(data stored in SCRATCH zone)

EMBL: D64127

ID   D64127; SV 1; linear; genomic DNA; STD; PRO; 8977 BP.
XX
AC   D64127;
XX
DT   27-OCT-1996 (Rel. 49, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Bacillus subtilis genes for RNA polymerase beta subunit, ribosomal proteins
DE   L12 and S7, elongation factors G and Tu and ribosomal proteins S10 and L3,
DE   partial and complete cds.
XX
KW   elongation factor G; elongation factor Tu; fus; ribosomal protein L12;
KW   ribosomal protein L3; ribosomal protein S10; ribosomal protein S7;
KW   RNA polymerase beta' subunit; rplC; rpoC; rpsG; rpsJ; rpsL; tufA.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-8977
RA   Yoshikawa H.;
RT   ;
RL   Submitted (14-APR-1995) to the INSDC.
RL   Hirofumi Yoshikawa, The University of Tokyo, Inst. Molecular and Cellular
RL   Biosciences; Yayoi 1-1-1, Bunkyo-ku, Tokyo 113, Japan
RL   (E-mail:hiyoshik@tansei.cc.u-tokyo.ac.jp, Tel:813-3812-2111(ex.7826),
RL   Fax:813-3813-0539)
XX
RN   [2]
RP   1-8977
RA   Yasumoto K., Yoshikawa H., Takahashi H.;
RT   "Bacillus subtilis genome project";
RL   Unpublished.
XX
RN   [3]
RX   PUBMED; 8969501.
RA   Yasumoto K., Liu H., Jeong S.M., Ohashi Y., Kakinuma S., Tanaka K.,
RA   Kawamura F., Yoshikawa H., Takahashi H.;
RT   "Sequence analysis of a 50 kb region between spoOH and rrnH on the Bacillus
RT   subtilis chromosome";
RL   Microbiology (Reading, Engl.) 142:3039-3046(1996).
XX
DR   MD5; 4d685e4d164b960fa859b609f336f601.
DR   EuropePMC; PMC105730; 9687404.
DR   EuropePMC; PMC92507; 11133424.
XX
CC   Sequence updated (14-Feb-1996) by: Hirofumi Yoshikawa
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8977
FT                   /organism="Bacillus subtilis"
FT                   /strain="168"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        <1..2246
FT                   /codon_start=3
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /product="RNA polymerase beta' subunit"
FT                   /db_xref="GOA:P37871"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37871"
FT                   /protein_id="BAA10999.1"
FT                   /translation="DQMAVHVPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVL
FT                   GNYYLTLERAGAVGEGMVFKNTDEALLAYQNGYVHLHTRVAVAANSLKNVTFTEEQRSK
FT                   LLITTVGKLVFNEILPESFPYMNEPTKSNIEEKTPDRFFLEKGADVKAVIAQQPINAPF
FT                   KKGILGKIIAEIFKRFHITETSKMLDRMKNLGFKYSTKAGITVGVSDIVVLDDKQEILE
FT                   EAQSKVDNVMKQFRRGLITEEERYERVISIWSAAKDVIQGKLMKSLDELNPIYMMSDSG
FT                   ARGNASNFTQLAGMRGLMANPAGRIIELPIKSSFREGLTVLEYFISTPGARKGLADTAL
FT                   KTADSGYLTRRLVDVAQDVIIRETDCGTDRGILAKPLKEGTETIERLEERLIGRFARKQ
FT                   VKHPETGEVLVNENELIDEDKALEIVEAGIEEVWIRSAFTCNTPHGVCKRCYGRNLATG
FT                   SDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGVAGDDITQGLPRIQELFEARNPKGQA
FT                   TITEIDGTVVEINEVRDKQQEIVVQGAVETRSYTAPYNSRLKVAEGDKITRGQVLTGGS
FT                   IDPKELLKVTDLTTVQEYLLHEVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVIDAGDTD
FT                   VLPGTLLDIHQFTEANKKVLLEGNRPATGRPVLLGITKASLETDSFLSAASFQETTRVL
FT                   TDAAIKGKRDELLGLKENVIIGKLVPGGTAMMKYRKVKPVSNVQPTDDMVPVE"
FT   CDS_pept        2427..2675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orf2"
FT                   /product="unknown"
FT                   /db_xref="GOA:P46350"
FT                   /db_xref="InterPro:IPR000948"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR023460"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="PDB:3V7E"
FT                   /db_xref="PDB:4LCK"
FT                   /db_xref="PDB:4TZP"
FT                   /db_xref="PDB:4TZV"
FT                   /db_xref="PDB:4TZW"
FT                   /db_xref="PDB:4TZZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46350"
FT                   /protein_id="BAA11000.1"
FT                   /translation="MSYDKVSQAKSIIIGTKQTVKALKRGSVKEVVVAKDADPILTSSV
FT                   VSLAEDQGISVSMVESMKKLGKACGIEVGAAAVAIIL"
FT   CDS_pept        2789..3205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /product="ribosomal protein L12"
FT                   /db_xref="GOA:P21472"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21472"
FT                   /protein_id="BAA11001.1"
FT                   /translation="MPTINQLIRKGRVSKVENSKSPALNKGYNSFKKEHTNVSSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKNLP
FT                   RVRYHIVRGALDTAGVENRAQGRPKYGTKKPKAK"
FT   CDS_pept        3247..3717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /product="ribosomal protein S7"
FT                   /db_xref="GOA:P21469"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21469"
FT                   /protein_id="BAA11002.1"
FT                   /translation="MPRKGPVAKRDVLPDPIYNSKLVSRLINKMMIDGKKGKPQTILYK
FT                   SFDIIKERTGNDAMEVFEQALKNIMPVLEVKARRVGGANYQVPVEVRPERRTTLGLRWL
FT                   VNYARLRGEKTMEERLANEILDAANNTGAAVKKREDTHKMAEANKAFAHYRW"
FT   CDS_pept        3771..5849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fus"
FT                   /product="elongation factor G"
FT                   /db_xref="GOA:P80868"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="PDB:5VH6"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80868"
FT                   /protein_id="BAA11003.1"
FT                   /translation="MAREFSLEKTRNIGIMAHIDAGKTTTTERILFYTGRIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWKGYRVNIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVGTLRDRLQANAHAIQ
FT                   LPIGAEDNFEGIIDLVENVAYFYEDDLGTRSDAKEIPEEYKEQAEELRNSLIEAVCELD
FT                   EELMDKYLEGEELTIDELKAGIRKGTLNVEFYPVLVGSAFKNKGVQLVLDAVLDYLPAP
FT                   TDVAAIKGTRPDTNEEIERHSSDEEPFSALAFKVMTDPYVGKLTFFRVYSGTLDSGSYV
FT                   KNSTKGKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTTTGDTLCDEKDLVILES
FT                   MEFPEPVIDVAIEPKSKADQDKMGIALAKLAEEDPTFRTQTNPETGQTIISGMGELHLD
FT                   IIVDRMKREFKVEANVGAPQVAYRETFRTGAKVEGKFVRQSGGRGQFGHVWIEFEPNEE
