atttttaaaa aattgtcaca    128820
     gtcatgtgcc aaagtcctct ttactttcaa ttgtataggg actgtaagcg ttttaacata    128880
     gagtcaaagg gaagcatcat tctctgaaca tatttttgta tcttacagcg acaaacaaaa    128940
     cagggagggt ttatatatgc agcagcaaga acagcagcaa ggcggcatga aagtgaaagt    129000
     gcaacgcttt gggagttatt tgagcggaat gatcatgccg aatatcggcg cgtttatcgc    129060
     gtggggtatc attaccgcgc tgtttattcc ggcaggatgg tttccgaatg aacagctgaa    129120
     cacgctggtc agcccgatga ttacgtattt attgccgctt ttgatagcgt atacaggcgg    129180
     aaaaatgatc tacgaccacc gcggcggagt tgtcggagcg acagcggcaa ttggggtgat    129240
     tgtaggatcg gatattccaa tgtttttagg cgcaatgatt atgggtccgc ttggcggata    129300
     cctcattaaa cagactgata aattattcaa ggataaagtc aagcaaggct ttggaatgct    129360
     gatcaacaac tttacggcag ggattgtcgg cgcggcttta acgattctcg cgttttacgc    129420
     catcggcccg gttgtcttga cgctaaataa attgctggcg gctggtgtgg aagtcattgt    129480
     acacgctaat ttactgccgg tagccagtgt ttttttagaa ccggcgaaag tgttgttcct    129540
     taacaacgcc ataaaccatg gaatcttaag cccgatcgga atcgagcaag catctcaaac    129600
     aggaaaatca attctgtttt tagtagaagc aaaccctgga ccggggctcg gcattttcct    129660
     ggcctacatg ttctttggca aaggatcttc aaaatcaacg gctcccggtg cggcgatcat    129720
     ccatttcttc ggagggattc acgagattta cttcccgtac attctgatga aacctggccc    129780
     tgattctcgc agccattgcc ggcggagcaa gcggactctt aacattacga tctttaatgc    129840
     cggacttgtc gcggcagcgt caccgggaag cattatcgca ttgatggcaa tgacgccaag    129900
     aggaggctat ttcggcgtat tggcgggtgt attggtcgct gcagctgtat cgttcatcgt    129960
     ttcagcagtg atcctgaaat cctctaaagc tagtgaagaa gacctggctg ccgcaacaga    130020
     aaaaatgcag tccatgaagg ggaagaaaag ccaagcagca gctgctttag aggcggaaca    130080
     agccaaagca gagaagcgtc tgagctgtct cctgaaagcg cgaacaaaat tatcttttcg    130140
     tgtgatccgg gatgggatca agtgccatgg gggcatccat cttaagaaac aaagtgaaaa    130200
     agcggagctt gacatcagtg tgaccaacac ggccattaac aatctgccaa gcgatgcgga    130260
     tattgtcatc acccacaaag atttaacaga ccgcgcgaaa gcaaagctgc cgaacgcgac    130320
     gcacatatca gtggataact tcttaaacag cccgaaatac gacgagctga ttgaaaagct    130380
     gaaaagtaat cttatagaaa gagagtattg tcatgcaagt actcgcaaag gaaacattaa    130440
     actcaatcaa acggtatcat caaaagaaga ggctatcaaa ttggcaggcc agacgctgat    130500
     tgacaacggc tacgtgacag aggattacat tagcaaaatg tttgaccgtg aagaaacgtc    130560
     ttctacgttt atggggaatt tcattgccat tccacacggc acagaagaag cgaaaagcga    130620
     ggtgcttcac tcaggaattt caatcataca gattccagag ggcgttgagt acggagaagg    130680
     caacacggca aaagtggtat tcggcattgc gggtaaaaat aatgagcatt tagacatttt    130740
     gtctaacatc gccattatct gttcagaaga agaaacattg aacgcctgat ctccgctaaa    130800
     gcgaagaaga tttgatcgcc atttcaacga ggtgaactga catgatcgcc ttacatttcg    130860
     gtgcgggaaa tatcgggaga ggatttatcg gcgcgctgct tcaccactcc ggctatgatg    130920
     tggtgtttgc ggatgtgaac gaaacgatgg tcagcctcct caatgaaaaa aaagaataca    130980
