(data stored in ACNUC8465 zone)

EMBL: D50469

ID   D50469; SV 1; linear; mRNA; STD; FUN; 969 BP.
XX
AC   D50469;
XX
DT   28-MAR-1996 (Rel. 47, Created)
DT   29-SEP-2006 (Rel. 89, Last updated, Version 7)
XX
DE   Saccharomyces cerevisiae Hor2 mRNA, complete cds.
XX
KW   .
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-969
RA   Hirayama T.;
RT   ;
RL   Submitted (01-MAY-1995) to the INSDC.
RL   Takashi Hirayama, The Institute of Physical and Chemical Research (RIKEN);
RL   Koyadai 3-1-1, Tsukuba, Ibaraki 305, Japan
RL   (E-mail:hirayama@rtcs1.riken.go.jp, Tel:81-298-36-4359, Fax:81-298-36-9060)
XX
RN   [2]
RP   1-969
RX   DOI; 10.1007/BF00290358.
RX   PUBMED; 7500933.
RA   Hirayama T., Maeda T., Saito H., Shinozaki K.;
RT   "Cloning and characterization of seven cDNAs for hyperosmolarity-responsive
RT   (HOR) genes of Saccharomyces cerevisiae";
RL   Mol. Gen. Genet. 249(2):127-138(1995).
XX
DR   MD5; d59010aab358042be8f9a5e7e98f7155.
DR   Ensembl-Gn; YER062C; saccharomyces_cerevisiae.
DR   Ensembl-Tr; YER062C_mRNA; saccharomyces_cerevisiae.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..969
FT                   /organism="Saccharomyces cerevisiae"
FT                   /strain="RS16"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:4932"
FT   CDS_pept        47..799
FT                   /gene="Hor2"
FT                   /db_xref="GOA:P40106"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="SGD:S000000864"
FT                   /db_xref="SGD:S000001315"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40106"
FT                   /protein_id="BAA09058.1"
FT                   /translation="MGLTTKPLSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFD
FT                   AEHVIQVSHGWRTFDAIAKFAPDFANEEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALN
FT                   ALPKEKWAVATSGTRDMAQKWFEHLGIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYP
FT                   INEQDPSKSKVVVFEDAPAGIAAGKAAGCKIIGIATTFDLDFLKEKGCDIIVKNHESIR
FT                   VGGYNAETDEVEFIFDDYLYAKDDLLKW"
XX
SQ   Sequence 969 BP; 318 A; 195 C; 196 G; 260 T; 0 other;
     taccagatca gtggaaaaac ataaaacaat aaaaacaata ttcggaatgg gattgactac        60
     taaacctcta tctttgaaag ttaacgccgc tttgttcgac gtcgacggta ccattatcat       120
     ctctcaacca gccattgctg cattctggag ggatttcggt aaggacaaac cttatttcga       180
     tgctgaacac gttatccaag tctcgcatgg ttggagaacg tttgatgcca ttgctaagtt       240
     cgctccagac tttgccaatg aagagtatgt taacaaatta gaagctgaaa ttccggtcaa       300
     gtacggtgaa aaatccattg aagtcccagg tgcagttaag ctgtgcaacg ctttgaacgc       360
     tctaccaaaa gagaaatggg ctgtggcaac ttccggtacc cgtgatatgg cacaaaaatg       420
     gttcgagcat ctgggaatca ggagaccaaa gtacttcatt accgctaatg atgtcaaaca       480
     gggtaagcct catccagaac catatctgaa gggcaggaat ggcttaggat atccgatcaa       540
     tgagcaagac ccttccaaat ctaaggtagt agtatttgaa gacgctccag caggtattgc       600
     cgccggaaaa gccgccggtt gtaagatcat tggtattgcc actactttcg acttggactt       660
     cctaaaggaa aaaggctgtg acatcattgt caaaaaccac gaatccatca gagttggcgg       720
     ctacaatgcc gaaacagacg aagttgaatt catttttgac gactacttat atgctaagga       780
     cgatctgttg aaatggtaat cctctaaaat cgaacatatt tgagtaataa ttctcagata       840
     cagtcctatt ctatattcgc cacaaaacaa gtaatgatgc taaaaaacga cacatttata       900
     aaatcacatc ttattgatta aataaatacg tagatagatt ttttttttaa aacatatagt       960
     gtgctatta                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page