FT                   GAGFEFENAIVGGVVPREYIPAVQAGLEDALENGVLAGFPLIDIKAKLFDGSYHDVDSN
FT                   EMAFKVAASMALKNAVSKCNPVLLEPIMKVEVVIPEEYMGDIMGDITSRRGRVEGMEAR
FT                   GNAQVVRAMVPLAEMFGYATALRSNTQGRGTFTMHMDHYGEVPKSVAEEIIKKNKGE"
FT   CDS_pept        5969..7159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /product="elongation factor Tu"
FT                   /db_xref="GOA:P33166"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:P33166"
FT                   /protein_id="BAA11004.1"
FT                   /translation="MAKEKFDRSKSHANIGTIGHVDHGKTTLTAAITTVLHKKSGKGTA
FT                   MAYDQIDGAPEERERGITISTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAI
FT                   LVVSAADGPMPQTREHILLSKNVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYD
FT                   FPGDDVPVVKGSALKALEGDAEWEAKIFELMDAVDEYIPTPERDTEKPFMMPVEDVFSI
FT                   TGRGTVATGRVERGQVKVGDEVEIIGLQEENKKTTVTGVEMFRKLLDYAEAGDNIGALL
FT                   RGVSREEIQRGQVLAKPGTITPHSKFKAEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDV
FT                   TGIIHLPEGVEMVMPGDNTEMNVELISTIAIEEGTRFSIREGGRTVGSGVVSTITE"
FT   CDS_pept        7258..8214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orf3"
FT                   /product="unknown"
FT                   /db_xref="GOA:P70981"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70981"
FT                   /protein_id="BAA11005.1"
FT                   /translation="MIPEKKSIAIMKELSIGNTKQMLMINGVDVKNPLLLFLHGGPGTP
FT                   QIGYVRHYQKELEQYFTVVHWDQRGSGLSYSKRISHHSMTINHFIKDTIQVTQWLLAHF
FT                   SKSKLYLAGHSWGSILALHVLQQRPDLFYTYYGISQVVNPQDEESTAYQHIREISESKK
FT                   ASILSFLTRFIGAPPWKQDIQHLIYRFCVELTRGGFTHRHRQSLAVLFQMLTGNEYGVR
FT                   NMHSFLNGLRFSKKHLTDELYRFNAFTSVPSIKVPCVFISGKHDLIVPAEISKQYYQEL
FT                   EAPEKRWFQFENSAHTPHIEEPSLFANTLSRHARNHL"
FT   CDS_pept        8450..8758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /product="ribosomal protein S10"
FT                   /db_xref="GOA:P21471"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21471"
FT                   /protein_id="BAA11006.1"
FT                   /translation="MAKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTE
FT                   KSVYTILRAVHKYKDSREQFEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL"
FT   CDS_pept        8798..>8977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /product="ribosomal protein L3"
FT                   /db_xref="GOA:P42920"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42920"
FT                   /protein_id="BAA11007.1"
FT                   /translation="MTKGILGRKIGMTQVFAENGDLIPVTVIEAAPNVVLQKKTAENDG
FT                   YEAIQLGFDDKREKL"
XX
SQ   Sequence 8977 BP; 2738 A; 1833 C; 1984 G; 2422 T; 0 other;
     gtgaccaaat ggcggttcac gtaccattat ctgctgaagc acaagctgaa gcacgcatct        60
     tgatgcttgc tgctcaaaac atcttgaacc ctaaagatgg taaaccggtt gtaacaccgt       120
     ctcaggatat ggtactaggt aactattacc tgacacttga gcgtgccggt gctgtcggtg       180