     cagtggaact ggcggaagag ggacgttcat cggagatcat tggcccggtg agcgctatta    131040
     acagcggcag tcagaccgag gagctgtacc ggctgatgaa tgaggcggcg ctcatcacaa    131100
     cagctgtcgg cccgaatgtc ctgaagctga ttgccccgtc tatcgcagaa ggtttaagac    131160
     gaagaaatac tgcaaacaca ctgaatatca ttgcctgcga aaatatgatt ggcggaagca    131220
     gcttcttaaa gaaagaaata tacagccatt taacggaagc agagcagaaa tccgtcagtg    131280
     aaacgttagg ttttccgaat tctgccgttg accggatcgt cccgattcag catcatgaag    131340
     acccgctgaa agtatcggtt gaaccatttt tcgaatgggt cattgatgaa tcaggcttta    131400
     aagggaaaac accagtcata aacggcgcac tgtttgttga tgatttaacg ccgtacatcg    131460
     aacggaagct gtttacggtc aataccggac acgcggtcac agcgtatgtc ggctatcagc    131520
     gcggactcaa aacggtcaaa gaagcaattg atcatccgga aatccgccgt gttgttcatt    131580
     cggcgctgct tgaaactggt gactatctcg tcaaatcgta tggctttaag caaactgaac    131640
     acgaacaata tattaaaaat cagcggtcgc ttttaaaatc ctttcatttc ggacgatgtg    131700
     acccgcgtag cgaggtcacc tctcagaaaa ctgggagaaa atgtagactt gtaggcccgg    131760
     caaagaaaat aaaagaaccg aatgcactgg ctgaaggaat tgccgcagca ctgcgcttcg    131820
     atttcaccgg tgaccctgaa gcggttgaac tgcaagcgct gatcgaagaa aaggatacag    131880
     cggcgtactt caagaggtgt gcggcattca gtcccatgaa ccgttgcacg ccatcatttt    131940
     aaagaaactt aatcaataac cgaccacccg tgacacaatg tcacgggctt tttactatct    132000
     cgcaatctag tataatagaa agcgcttacg ataacagggg aaggagaatg acgatgaaac    132060
     aatttgagat tgcggcaata ccgggagacg gagtaggaaa gaggttgtag cggctgctga    132120
     gaaagtgctt catacagcgg ctgaggtaca cggaggtttg tcattctcat tcacagcttt    132180
     tccatggagc tgtgattatt acttggagca cggcaaaaat gatgcccgaa gatggaatac    132240
     atacgcttac tcaatttgaa gcagtttttg ggagctgtcg gaaatccgaa gctggttccc    132300
     gatcatatat cgttatgggg ctgctgctga aatccggagg gagcttgagc tttccattaa    132360
     tatgagaccc gccaaacaaa tggcaggcat tacgtcgccg cttctgcatc caaatgattt    132420
     ttgacttcgt ggtgattcgc gagaacagtg aaggtgaata cagtgaagtt gtcgggcgca    132480
     ttcacagagg cgatgatgaa atcgccatcc agaatgccgt gtttacgaga aaagcgacag    132540
     aacgtgtcat gcgctttgcc ttcgaattgg cgaaaaaacg gcgcacactc gtgacaagcg    132600
     ccacaaagtc taacggcatt tatcacgcga tgccgttttg ggatgaagtc tttcagcaga    132660
     cagccgctga ttatagcgga atcgagacat catctcagca tattgatgcg ctggccgctt    132720
     tttttgtgac gcgtccggaa acgtttgatg tcattgtggc gagcaaattg ttcggtgata    132780
     ttttaaccga catcagctca agcctgatgg aaagcatcgg cattgcgcct cccgacatca    132840
     atccatccgg caaatatccg tccatgtttg aaccggttca cggctcagct cctgacattg    132900
     ccggacaggc cttgccaatc cgatcggcca gatttggaca gcgaagctga tgctcgacca    132960
     cttcggagag gaagaattgg gggcgaaaat tctggatgta atggagcaag tgactgccga    133020
     cggcatcaaa acacgcgaca ttgggggaca aagcacaacg gctgaggtca ctgatgaaat    133080
     ctgttcgcgc ttaagaaagc tctgatgaat caggccggtg gcagatggct gccccggtct    133140
