(data stored in SCRATCH zone)

EMBL: D64125

ID   D64125; SV 1; linear; genomic DNA; STD; PRO; 1503 BP.
XX
AC   D64125;
XX
DT   27-OCT-1996 (Rel. 49, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Bacillus subtilis genes for ribosomal protein S5, ribosomal protein L18,
DE   ribosomal protein L6 and ribosomal protein S8, complete and partial cds.
XX
KW   ribosomal protein L18; ribosomal protein L6; ribosomal protein S5;
KW   ribosomal protein S8.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-1503
RA   Yoshikawa H.;
RT   ;
RL   Submitted (14-APR-1995) to the INSDC.
RL   Hirofumi Yoshikawa, The University of Tokyo, Inst. Molecular and Cellular
RL   Biosciences; Yayoi 1-1-1, Bunkyo-ku, Tokyo 113, Japan
RL   (E-mail:hiyoshik@tansei.cc.u-tokyo.ac.jp, Tel:813-3812-2111(ex.7826),
RL   Fax:813-3813-0539)
XX
RN   [2]
RP   1-1503
RA   Yasumoto K., Yoshikawa H., Takahashi H.;
RT   "Bacillus subtilis genome project";
RL   Unpublished.
XX
RN   [3]
RX   PUBMED; 8969501.
RA   Yasumoto K., Liu H., Jeong S.M., Ohashi Y., Kakinuma S., Tanaka K.,
RA   Kawamura F., Yoshikawa H., Takahashi H.;
RT   "Sequence analysis of a 50 kb region between spoOH and rrnH on the Bacillus
RT   subtilis chromosome";
RL   Microbiology (Reading, Engl.) 142:3039-3046(1996).
XX
DR   MD5; 9e453cf8e110858b3ec16c25f0cafc88.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1503
FT                   /organism="Bacillus subtilis"
FT                   /strain="168"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        1..399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /product="ribosomal protein S8"
FT                   /db_xref="GOA:P12879"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12879"
FT                   /protein_id="BAA10980.1"
FT                   /translation="MVMTDPIADMLTRIRNANMVRHEKLEIPASKLKREIPEILKREGF
FT                   IRDVEFVEDSKQGIIRVSLKYGQNNERVITGLKRISKPGLRVYAKSNEVPRVLNGLGIA
FT                   IISTSQGVLTDKEARAKQAGGEVLAYVW"
FT   CDS_pept        429..968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /product="ribosomal protein L6"
FT                   /db_xref="GOA:P46898"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46898"
FT                   /protein_id="BAA10981.1"
FT                   /translation="MSRVGKKLLEIPSDVTVTLNDNNTVAVKGPKGELTRTFHPDMEIK
FT                   VEDNVLTVARPSDQKEHRALHGTTRSLLGNMVEGVSKGFERGLELVGVGYRASKSGNKL
FT                   VLNVGYSHPVEIVPEEGIEIEVPSQTKVVVKGTDKERVGAIAANIRAVRSPEPYKGKGI
FT                   RYEGEVVRRKEGKSAK"
FT   CDS_pept        1001..1363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /product="ribosomal protein L18"
FT                   /db_xref="GOA:P46899"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46899"
FT                   /protein_id="BAA10982.1"
FT                   /translation="MITKTSKNAARLKRHARVRAKLSGTAERPRLNVFRSYKHIYAQII
FT                   DDVNGVTLASASTLDKDLNVESTGDTSAATKVGELVAKRAAEKGISDVVFDRGGYLYHG
FT                   RVKALADAAREAGLKF"
FT   CDS_pept        1388..>1503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ribosomal protein S5"
FT                   /db_xref="GOA:P21467"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21467"
FT                   /protein_id="BAA20856.1"
FT                   /translation="MRRIDPSKLELEERLVTVNRVAKVVKGGRRFRFAALVVV"
XX
SQ   Sequence 1503 BP; 456 A; 282 C; 355 G; 410 T; 0 other;
     atggttatga cagatccaat tgcagatatg ctaactcgta ttcgcaatgc aaacatggta        60
     cgtcatgaga agcttgaaat tcctgcttct aaattgaaaa gagaaattcc tgaaatttta       120
     aagcgtgaag gtttcattcg tgacgttgag ttcgtagaag acagcaaaca aggtattatc       180
     cgcgtttcct tgaaatacgg acaaaacaac gagcgcgtta tcactggtct taaaagaatc       240
     agcaagcctg gtttgcgtgt ttatgctaaa tctaatgaag taccccgcgt acttaacggt       300
     cttggaatcg cgattatttc tacatcacaa ggtgttttaa cggacaaaga agcccgtgca       360
     aaacaagctg gtggagaagt tctagcatac gtttggtaag aagtttaaca tgaatggagg       420
     tgtttggtat gtctcgtgta ggtaagaagc tacttgagat tccttctgat gttacagtaa       480
     cgttaaatga taacaacact gtagctgtga aaggaccaaa aggagaatta actcgtacgt       540
     ttcaccctga tatggagatt aaagtagagg acaatgtgct tacagtcgct cgtccttctg       600
     atcaaaaaga gcaccgtgcc ctgcatggta cgactcgcag tctgcttggc aacatggttg       660
     aaggtgtatc taaaggattt gaaagaggtt tggaattagt cggtgtcggt taccgtgctt       720
     ctaaatccgg aaataaactt gttttaaacg ttggatactc tcatcctgtt gagatcgttc       780
     ctgaagaagg catcgaaatc gaagttcctt ctcaaacaaa agtagttgta aaaggtacag       840
     acaaagaacg cgtaggagct attgctgcta acatccgcgc tgtacgttct ccagagcctt       900
     acaaaggtaa aggaatccgc tacgaaggtg aagttgttcg ccgtaaagaa ggtaaatctg       960
     ctaagtaaga tcgcttaaag tgaagaaagg agtgacctag atgattacga aaactagcaa      1020
     aaatgctgct cgtcttaaaa gacacgctcg tgttcgcgct aaactttccg gtactgctga      1080
     aagaccgcgc ctgaacgttt tccgttctta caagcacatt tacgctcaaa tcatcgatga      1140
     tgtaaatggt gtaacacttg ctagtgcatc tactctcgat aaagacttga acgttgaaag      1200
     cactggagat acttctgctg ctactaaagt tggagaatta gttgcaaaac gcgctgctga      1260
     aaaaggcatt tctgacgtag tatttgaccg tggcggatac ttataccatg gacgtgtaaa      1320
     agctttggct gatgccgctc gtgaagctgg acttaaattt taataaaaga aggagggaca      1380
     catgattatg cgtcgtattg acccaagcaa attagagtta gaagaacgct tagttacggt      1440
     taaccgcgta gcgaaagttg ttaaaggtgg tcgtcgtttc cgcttcgcag ctctagtcgt      1500
     tgt                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page