(data stored in SCRATCH zone)

EMBL: D58414

ID   D58414; SV 1; linear; genomic DNA; STD; PRO; 5302 BP.
XX
AC   D58414;
XX
DT   26-JUL-1995 (Rel. 44, Created)
DT   09-SEP-2004 (Rel. 81, Last updated, Version 5)
XX
DE   Bacillus subtilis DNA for homologues of the E. coli pst gene products.
XX
KW   phosphate transport protein; phosphate-binding protein; pst.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-5302
RA   Kobayashi Y.;
RT   ;
RL   Submitted (27-JUN-1995) to the INSDC.
RL   Yasuo Kobayashi, Tokyo University of Agriculture and Technology, Applied
RL   Biological Science; 3-5-8 Saiwai-cho, Fuchu, Tokyo 183, Japan
RL   (E-mail:ykobayas@cc.tuat.ac.jp, Tel:0423-67-5706, Fax:0423-67-5715)
XX
RN   [2]
RP   1-5302
RA   Takemaru K., Mizuno M., Sato T., Takeuchi M., Kobayashi Y.;
RT   "Cloning and sequencing of Bacillus subtilis homologues of the Escherichia
RT   coli pst gene products";
RL   Unpublished.
XX
RN   [3]
RX   PUBMED; 8760913.
RA   Takemaru K., Mizuno M., Kobayashi Y.;
RT   "A Bacillus subtilis gene cluster similar to the Escherichia coli
RT   phosphate-specific transport (pst) operon: evidence for a tandemly arranged
RT   pstB gene";
RL   Microbiology (Reading, Engl.) 142:2017-2020(1996).
XX
DR   MD5; e12ed7af63a1881d09c7c27728215dca.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5302
FT                   /organism="Bacillus subtilis"
FT                   /strain="JH642 (trpC2 pheA1)"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   regulatory      67..72
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      90..95
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      141..146
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        157..1059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF108"
FT                   /note="Similality to phosphate-binding protein (PstS) of E.
FT                   coli"
FT                   /db_xref="GOA:P46338"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46338"
FT                   /protein_id="BAA09581.1"
FT                   /translation="MKKNKLVLMLLMAAFMMIAAACGNAGESKKSNSDSAKGEEKASGS
FT                   LTISGSSAMQPLVLAAAEKFMEENPDADIQVQAGGSGTGLSQVSEGAVQIGNSDVFAEE
FT                   KEGIDAKALVDHQVAVVGMAAAVNPDAGVKDISKDELKKIFTGKIKNWKELGGKDQKIT
FT                   LVNRPDSSGTRATFVKYALDGAEPAEGITEDSSNTVKKIIADTPGAIGYLAFSYLTDDK
FT                   VTALSIDGVKPEAKNVATGEYPIWAYQHSYTKGEATGLAKEFLDYLKSEDIQKSIVTDQ
FT                   GYIPVTDMKVTRDANGKQS"
FT   regulatory      1114..1120
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        1128..2057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF72"
FT                   /note="Similality to phosphate transport protein (PstC) of
FT                   E. coli"
FT                   /db_xref="GOA:P46339"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46339"
FT                   /protein_id="BAA09582.1"
FT                   /translation="MINNRENMSVSERLISSRQNRQLDEVRGRMIVTACALIMIAASVA
FT                   ITIFLGVKGLQSFLVNGVSPIEFLTSLNWNPTDSDPKYGVLPFIFGSFAVTILSALIAA
FT                   PLGIAGPIFMTEIAPNWGKKVLQPVIELLVGIPSVVYGFIGLTVLVPFIAQFKSSGTGH
FT                   SLLAGTIVLSVMILPTITSISADAMASLPKSLREGSYALGATRWQTIRKVLVPAAFPTL
FT                   MTAVVLGMARAFGEALAVQMVIGNTRVLPESPFDTAGTLTTIITLNMGHTTYGSVENNT
FT                   LWSMGLVLLVMSFLFILLIRYLSSRRKV"