     gtccatttcc ttacgaaaat ttccacgaaa gtctaaccaa gcagatccaa atgctgtata    133200
     ataatttgga attcttagga aagcatcggg tgaaggaagt tgaatgcaaa aacaatcacg    133260
     ttaaagaaaa aaagaaaaat caaaacgatc gttgtactca gtatcattat gatcgcagct    133320
     ctcattttta cgatcagatt ggtgttttac aagccttttc ttattgaagg atcatcaatg    133380
     gccccaacgc ttaaagactc agaaagaatt ctggttgata aagcagtcaa atggactggc    133440
     gggtttcaca gaggagacat catagtcatt catgacaaaa agagcggccg ctcatttgtc    133500
     aaacgtttaa tcggtttgcc tggtgacagc attaaaatga aaaatgatca gctatacata    133560
     aatgataaaa aggtggaaga accatactta aaggaatata aacaggaggt caaagagtcg    133620
     ggtgtaacct taacaggtga cttcgaagtt gaggttcctt ccggtaaata ttttgtgatg    133680
     ggagataacc gtctcaattc actggatagc agaaacggaa tgggcatgcc ttctgaggac    133740
     gatatcatcg gtactgaatc tctcgtcttt tatccattcg gtgagatgag acaggcaaaa    133800
     taaaatgcaa tgcaaaaaga acatggaaca tgacggcacc gataataaag cgccgtgcac    133860
     gtttaaaaaa atgatgatga aacggtgcgg agcggctttc cgccccgttt tttatgatag    133920
     aaagcgtttt gaagaaaagg gccctgttga aataaacaga atcaggattg gcgaagcgtg    133980
     aagcgcatcg aattggtaaa tctcaagatg ggtatgctgt ttttcccgca gttttttgat    134040
     aagaagcgct acgtcaaacg acggctcata attagggaaa aacaatagga ccgggcaggc    134100
     tggcatgtga tgaagagagt cgcgtatccg ggaaccgtaa taacaaaccg atccgctcac    134160
     ctcaggcata ctgctgcatt tccatgcgat agtagccccc acgctgaatc caatcacaaa    134220
     gatgtgccgt ccggcgtttt gcctgatcac aggctggatg atggtttctc ccgttttcag    134280
     cctttcgtgt tttgtaaatt gttcgtatgc cgttttttct tctttcagtg tgtagacttc    134340
     atcctcgccg agcaggttgg gcgtcaacac atcatatcca gccattttga tcagccggcc    134400
     catctttttc atatggctgt ttacaccata tatttcgtgt gcgagaatga caagcggttt    134460
     tgggaacata acggcctcct tttgtgtttt ttccattata tcctatcgtt tcactttagg    134520
     ctgagatata atggtcaaaa aaaggagata taaaatgaac tcattatctt tgcctcaccg    134580
     ctatccattt ttgtttattg atggcgtgac ggatagcgag cccggcaaac atgcggcagc    134640
     ttataagctg attagtgaga acgactggtt tatcactgat acgcaaacag aaatgccgtt    134700
     ttcacttgtg attgaaggct tgcgcaaacc gcggctttta caggaattac agatgagaac    134760
     agcttgggat tattgtcttc gaaagcggaa aagctgggag aagctgtgcc tggtgaccgg    134820
     cttgatctta cgtttgaagt cacgcgcaat cggcgcgggt ttgtgttcgg acatgccaag    134880
     gcatcagttg gagagcagcc tgttgctgaa gctgaaatcg gcatctatat tgaaaaatga    134940
     aaaaaaccct tcacaacatt ttgtgagggg ttctattttg tgtcgtaatc ccgttcgctt    135000
     tgagagttat ctctttgctg gcgtttgtgt ttttcatcat tcatattttc cttcagctct    135060
     tcattaggaa tcggatcggt taagtcgttg tgctcggggt tttcatttgg tttgttttgc    135120
     tgtttttttt ctgtcatgtt tgatcacctc accgtttgtt ttcctcttat tcattctcct    135180
     caaacatagg aaatcgcttt tttgtcccgc tgggtataat gtattagaat agagagaagc    135240
     acaacaaaaa gataaagaga ggtacatata tgtctgtcca aagagaagat gtagatatca    135300
     agctgatcgc aattgatatg gatggtacac tgctgaacga cgagcagctg atctcggatg    135360