     aaggtatggt cttcaagaat acagacgaag cgcttcttgc ttatcaaaac ggatatgttc       240
     accttcatac gagagtagct gttgcagcta actcacttaa gaatgtgaca tttaccgaag       300
     aacagcgctc aaaattgtta attacaactg tcggtaagct tgtcttcaat gaaattcttc       360
     cggaatcatt cccttacatg aatgaaccaa cgaagagcaa cattgaagag aaaacacctg       420
     accgtttctt cttagaaaaa ggtgctgatg ttaaagctgt tatcgcacag cagccaatca       480
     atgcgccgtt taaaaaaggc attctgggta aaatcatcgc ggaaatcttt aaacgattcc       540
     atattacgga aacgtctaaa atgcttgacc gcatgaaaaa cctaggtttc aaatattcaa       600
     ctaaagctgg tattacagtt ggggtttctg acatcgtcgt actcgatgat aaacaagaaa       660
     ttcttgagga agcgcaaagc aaagttgaca acgttatgaa gcaattccgc cgcggtctta       720
     tcactgaaga agaacgctat gagagagtca tctctatctg gagtgctgca aaagacgtta       780
     tccaaggcaa actgatgaaa tcacttgatg aactcaaccc gatctacatg atgagtgact       840
     ctggtgcccg tggtaacgca tctaacttta cgcagcttgc cggaatgcgc ggcctgatgg       900
     ccaacccggc tggacgtatc attgagttgc cgatcaaatc aagtttccgt gaaggtctga       960
     cagtattgga gtactttatc tccacacccg gtgcgcgtaa aggtcttgcc gataccgctc      1020
     ttaaaactgc tgactcaggt taccttacac gccgtctcgt tgacgttgct caggatgtta      1080
     tcatccgtga aactgattgc ggaactgacc gaggcattct tgctaagcct cttaaagaag      1140
     gaactgaaac aattgagcgc ttagaagaac gcttaatcgg acgttttgca agaaaacaag      1200
     tgaagcaccc tgaaacaggt gaagtgcttg tgaatgaaaa cgaactgatc gatgaagata      1260
     aagcactgga gattgtcgaa gccggcattg aagaagtgtg gatccgttct gccttcacat      1320
     gtaatacgcc tcatggtgta tgtaaacgat gctatggccg aaatcttgca actggctccg      1380
     atgttgaagt cggtgaagct gtcggaatca ttgctgccca atcaatcggt gagcctggta      1440
     cacagttaac aatgcgtaca ttccatacag gcggggttgc cggagacgat atcacacagg      1500
     gtcttccgcg tatccaagag cttttcgaag cgcgtaatcc gaagggtcag gcaacaatta      1560
     cagaaatcga cggtacagtc gttgagatca atgaagttcg tgataagcaa caggaaattg      1620
     tggttcaagg cgcagtggaa acacgttctt atacggcacc ttacaactcc cgcctgaaag      1680
     tagcggaagg agataaaatt actcgaggcc aagtactgac aggaggttca atcgatccga      1740
     aagaacttct taaagtgact gacctgacga ctgttcaaga gtatcttctc catgaggttc      1800
     aaaaggttta ccgtatgcag ggtgttgaaa tcggtgataa acacgtagaa gtaatggttc      1860
     gccagatgct tcgcaaagta cgcgtgattg atgccggtga cactgatgtg cttccaggta      1920
     cattgcttga tattcaccaa tttactgaag cgaacaaaaa ggtattgctt gaaggcaacc      1980
     gaccagctac aggccgtcct gtcttactcg gtattacaaa agcatctctt gaaactgatt      2040
     cattcttatc tgctgcttcc ttccaggaaa caacacgtgt ccttacagat gcagcgatca      2100
     aaggtaagcg tgacgagctt ctcggcttga aagagaatgt tatcatcggt aagcttgttc      2160
     caggaggtac agcaatgatg aaataccgta aagtaaaacc agtatcaaat gttcagccga      2220
     ctgacgatat ggtcccggtt gaataactga tttaactctc tgctgaaaga ctgcaaaaac      2280
     agtcttgcag cagatatatt tatgaaaaag tcactctatg agaagaacga atctaaaaaa      2340
     tgtcatacct tgttgacatt cgtctcctag aatgataata taaccaaggt gctcgaaata      2400