FT   regulatory      2043..2048
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        2057..2941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF73"
FT                   /note="Similality to phosphate transport protein (PstA) of
FT                   E. coli"
FT                   /db_xref="GOA:P46340"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46340"
FT                   /protein_id="BAA09583.1"
FT                   /translation="MNRKITDKLATGMFGLCAAIIAAILVGLFSYIIINGVSQLSFQFI
FT                   TTKSSAIAAGGGIRDQLFNSFYILFITMLITIPLGVGGGVFMAEYAPNNKVTDFIRTCI
FT                   EVLSSLPSIVIGMFGLLMFVNLTGWGYTIIGGALALTVFNLPVMVRVTEDAIRSVPKDL
FT                   KEASLALGVSRWHTVKTVLIPSAIPSIITGAILASGRVFGEAAALLFTAGLTTPRLNFT
FT                   EWNPFSETSPLNIFRPAETLAVHIWNVNTQGMIPDAEAIANGGSPVLVISVLVFNLAAR
FT                   WLGTMIYKKLTAN"
FT   regulatory      2946..2953
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        2962..3771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF74"
FT                   /note="Similality to phosphate transport protein (PstB) of
FT                   E. coli"
FT                   /db_xref="GOA:P46341"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46341"
FT                   /protein_id="BAA09584.1"
FT                   /translation="MSEQMVKEKPERAVIVPKQNHVLEVKDLSIYYGNKQAVHHVNMDI
FT                   EKNAVTALIGPSGCGKSTFLRNINRMNDLIPSARAEGEILYEGLNILGGNINVVSLRRE
FT                   IGMVFQKPNPFPKSIYANITHALKYAGERNKAVLDEIVEESLTKAALWDEVKDRLHSSA
FT                   LSLSGGQQQRLCIARTLAMKPAVLLLDEPASALDPISNAKIEELITGLKREYSIIIVTH
FT                   NMQQALRVSDRTAFFLNGELVEYGQTEQIFTSPKKQKTEDYINGKFG"
FT   regulatory      3770..3775
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        3782..4564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF75"
FT                   /note="Similality to phosphate transport protein (PstB) of
FT                   E. coli"
FT                   /db_xref="GOA:P46342"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46342"
FT                   /protein_id="BAA09585.1"
FT                   /translation="MSIATEAVMKQEVYQVNGMNLWYGQHHALKNINLSIYENEVTAII
FT                   GPSGCGKSTFIKTLNLMIQMTPNVKLAGELNYNGSNILKDKVDIVDLRKNIGMVFQKGN
FT                   PFPQSIFDNVAYGPRVHGTKNKKKLQEIVEKSLKDVALWDEVKDRLHTSALSLSGGQQQ
FT                   RLCIARALATNPDILLMDEPTSALDPISTRKIEELILELKDKYTIVIVTHNMQQAARVS
FT                   DQTAFFYMGELVECDNTNKMFSNPKDQRTLDYISGKFG"
FT   regulatory      4564..4594
FT                   /note="factor independent terminator"
FT                   /regulatory_class="terminator"
XX
SQ   Sequence 5302 BP; 1537 A; 1025 C; 1229 G; 1511 T; 0 other;
     taaaaaaaac gctcacatga tgtgggcgtt ttttttatac aaaaaaacgc actgatttac        60
     aaaaccttaa cattcggttc aaaccctttt tacatagaac ctttactcta tacgtgtagg       120
     acaaattaca cattatacgc agggggaatt caggaaatga aaaaaaacaa attggtgctt       180
     atgcttctga tggctgcttt tatgatgatt gcagctgcat gcggaaatgc aggagaaagt       240
     aaaaaatcga atagcgattc tgcaaaagga gaagaaaagg catcaggttc tttaaccatt       300
     tctggttcat cggcaatgca gccactagta cttgcagccg cggaaaaatt tatggaagaa       360
     aaccctgatg ctgatataca ggtacaagct ggcggttctg gaacagggct ttctcaagtc       420
     tctgaaggag ctgttcagat cgggaattca gacgtttttg ctgaagaaaa agaaggcatc       480