     aaaaccgcaa agccattcgt gaagcggagg ataaaggtgt gtatgtggtg atcagcacgg    135420
     gccggacgct gatgacgtgc agggagctgg cggaatcgct aaagctgtca tcctttctaa    135480
     tcacggcaaa cggcagtgaa atttgggatt cgaattttaa tttggtggaa cggaagctgc    135540
     ttcatacgga ccatattcaa atgatgtggg atttgcggaa taagcacaac actaatttct    135600
     gggcttctac ggtgaataaa gtatggagag gcgagtttcc ggaaaacatt acggatcatg    135660
     aatggctcaa attcggcttt gacatcgagg atgacgatat ccgaaacgaa gtgcttgagg    135720
     agctgaggaa aacaaagagc tctgaaatca caaattcaag tccgacaaac attgaagtca    135780
     acgcgcttgg catcaacaaa gctgcagccc cttgccaagg ttacggaaaa ctcggcttta    135840
     caatggagaa tgtgatggcg atgggcgaca gccttaatga cattgcgatg atcaaagaag    135900
     cgggtcttgg cgtcgcaatg ggcaatgcgc aagacatcgt aaaagaaacg gctgattata    135960
     tcacggatac aaatattgag gatggtgtcg ctaaagcgat tcgccattgg gtactataaa    136020
     aaaagagagt cctaagatgg actctctttt tagtttggca ggttttattc tgggaccatg    136080
     gtaggttttc tgacaaaagt atttcacaaa ctgatatgat tcacttataa tgaaataaag    136140
     ttcaaaaatt cggaatagtc gttccgaatt tcgggacaat aaatgacata aagcatatcg    136200
     tttgctttgg caggagggat tctttgtttc aaattgattt aaactgtgat ttaggagaaa    136260
     gcttcggagc ctacaagata ggccttgacc aagatatttt agagtatgtg acatcagcga    136320
     atatcgcatg cggatttcat gcaggagatc ctagtgttat gcgaaaaacc gtcgcgcttg    136380
     cagcagaaag aggcgtgaaa atgggtgcgc atccgggctt gccggattta ctcggttttg    136440
     ggcgccgcaa tatggcgatt tctcctgagg aagcgtatga tcttgtcgtt tatcaaattg    136500
     gcgcgctctc tggctttcta aaagcagagg gacttcacat gcagcacgtc aagccgcatg    136560
     gcgctttata caatatggcg gcagtcgatc aaaaactgtc ggatgctatc gcgaaagctg    136620
     tctataaggt tgatcccggc ctgattcttt tcggtcttgc tgagagcgag cttgtaaaag    136680
     cgggagaacg gatcggactt cagaccgcaa atgaagtgtt cgccgacaga acataccaat    136740
     cggacggcac gctgacaccg gctcccagcc ggacgcactc attgaaagtg atgatgccgc    136800
     gtcacccagg tcatcaaaat ggtgaaagaa ggggcggtca aatttcagca aggccatgat    136860
     tgtgtcattt aaaagcggtt cagttttcat ttatggagat ggagcccatg cgctgacatt    136920
     tgcgcaaaaa atcagaaaac agctcaaagc ggctggaatt gaagtgacag ctatttcaga    136980
     acagaggtca acataaagga ggaacaatag atggagcagc agaaaaagac agcaggaaaa    137040
     aagcgggcag ctggtcattg ctgatgggcg ccgccttttt aatggcgaca tcagcaatcg    137100
     gaccgggttt cctcacccaa accgcaacat tcacaaacac actcgcagca agcttcggtt    137160
     ttgtcatctt aatctctatt attttagata ttttcgccca aaccaatgtg tggcgcatca    137220
     tcgcagtttc tggaaaacga ggtcaggaaa ttgcgaatat ggtgcttccc ggactggggt    137280
     attccatcgc cattctcgtc gtgcttggcg gactagcttt taatattggg aatatcggag    137340
     gggcgggcct gggacttcag gtgctgttcg gcattacacc tgaaacaggc gctttaatca    137400
     gtgccgttat cgccattttg atttttgtca tcaaggaagc aggaatagcg atggaccgtt    137460
     ttacgcaaat cgcggggttc gtaatgatta ttttaacggt ctacgttgcg gcgacgacag    137520