     aacctgttac tttggaggat atgtttatgt cttatgataa agtatcacag gccaaatcaa      2460
     ttattattgg tacgaagcaa acagtgaaag ctctaaagcg aggttcagta aaggaagtag      2520
     tcgttgccaa agacgcagat ccgatactca cgtcaagtgt tgtttcactt gctgaagatc      2580
     aaggtatctc tgtctcaatg gttgaatcca tgaaaaagct cggcaaagcc tgcggaattg      2640
     aggtaggagc agccgctgtt gccattattt tataacgtac ttttgttttt gcgtcagatt      2700
     ccatcttgtg taaagacatt gttttttgcc ttttgatgaa ccacctgggt atgtgggtta      2760
     taaaacgtaa tgaagggagg aaaaattcat gcctacaatt aatcagctaa ttcgcaaagg      2820
     acgcgtgagt aaagtagaaa actcaaagtc tcctgcactt aacaaaggat acaacagctt      2880
     taaaaaagag cacactaacg tatcttctcc acaaaaacgc ggggtatgta ctcgtgttgg      2940
     tacaatgaca ccgaaaaaac cgaactcagc gcttcgtaaa tatgctcgtg ttcgtttgac      3000
     taacggaatc gaggttactg cttacattcc tggtatcggt cacaacctgc aagagcacag      3060
     tgttgtactt atccgcggcg gacgtgttaa aaacttacca agggtacgtt accacatcgt      3120
     tcgtggtgcg cttgatactg ctggagttga aaaccgtgca caaggccgtc ctaaatacgg      3180
     tacgaaaaaa cctaaagcaa aataatatac gaaaatacgc ataattaatg aagggaggat      3240
     attcagatgc cacgtaaagg tcctgtagca aaaagagatg ttttacctga tccgatttac      3300
     aactctaagc ttgtatctcg tttaatcaac aaaatgatga tcgatggtaa aaaaggtaag      3360
     cctcaaacga tcctatacaa gtcattcgat atcattaaag aacgtactgg caatgatgca      3420
     atggaggttt tcgaacaagc attgaaaaac atcatgcctg tacttgaagt aaaagcacgc      3480
     cgtgtaggtg gtgcgaacta ccaagttcct gtagaagttc gtcctgaacg tcgtacgact      3540
     cttggacttc gctggttagt taactacgct cgtcttcgtg gagaaaaaac gatggaagag      3600
     cgtttagcta acgaaatcct tgacgcagct aacaacactg gtgctgctgt taagaaacgt      3660
     gaagacactc ataagatggc tgaagcaaac aaagcatttg ctcactatcg ctggtaggat      3720
     ttatagatta acaaaacaca atttcctaat aaggaaggag aaattaccca atggcaagag      3780
     agttctcctt agaaaaaact cgtaatatcg gtatcatggc tcacatcgat gccggtaaaa      3840
     cgactactac agaacgtatc ttgttctata ctggtcgtat ccacaaaatt ggtgaaactc      3900
     atgaaggagc ttcacaaatg gactggatgg agcaggaaca agaacgtggt atcacaatca      3960
     cttccgctgc gactactgca cagtggaaag gataccgcgt aaacatcatc gatactccag      4020
     gacacgtaga cttcacagtt gaagttgaac gttctcttcg tgtacttgat ggtgctgttg      4080
     ctgtacttga cgcgcaatca ggcgttgagc ctcaaacaga aactgtttgg cgtcaggcaa      4140
     caacttatgg agtaccgcgt atcgtttttg ttaacaaaat ggacaaaatc ggtgcagact      4200
     tcctttactc tgtaggaact ttaagagacc gtcttcaagc aaacgctcat gcaattcaat      4260
     tgccgatcgg tgctgaagat aacttcgaag gtatcattga ccttgtagaa aacgttgcgt      4320
     atttctacga agatgacctc ggaactcgtt ctgatgcaaa agaaatccct gaagagtaca      4380
     aagagcaagc tgaagagctt cgcaacagcc ttattgaagc tgtatgtgag cttgatgaag      4440
     agcttatgga taagtacctt gagggtgaag aacttacaat tgacgagtta aaagcaggaa      4500
     ttcgtaaagg tacattaaat gttgaattct accctgttct tgttggttct gccttcaaaa      4560
     acaaaggtgt tcaactagta cttgatgctg ttcttgacta ccttcctgca ccaactgacg      4620