     gatgcaaaag cgcttgtcga tcatcaagtc gctgtagttg gtatggcagc agctgtaaac       540
     cctgatgctg gtgtaaagga tatttcaaaa gatgaattga aaaaaatctt cactggcaaa       600
     atcaaaaact ggaaagagct cggcggcaaa gaccaaaaga ttacacttgt aaaccgccct       660
     gattcttccg gcacacgtgc tacatttgtg aaatatgcgc ttgacggagc ggagcctgca       720
     gaaggcatta ctgaagattc ctccaacacg gtgaaaaaga tcattgctga tactccggga       780
     gcgattggat atcttgcatt ctcatattta acagatgaca aagtaactgc tctatctatt       840
     gacggtgtta aacctgaagc gaaaaatgta gcaactggcg agtatccgat ctgggcttat       900
     caacattctt atacaaaagg tgaagcgaca ggtttagcta aagaatttct tgattatcta       960
     aagagtgaag acattcaaaa aagcattgtt actgaccaag gctacattcc ggttactgat      1020
     atgaaagtga cacgtgatgc caacgggaag caaagctgat cttaataaaa agaggagtgc      1080
     ggggacaacc gtttctcctc ttaacacatt cataggagtg taaaacaatg ataaacaata      1140
     gagaaaatat gtctgtgagc gagcgcttaa tcagctctag gcaaaatcgg caattggatg      1200
     aagttcgggg aagaatgata gtcacagctt gtgcactgat tatgattgcg gcatctgttg      1260
     cgattaccat tttcctcggc gttaaggggc tgcaatcttt tcttgtaaat ggtgtaagcc      1320
     caattgaatt cttaacgagc ttaaattgga atcctacaga tagtgatccg aaatacggag      1380
     tgctgccatt tatttttggc tcatttgcag taacgattct ttctgctcta atcgctgcgc      1440
     cgcttggcat tgcaggtccg atttttatga cagagattgc cccgaattgg ggaaagaaag      1500
     tgctgcagcc ggtgattgag cttttagtcg gtattccatc tgttgtttat ggattcatag      1560
     gtcttacagt attggtgccg tttatcgccc agttcaaatc gagcggaaca gggcacagtt      1620
     tattggcggg aacgattgtc ctttccgtca tgattctgcc gacgatcaca tcgatttctg      1680
     ctgatgcaat ggcttctctt ccgaagagtt tacgagaggg ttcttacgcg cttggtgcca      1740
     caagatggca gacgatcaga aaagtacttg tgcctgcagc ttttccaaca ttgatgacag      1800
     ctgttgtgtt aggcatggct cgggcgttcg gtgaagcttt ggctgttcag atggtcattg      1860
     gaaatacaag agtattgccg gaaagcccgt ttgacactgc gggaacgctg acaacgatca      1920
     tcacgctgaa tatgggccac accacatacg gaagtgttga aaacaatacg ctgtggtcaa      1980
     tggggcttgt gcttctggtg atgtcattct tgttcatcct gcttattcgc tacttgtcat      2040
     ctaggaggaa agtgtaatga accgcaaaat aacagataaa ctggcgaccg gaatgtttgg      2100
     tttgtgtgca gccattatcg ctgccatttt agtaggtttg ttttcctata ttattataaa      2160
     cggtgtttct cagctcagtt ttcaatttat tacaacaaag tcgagcgcca ttgcagctgg      2220
     aggaggcata cgagatcagc tgtttaactc cttttatatt ttgtttatta caatgctgat      2280
     tacaatcccg ctcggtgtgg gcggcggagt cttcatggct gaatacgcgc ctaataacaa      2340
     agtaactgac ttcattagaa catgtataga ggtgctttca tctcttccgt ctattgtcat      2400
     tgggatgttt ggattattga tgtttgtcaa cttaacaggc tggggttata cgatcatagg      2460
     cggagcgctt gcgttaactg tttttaacct tcctgtcatg gtgcgtgtga cagaagacgc      2520
     gatccgttca gtccctaaag atctgaagga agcctctctc gctttaggtg tatcacgctg      2580
     gcataccgta aaaacagttt taattccaag tgcgattcct tctatcatca caggagcaat      2640
     tttagcgtca ggaagggtgt tcggggaagc ggccgcatta ttatttacgg caggcctgac      2700
     aacaccgcgt cttaatttta cggagtggaa cccgttttcg gaaacatcac cgcttaatat      2760
     tttcaggccc gctgaaacac ttgcggtcca catttggaac gtcaatacac aaggaatgat      2820
     tccggatgct gaagcgattg ccaacggtgg ttctcccgtg ctggtgattt ctgttcttgt      2880
     gtttaatctc gcggcgagat ggcttggcac gatgatctac aaaaagctta cggcaaatta      2940