     ctcctccggt cggacaggca gtcgcaaata cattcgtccc ggaacacatc agcatatttg    137580
     ccattgtcac cctagtgggc ggaaccgtcg gcggttatat cacatttgcc ggaggacacc    137640
     gtttgcttga tgccggaatt aaaggaaagg aatccattcc gcaggtgaca aagagctcgg    137700
     ttgtcggcat tttaattaca tctgtcatgc gtatcgctct tttttttgcg gttctaggcg    137760
     ttgtatcgaa aggcctgcac atcgatgaaa gcaacccggc ggcttctgtc ttcaagctgg    137820
     ctgctggaaa tgtcggttat aaaattttcg gattgatcat gtggtctgcg gcgattacgt    137880
     ctgttattgg agcagcctat acatctgttt cattttttaa aaccttttct ccaaaaattg    137940
     aaaagaattc acgcggtatt attatcggat ttattgtggt ttctacgtta gcttttgtca    138000
     caatcggcca gcctgcgaag atcctcgtcc ttgtgggttc actgaacggc ttaattctgc    138060
     cgattgcgct cggaacgctg cttgttgccg cctacaagaa aaacattgtc ggtgattata    138120
     agcatccgct ttggctgaca agcacaggcg cgcttgtagt gattgtaatg gcagttatgg    138180
     gaatctacac gttatgtaca caacttcctc aattgtggag ctgatataag tggagcaatt    138240
     aaacaaaatg gcgccaaagg atgtacgcgc cctgatacga gaggggaaaa taaacgggcc    138300
     gaccgcaggc atgtccggcg gctacgccca agcgaatctt gtggttttga aaaaggacct    138360
     tgcgtttgat tttctgctgt tttgccagcg aaatcaaaag ccctgccccg tgctggatgt    138420
     gactgaagca ggttcgcctg tgccgtctct gctgcgccgg atgctgatat ccagaacgga    138480
     ctttccgaaa taccgtattt acaggcacgg tatcctaacg gaagaagtat ctgatattac    138540
     gccatactgg gaggacgatt ttgtcggctt tctgatcgga tgcagtttct cctttgaaca    138600
     ggcactgatc aataatggga tagctgtccg gcatattgat gaggggacaa acgtctcaat    138660
     gtataaaacg aatatcgatt gttttccggt gggggcgttt cacggacaga tggttgtcag    138720
     catgaggccg gttcctgaac ggctggctgt acgtgctgca caagtgacct cgcgttttcc    138780
     ggctgtgcac ggagggccga tccatattgg caatccggga gcaatcggga ttcgcgatct    138840
     cgggaaaccg gatttcggag atgccgtttc cattcgtgac ggcgaggttc ctgttttttg    138900
     ggcatgcgga gtgaccccgc aagccgtggc tatgaatgta aagcctgaaa tggtcatcac    138960
     acatgcgccg gggcatatgc tcatcacaga tattcgagac gagtcgcttg cggtgctgta    139020
     gcctctcgtc atcctgatga acgagaatta aagaggtgag aaagatgact gtacgatatc    139080
     aaatcgaaca gctcggtgat tctgcaatga tgatccgatt cggagaagaa atcaatgaac    139140
     aggtcaacgg cattgtccat gcagcggccg cttatataga agaacagcca tttccgggat    139200
     tcattgaatg tatcccggct tttacaagtc taaccgtatt ttatgatatg tatgaagtgt    139260
     acaagcattt gcctcaaggc ataagctcac cttttgagag tgtcaagcgc gatgtcgaag    139320
     agcggctggc agaaatagcc gaagactatg aggtcaaccg ccgtattgta gaaattcccg    139380
     tttgctatgg cggtgaattc ggtccggatt tagaagaggt ggcgaagatc aatcaactgt    139440
     caccggagga agtaatcgac attcatacaa acggtgaata tgtggtgtat atgcttggct    139500
     tcgcgcccgg ttttcctttt ctaggcggga tgtcaaaacg cattgcagct ccgagaaaat    139560
     catcgccaag accgtcgatt cccgcaggtt cggtcggtat tgcgggattg cagacaggcg    139620
     tttatccgat ttcaacgccg ggcggctggc agctgatcgg caaaacgccg ctggctcttt    139680
     tccggccgca ggaaaacccg ccgacattgc tgcgggcggg agatattgtg aaattcgttc    139740