     ttgctgcaat aaaaggtaca cgtcctgata caaatgaaga gattgagcgt cattcttctg      4680
     acgaagagcc attctctgca ttagcattta aagttatgac tgacccttac gttggtaagt      4740
     tgacgttctt ccgtgtgtac tctggaacac ttgattctgg ttcatacgtg aaaaactcta      4800
     ctaaaggcaa acgtgagcgt gttggacgta ttcttcaaat gcacgctaac agccgtgaag      4860
     aaatctctac tgtatacgca ggggatatcg cggctgctgt aggtcttaaa gatacaacta      4920
     ctggagatac tctatgtgat gagaaggatc ttgttatcct tgagtcaatg gaattcccag      4980
     aaccagttat cgacgttgct attgagccta aatcaaaagc tgaccaagat aaaatgggta      5040
     tcgctttagc gaaacttgct gaagaagatc ctacattccg tactcaaaca aacccagaaa      5100
     ctggccaaac gatcatctct ggtatgggtg aacttcacct tgatatcatt gttgaccgta      5160
     tgaaacgcga atttaaagta gaagccaatg ttggtgctcc tcaagttgcg taccgtgaaa      5220
     cattccgtac cggtgcaaaa gttgaaggta aattcgtacg tcagtctggt ggacgcggtc      5280
     agttcggaca cgtttggatc gaattcgaac caaacgaaga aggcgctggc tttgaatttg      5340
     aaaatgcgat tgtcggtggg gtcgttcctc gtgaatacat cccagctgtt caagcaggtc      5400
     tggaagatgc actcgaaaat ggtgtactag caggcttccc gcttatcgac attaaagcta      5460
     aacttttcga cggttcttac catgatgttg actcaaacga aatggcattt aaagtcgctg      5520
     cttctatggc attgaaaaat gcagtcagca aatgtaaccc agttcttctt gaaccaatca      5580
     tgaaagtgga agtggttatt ccagaagaat atatgggaga tatcatgggt gatatcactt      5640
     cacgtcgcgg acgcgtagaa ggtatggaag cacgcggtaa cgctcaagtt gttcgtgcta      5700
     tggttcctct tgctgaaatg ttcggttacg ctactgcact tcgttctaat acgcaaggtc      5760
     gcggtacgtt cactatgcac atggatcact acggagaagt gccgaagagc gtcgcagaag      5820
     aaattatcaa aaaaaataaa ggcgaataat tgattttgcc gcttaactca agtataacta      5880
     ctattgtaag atgaggaagt gaaagctttc tttcacttcc tatcactcta tacattacta      5940
     attaaaagct cttaaggagg attttagaat ggctaaagaa aaattcgacc gttccaaatc      6000
     acatgccaat attggtacaa ttggacacgt tgaccatggt aaaacaactt taactgctgc      6060
     tatcacaaca gtacttcata agaaatctgg taaaggtaca gctatggcgt acgatcaaat      6120
     tgatggtgct ccagaagaac gcgagcgcgg tatcacaatc tctactgcac acgttgagta      6180
     cgaaactgaa actcgtcact atgcacacgt tgactgccca ggacacgctg actatgttaa      6240
     aaacatgatc actggtgctg cgcaaatgga cggagctatc cttgtagtat ctgctgctga      6300
     tggcccaatg ccacaaactc gtgagcacat ccttctttct aaaaacgttg gtgtaccata      6360
     catcgttgta ttcttaaaca aatgcgacat ggtagacgac gaagagcttc ttgaactagt      6420
     tgaaatggaa gttcgcgatc ttcttagcga atacgacttc cctggtgatg atgtaccagt      6480
     tgttaaaggt tctgctctta aagctcttga aggagacgct gagtgggaag ctaaaatctt      6540
     cgaacttatg gatgcggttg atgagtacat cccaactcca gaacgcgaca ctgaaaaacc      6600
     attcatgatg ccagttgagg acgtattctc aatcactggt cgtggtacag ttgctactgg      6660
     ccgtgtagaa cgcggacaag ttaaagtcgg tgacgaagtt gaaatcatcg gtcttcaaga      6720
     agagaacaag aaaacaactg ttacaggtgt tgaaatgttc cgtaagcttc ttgattacgc      6780
     tgaagctggt gacaacattg gtgcccttct tcgcggtgta tctcgtgaag aaatccaacg      6840