     gaacggaaag aggcgaaaaa catgtctgaa caaatggtaa aagaaaaacc tgagcgagct      3000
     gttattgttc cgaagcagaa ccacgtgctt gaggtcaaag atctgtccat ttattacgga      3060
     aataaacaag ccgttcatca tgtaaacatg gatattgaaa aaaatgcggt gactgcttta      3120
     attgggccgt cgggatgcgg aaaatctact tttttgagaa atattaaccg aatgaacgat      3180
     ttaattccat ctgcaagagc ggaaggtgaa atcctttatg agggattaaa tatattgggc      3240
     ggcaatatta acgttgtcag cttgagaaga gaaatcggaa tggttttcca aaaaccaaat      3300
     ccatttccga aatcgatcta tgcgaatatc acacatgcat tgaaatatgc cggagagcgg      3360
     aataaagctg ttttagatga aattgtggaa gaaagtttaa caaaagcagc gctctgggat      3420
     gaggtgaagg atcgtttaca ttcatccgca ctctcgttat ccggcggcca gcagcagcgt      3480
     ttatgcatcg cgagaacgct tgcgatgaag ccggctgttc ttctgcttga tgaaccagct      3540
     tcagcgcttg atccgatttc aaatgcaaaa atagaggaat taattacagg attgaaaaga      3600
     gaatactcaa ttattattgt cacgcacaat atgcagcagg ctctgcgggt ttctgaccgg      3660
     acggcattct ttttaaacgg cgagcttgta gaatacggac agaccgaaca gattttcacg      3720
     agtccgaaaa agcaaaagac agaggattat attaacggga aattcggata ggagggcggc      3780
     aatgagtatt gctaccgaag ctgtaatgaa acaggaagta tatcaagtca atggaatgaa      3840
     cttatggtat gggcagcatc atgctttaaa aaatatcaat ttgagcattt atgaaaatga      3900
     ggttacggcg attatcggac catccggatg cgggaaatcg acctttatca agacattgaa      3960
     tttaatgatt caaatgacgc cgaatgtaaa gcttgcaggt gagctgaact ataatggcag      4020
     caacatttta aaggataaag tggacatcgt ggatttgcga aaaaatatcg gcatggtatt      4080
     ccaaaaaggg aatccgtttc cgcaatctat ttttgataat gtggcttacg gaccgagagt      4140
     ccacggcacc aaaaataaga agaagcttca ggaaattgtg gaaaagtcat taaaagacgt      4200
     ggcgttatgg gatgaggtga aggatcgatt gcatacgtcc gctctttcgc tgtcaggggg      4260
     ccagcagcag cgtctttgca tcgccagagc acttgcgacc aatcctgata ttttgctgat      4320
     ggatgaaccg acatctgcac tagatccaat ctcaacgaga aaaattgaag aactcattct      4380
     agagctgaaa gataaatata caattgtcat tgtcacgcat aacatgcagc aggcagcaag      4440
     ggtttctgat caaaccgcct ttttctacat gggcgagctt gttgaatgcg acaatacgaa      4500
     taaaatgttc tctaacccga aggaccaaag aacgctcgat tacatttcag gaaagtttgg      4560
     atgaaaaaaa caggctgagt cagcctgttt ttttatcgtg ttaacgtttt tacgatcttt      4620
     ttgaaactca tgtctgattt tactttaaac ttgccggcac gaatttcttt gtgatagccg      4680
     gcatcaatga catagtcatt aaagtcttga gccgaagaga taatgccctc tttttcaaga      4740
     atagcagata catccgccgt gctcatgccg tctttaatgg tgagcttgta ggttttgact      4800
     ttgtctgatt tcgtgtctga gccgctgtca ttgtttaagg atttctcttt tgaatcgaga      4860
     agtttttgat attcatcacg gttgacagaa accaattttt tagaatcaag ataattgttc      4920
     acgtcttgtt cggttactgt tttattatct tttacagcag cggcctggtc ttcgtcagtc      4980
     agataaaaaa cagctgcaag aacggctgtc gctaaaatga tgccgccagc aaatgcctga      5040
     atgccccgtt ttgtcatacg agcaccttct cattatcttt gataatcgta ttcacgtctt      5100
     ccactgatac atgttcagct ttagcaatcg cttcagctga cataccgtta ttatatttag      5160
     aaagtatttg tttagcgatt ttttgattga tgtcgttctg ctttgatttg cgaatgacaa      5220
     ggtttgtttc cagtaattct tcctcaagca ctgtcatttt ctttttgagc ttgtaaattt      5280
     cctgcatcgc agaaagctgc ag                                               5302
//

If you have problems or comments...

PBIL Back to PBIL home page