     gcatctcaga aaagactatc acgcctataa ggaggagtcc aattgagcat gaaagtatta    139800
     aagcccggac tgctcacaac ggttcaggat ataggcagaa cgggttacca aaaatacggc    139860
     gttctggcca gcggcgctat ggacacggtt tcactgcgca ttgccaatct gttgatagga    139920
     aacggcgaaa tgaagcaggt ctcgaaataa cgatgatggg gcccggtccg tcgtttcatt    139980
     tttcaaaaca gacactgatt gctgtgacag gggcggactt cacgctgcgt attaatgacg    140040
     aggaagcgcc tttatggaag cctgtgctca tcaaggaaaa cagcacggtc agctttggcc    140100
     cctgcaaact cggcagccgt gcttatttgg cggcagctgg cggcattgag gtgcctgccg    140160
     tcatggaaag taaaagcaca tacgtcagag gaagcattgg cggacttcat ggcagagcgc    140220
     ttcaaaaaga agatgaactg aacattggag agatgtcagc tctttcgcaa accatccttt    140280
     ctcgcttaag ttcgcagctt gcacatacag tgattggcag caccgacgtg gtcagtcaac    140340
     cgtgggagat ttctgtcatt gaagacgaat cccgtcattc gagtgctgga gggatatcaa    140400
     tatgcctgtt gcacagcaga atcaaaaacg cgttttctga agaagcattt cgtgtcacgc    140460
     cgcagtccga ccgtatgggg tacaggctca aaggagaacc gctcgatctg acggccccgc    140520
     ttgagatggt gtcggcagcg gtttcattcg gagcagcaca gatgccgcct gccggcaaac    140580
     cgtattatcc ttgcttgcaa gaccggcaag acgactggcc ggctatccga ggaatcgcgc    140640
     acatcatatc cgctgatctt ccgattgttt cccaaatcat gccgggcgag cacgttcagt    140700
     ttgagcctgt gtccctccag gaggcagaag cgcttgcggt agaacgggaa cagcatataa    140760
     aagaactgaa aacgagaatg aagatggaat ggctgacata gcaaacggga tgaatgatgc    140820
     agaataaaaa taaaaccgta gtcaaatcta tggcgctgct taatttgttt ttgcataaac    140880
     caagcctaac cttaagtgaa ctggtgtcgc tgacgggaat gccgaagacc tctgttcacc    140940
     ggatggtcag ctccttggag gaaatggggt tcctcagtcg ggatgcgtcc ggcgcttatt    141000
     cgctgggatt ggtgtttttg gaattcggac agcttgtcgc tgacaggctg gatatcagaa    141060
     aaatagcgaa accggtgatg gaagagctgt gccgggaagt ggatgaggcc gtgcagttga    141120
     tcatgaggga cggcaatgaa gcgatatacg ttgagaaaat agaagggaca cagactgtgc    141180
     ggctgtatac ggcgatcggc aggcgttccc ccctatacgc gggagcgtgc gccagaagca    141240
     ttctgtcctt tcttccccgt gaagaaatcg aagcatacat caaacaaacc gagctcattt    141300
     cgattggctc cggaacgatt accgatcccg aaaaactgct tcaggagatt gatgcctctg    141360
     tgcaaaatgg ctatactgtc agctattcag agctcgaaaa ctatacggcg gcgatcggcg    141420
     ccccgatctt taaccatgag cgccaggtgg cagccggcat tagcattgca ggctttgaag    141480
     cgagatttac agaagacagg ctgccctatt taacagaaaa ggtgaaggac gccgctttac    141540
     agatttcaag aaaataggat atacataagt agccaatctt ttctctgctg cgtacattaa    141600
     cgtatcgacg ttcaagagtg gaggaaagaa catggtgctt cgatatacag ctctgggcga    141660
     ttccttgacg acagggagag gctccgggct gttttcaccc ggcttcgtcc agcgttttgg    141720
     ggacatgatg gaagctgact tgaaaacaag aacggcaata aacatatttg ccagatcagg    141780
     tctgaataca gaagagattt tgggactcct gtcatatccc tatgtgcaaa aatgtattcg    141840
     agatgctgat atgataacga tcacagggtg cggaaacgat ctcatcgatt cggtcttagc    141900