     tggtcaagta cttgctaaac caggtacaat cactccacac agcaaattca aagctgaagt      6900
     ttacgttctt tctaaagaag agggtggacg tcatactcca ttcttctcta actaccgtcc      6960
     tcagttctac ttccgtacaa ctgacgtaac tggtatcatc catcttccag aaggcgtaga      7020
     aatggttatg cctggagata acactgaaat gaacgttgaa cttatttcta caatcgctat      7080
     cgaagaagga actcgtttct ctattcgtga aggcggacgt actgttggtt caggcgttgt      7140
     ttctacaatc actgagtaat agtatggttt taaacgagac ccctgtgggt ctcgtttttt      7200
     gtttgcttat ctttttcttg tataatagga tctatcatat tcgaggggtt aatatttatg      7260
     attcctgaaa agaaatcaat cgcaatcatg aaagaactaa gcattggaaa tacaaagcaa      7320
     atgctgatga ttaatggagt tgacgtgaaa aatccattgc tgcttttttt acatggcggg      7380
     ccgggaacgc cgcaaatcgg atatgttaga cattatcaaa aagagctgga acagtatttt      7440
     acagtagttc attgggatca gagaggatcg gggctttctt attctaagcg aatttcgcat      7500
     cactctatga caataaatca cttcattaaa gatacaatcc aagtcactca atggctttta      7560
     gctcattttt caaaatcaaa actttaccta gccggtcatt cttggggatc aatactggcg      7620
     cttcatgtgc tgcagcagcg tcctgattta ttttacacgt attatggaat cagccaggtt      7680
     gttaacccgc aagatgaaga atcaactgct tatcaacata ttcgtgaaat ttccgaatca      7740
     aaaaaagcca gcatattatc tttccttaca cgtttcattg gtgctccgcc ttggaagcag      7800
     gatatccagc accttatcta tcggttttgt gttgagctaa ccaggggagg attcactcac      7860
     cgtcatcgtc aatctctcgc tgtattattt caaatgctta ctggcaatga gtatggagtg      7920
     cggaacatgc acagcttcct taatggattg cgcttcagta aaaaacattt aactgatgag      7980
     ttgtaccggt ttaatgcttt tacatcagtt ccttctatta aagtaccgtg tgttttcatt      8040
     tcagggaaac atgacttaat tgttcctgca gaaatatcga aacagtatta tcaagaactt      8100
     gaggcacctg aaaagcgctg gtttcaattt gagaattcag ctcacacccc gcatattgag      8160
     gagccatcat tattcgcgaa cacattaagt cggcatgcac gcaaccattt atgatagatc      8220
     cttgataaat aagaaaaacc cctgtataat aaaaaaagtg tgcaaatgat gcatatttta      8280
     aataagtctt gcaacatgcg cctattttct gtataatggt gtatgttggt ctttgactgc      8340
     gatgaagtga gaggttgctg acacacccgg ccgctttgcc atggcaaggt gttcaggttt      8400
     ttctcacgga gactgtctaa cgtgatgtag gcgaaaagga gggaaaataa tggcaaaaca      8460
     aaaaattcgt attcgtttga aagcatatga tcatagaatc cttgatcaat ctgcagagaa      8520
     gattgttgaa acggcaaaac gttctggtgc cagcgtatct ggtccgattc cgttgccaac      8580
     tgaaaaatca gtttacacaa tccttcgtgc ggtgcacaaa tacaaagatt ctcgtgagca      8640
     atttgaaatg cgtacacata aacgtttaat cgacattgtg aacccaacac cacaaactgt      8700
     tgatgctctt atgcgattag acttaccatc tggtgtcgat atcgaaatta aactttaatt      8760
     ctaaaatata gaatgatctt aataggaggt gtgacgaatg accaaaggaa tcttaggaag      8820
     aaaaattggt atgacgcaag tattcgctga gaatggtgat cttattccgg taactgttat      8880
     cgaggctgct ccaaacgttg ttcttcaaaa gaaaacagct gaaaacgacg gttacgaagc      8940
     aatccagctt ggttttgacg acaagcgtga aaagctt                               8977
//

If you have problems or comments...

PBIL Back to PBIL home page