     ctaccaaacc tctaaggatg aaacgatttt cagccgtgta tccgcccatt gccatgagaa    141960
     ttttgaaaag atgattgcca aagtcgccga gattaaagga gaaaatcctt ccccgtacgc    142020
     cattcgtgtg ttcaacttat acaatccgtt tcccgaaatt gatatcgccg gcaaatggat    142080
     cacttcgttt aattcacatt tagaaacact tgcatcagca ccccatgtca aaatcgcgga    142140
     tgcctatagc atcttcaaag gcaaagaaca ggaatatctg tcctttgacg gtgtccatcc    142200
     gaacagcaaa ggctatcaag cgatggctga agccgttcac aagctaggct ataaagaatt    142260
     atcagtttca tagaaaacgc gcctcatgac aggcgcgttt ttatgtgtga tcgaaatatt    142320
     aaaagaaact taaaattctc tgtcttctgt tctacagaca aacaaagtgc gctagaataa    142380
     tggagggcgt aggcaaatat agccataacg ttcaatattt cgtatataag gaaggatggt    142440
     ccttttgttt cggattttaa aatgtctttt gcggttatca ttattatact ggcgcttatt    142500
     gcttttaact atacggaaca cacctctgta atccaatcgg tcatgctcgt ctttcttggt    142560
     gcggtcatgt ttatgcaggg gcttgaagag cgcaaaaaag aaaatgacgg ctcaggcgct    142620
     tttaatattt ataccgccgt tttgtatggt ctgtctccct tatcggtttt acacttcata    142680
     ttatataaat ctatattaca catcctgaaa atgctcgacc gtcgggaacg gggtatagaa    142740
     ccgatgaagc aaggctttcc actcttgata ctctgaagaa ccgcgaaagc cttccgtatg    142800
     gtcctcaagt gtttcccact ccacaagaag cagatattta tgcgtttcct ccatgcattt    142860
     tgataacgag tgagtgatat agcccttcat gccggaaata atcggcgcag cttgccggaa    142920
     tgcatcctca aactcttgtt caaggccttc tttaatgtga agcattgctg cctctctgac    142980
     catgctatcc cttctttctg tcttttcaaa tagtctacag caaacgatag gagatttctg    143040
     caaaatcggt gaacttttcc ttcattttca aaaaatcttg cacgcaccaa ttcaattaag    143100
     agaaaataac aagtggaagg cagggaaagt catgttaaaa aagtgtattc tactagtatt    143160
     tctatgcgtc ggattgattg ggttaatcgg atgctccaaa acagattcac cagaggatcg    143220
     catggaagca ttcgtgaaac agtggaacga tcagcaattc gatgacatgt atcaaagcct    143280
     gactaaagat gtcaaaaaag aaatctccaa aaaagatttc gtcaacaggt ataaagccat    143340
     ctatgagcag gccggcgtaa aaaatttgaa agtcactgcg ggagaagtag ataaggacga    143400
     tcaagacaac aagacgatga aacatatccc gtataaagtc agcatgaaca caaatgccgg    143460
     caaagtcagc ttcaagaata ctgctgtgct gaaattagaa aaaacagatg acgaggagtc    143520
     atggaatata gattgggacc catcgtttat tttcaagcag ctggctgacg acaaaaccgt    143580
     gcaaattatg agcattgaac cgaaacgagg ccaaatttac gataaaaatg gaaaaggctt    143640
     agccgtcaat acagatgttc cggaaattgg aattgttccc ggagagcttg gcgataaaaa    143700
     agagaaagtc ataaaagaac tcgccaaaaa acttgatttg actgaagacg acatcaagaa    143760
     aaagctggat caaggctggg taaaagacga ttcgtttgtg ccgctcaaaa aggtcaagcc    143820
     tgaccaggag aaattagttt ctgaagcgac gtcattacaa ggcgtaacaa gaacgaatgt    143880
     cagctcccgc tactatccgt atggcgaaaa gacagcccat ttgacaggct atgtccgcgc    143940
     cattacagcg gaagaactga agaaaaagaa agaaggaacg tacagcgata cgtctaacat    144000
     cggtatcgcc ggacttgaaa atgtgtatga agacaagcta agaggcacaa ctggctggaa    144060
     aatctacgtg ccgcaaaccg gggaagtcat cgctgaaaag aaagcaaagg acggcgagga    144120
     tcttcacctc acaattgata tcaaaacgca aatgaagctg tatgatgaac tgaaggatga    144180
     cagcggggcg gcagtcgcgc tgcagccgaa gacaggcgaa acactcgccc ttgtcagcgc    144240
     gccttcctac gatccaaacg gatttatttt cggctggagc gataaggaat ggaaaaagct    144300
     aaacaaagat aaaaacaatc cgttttcagc gaaattcaat aagacatacg cgccaggttc    144360
     taccattaaa ccgattgcgg ctgctattgg aatcaaaaac ggcaccctta aagccgatga    144420
     gaagaaaaca atcaaaggca aggagtggca aaaagattca agctggggcg gctattcagt    144480
     gacacgtgtg tctgagagac ttcaacaagt cgatttggaa aacgccctta ttacgtcaga    144540
     caatatttat tttgcccaga atgcgcttga tatgggagcg gacaccttta caaaaggctt    144600
     gaagacattc ggtttttcag aggacgttcc gtacgaattc ccgatccaga aatcgtctat    144660
     tgcaaatgac aagcttgatt cagacatttt gcttgcggat acaggctacg gacaagggca    144720
     aatgcaaatg tctccgcttc acttggcaac tgcttacacg ccatttgttg acaatggaga    144780
     ccttgtcaaa ccgacgctga tcaaaaaaga ttcacaaaca gctgatgttt ggcacaagca    144840
     agtggtcacg aaggaaggag cggcagacat tacaaaaggt ctgaaaggcg ttgtggaaga    144900
     tgagcgcgga tcagcgtatc agcctgtcgt gaaaggaatc acagtggctg gaaaaacagg    144960
     aacagccgag ctgaaaacat caaaagatga taaagacggc acggaaaatg gctggtttgt    145020
     cggctacgat tacgaaaaca aagacctgct tgtcgccatg atgatccaaa atgtgcagga    145080
     ccgcggcggc agccactatg tcgttgagaa agcgaaaaag caatttcaat cgaattaaaa    145140
     tgtcttttta aaaggagcga aaggaaaaag gggatctgag gccgaatgaa ctagtaaggg    145200
     ggcaaaaccc ggtttataca aagaaaagag ggattttgca tgcagcgtat tcaattggcg    145260
     gaggatcttc aattttcaag agtcatacac gggctttggc ggctgaatga atggaactat    145320
     tcagatgctg aacttctaag cctcattgaa tggtgtatcg atcacggcat cacgaccttt    145380
     gatcatgcgg atatttatgg aggctatacg tgcgaaaagc tgtttggaaa cgcccttgcc    145440
     ctttcgcctg gattaagaga aaacatagag ttggtcacaa aatgcggtat cgttcttgaa    145500
     tcgcctgaac ggcccgctca cagatcgcat cattataaca caagcaaatc gcatattttg    145560
     gcatccgttg agcaatcgct tatgaacctt aggacggatt atatcgatat gcttttgatt    145620
     cacagaccgg acccgctcat ggatccggag ggggtagcag aggcgtttca ggccttgaaa    145680
     tgctctggca aggtcaggta ctttggcgtt tcaaatttta aagatcacca gtatcggatg    145740
     ctggaatcat atttgcctga gaagctcgta accaaccaga ttgagctttc cgcatacgaa    145800
     ttagaaaata tgctcgacgg cactttgaac ctgtgccagg aaaaacggat tccgccgatg    145860
     gcttggtcgc ctctggcagg cggcaaagta ttcactgaaa acacggataa agaccgacgt    145920
     gtccgtacgg cgcttgaatc cgtccaaggg gaaatcggcg ccgcttcatt ggacgaggtg    145980
     atgtacgcat ggctgtatac gcatccggcc ggcatcatgc cgattgtcgg aagcggaaag    146040
     cgcgagcgga tttccgccgc gataaatgcg ttgtcataca agcttgacca ggatcaatgg    146100
     ttccgcattt ttacagccgt acagggttac gatattccat aaaaagcatc agtttaccag    146160
     ctgatgcttt ttcaatattg tcacaccgct t                                   146191
//

If you have problems or comments...

PBIL Back to PBIL home page