(data stored in SCRATCH zone)

EMBL: D76432

ID   D76432; SV 1; linear; mRNA; STD; MUS; 5214 BP.
XX
AC   D76432;
XX
DT   19-OCT-1995 (Rel. 45, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus mRNA for transcriptional repressor deltaEF1, complete cds.
XX
KW   deltaEF1; homeodomain; transcriptional repressor; zinc finger.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5214
RA   Ryohei S.;
RT   ;
RL   Submitted (16-OCT-1995) to the INSDC.
RL   Sekido Ryohei, Osaka University, Inst. for Molecular and Cellular Biology;
RL   1-3 Yamadaoka, Suita, Osaka 565, Japan
RL   (E-mail:i64591a@center.osaka-u.ac.jp, Tel:06-877-1738, Fax:06-877-1738)
XX
RN   [2]
RP   1-5214
RA   Sekido R.;
RT   "Mouse mRNA for transcriptional repressor deltaEF1, complete cds.";
RL   Unpublished.
XX
RN   [3]
RX   DOI; 10.1016/0378-1119(96)00185-0.
RX   PUBMED; 8964504.
RA   Sekido R., Takagi T., Okanami M., Moribe H., Yamamura M., Higashi Y.,
RA   Kondoh H.;
RT   "Organization of the gene encoding transcriptional repressor deltaEF1 and
RT   cross-species conservation of its domains";
RL   Gene 173(2):227-232(1996).
XX
DR   Ensembl-Gn; ENSMUSG00000024238; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025081; mus_musculus.
DR   EuropePMC; PMC2806579; 19948490.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5214
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /dev_stage="12-day postcoitum"
FT                   /clone="MR2-27, M12, MR3-15"
FT                   /tissue_type="whole embryo"
FT                   /note="Common name: Mouse"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        20..3373
FT                   /codon_start=1
FT                   /product="deltaEF1"
FT                   /note="7 zinc fingers and a homeodomain"
FT                   /db_xref="GOA:Q64318"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR008598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1344313"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64318"
FT                   /protein_id="BAA11177.1"
FT                   /translation="MADGPRCKRRKQANPRRNNVTNYNTVVEANSDSDDEDKLHIVEEE
FT                   SITDAADCEGGMPDDELPADQTVLPGGSDRGGGAKNCWQDNVKDNECDSDAENEQNHDP
FT                   NVEEFLQQQDTAVIYPEAPEEDQRQGTPEASSHDENGTPDAFSQLLTCPYCDRGYKRFT
FT                   SLKEHIKYRHEKNEDNFSCSLCSYTFAYRTQLERHMTSHKSGREQRHVTQSGGNRKFKC
FT                   TECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLMPVNGR
FT                   PRSGLKTSQCSSPSLSTSPGSPTRPQIRQKIENKPLQEPLSVNQIKTEPVDYEFKPIVV
FT                   ASGINCSTPLQNGVFSSGGQLQATSSPQGVVQAVVLPTVGLVSPISINLSDIQNVLKVA
FT                   VDGNVIRQVLETNQASLASKEQEAVSASPIQQGGHSVISAISLPLVDQDGTTKIIINYS
FT                   LEQPSQLQVVPQNLKKEIPAPTNSCKSEKLPEDLTVKSETDKSFEGARDDSTCLLCEDC
FT                   PGDLNALPELKHYDPECPAQPPPPAPATEKPESSASSAGNGDLSPSQPPLKNLLSLLKA
FT                   YYALNAQPSTEELSKIADSVNLPLDGVKKWFEKMQAGQIPGQSPDPPSPGTGSVNIPTK
FT                   TDEQPQPADGNEPQEDSTRGQSPVKIRSSPVLPVGSAMNGSRSCTSSPSPLNLCSARNP
FT                   QGYSCVAEGAQEEPQVEPLDLSLPKQQGELLERSTVSSVYQNSVYSVQEEPLNLSCAKK
FT                   EPQKDSCVTDSEPVVNVVPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQ
FT                   TILIPQVAYTYSATVSPAVQEPPVKVIQPNGNQDERQDTSSEGVSTVEDQNDSDSTPPK
FT                   KKTRKTENGMYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICRKAFKHKHHLIEHMR
FT                   LHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCKRGAEDRDAMEQEDAGPEVLPEVLA
FT                   TEHVGARASPSQADSDERESLTREEDEDSEKEEEEEDKEMEELQEGKECENPQGEEEEE
FT                   EEEEEEEEEEEEEEVEADEAEHEAAAKTDGTVEVGAAQQAGSLEQKASESEMESESESE
FT                   QLSEEKTNEA"
FT   3'UTR           3374..5214
FT   polyA_signal    5192..5197
XX
SQ   Sequence 5214 BP; 1549 A; 1184 C; 1227 G; 1254 T; 0 other;
     agacacaagc gagaggatca tggcggatgg ccccaggtgt aagcgcagaa agcaggcgaa        60
     cccgcggcgc aataacgtta caaattataa tactgtggta gaagcaaatt cagattccga       120
     tgatgaagac aaactccata ttgtggaaga agaaagtatt acagatgcag ctgactgtga       180
     aggtggcatg ccagatgatg aactgccagc agaccagaca gtattaccag gaggcagtga       240
     cagggggggc ggtgccaaga actgctggca agacaacgtg aaagacaacg agtgtgactc       300
     agatgcagaa aatgagcaaa accatgatcc gaatgtggaa gaatttctgc agcaacaaga       360
     caccgccgtc atttatcctg aggcgcccga ggaagaccag cggcagggca caccagaagc       420
     cagcagtcat gatgaaaacg gaacaccaga tgcattttcc cagttgctca cctgcccgta       480
     ttgtgataga ggctacaagc gctttacctc tttgaaagaa cacattaagt accgccatga       540
     gaagaacgag gacaacttca gctgctccct gtgcagttac acctttgcat acagaaccca       600
     gcttgaacgt catatgacat cacataagtc aggaagagag caaagacatg tgacacagtc       660
     tgggggaaac cgcaagttca agtgcactga atgcgggaag gccttcaagt acaaacacca       720
     cctgaaagag cacttacgga ttcacagtgg agagaagcca tacgaatgcc cgaactgcaa       780
     gaaacggttt tcccattctg gctcctatag ctcacatata agcagtaaga agtgtattag       840
     cttgatgcct gtgaatggca ggcctagatc aggactcaag acatctcagt gttcctcgcc       900
     atctctttcg acatcaccag gcagtcccac acgcccacag atacgacaga agatagagaa       960
     taaacccctt caagaaccgc tttctgtaaa ccaaatcaaa actgaacctg tggattatga      1020
     gttcaaaccc atagtggttg cttcaggaat caactgttca acccctttac aaaatggggt      1080
     ttttagcagt ggtggccaat tgcaggcaac cagttctcct cagggtgtgg tgcaagccgt      1140
     tgttctgcca acagttggtt tggtatctcc cataagtatc aacttaagtg acattcagaa      1200
     tgtacttaaa gtggctgtag atggtaacgt aatacgacaa gtcttggaga ctaatcaagc      1260
     cagtcttgca tccaaagagc aagaagcagt gagtgcttcg cccatccagc agggtggcca      1320
     ttctgtcatt tctgccatca gtcttccttt agttgatcag gatggaacaa ccaaaatcat      1380
     catcaactac agtcttgagc agcccagtca acttcaggtt gttccccaga atttaaagaa      1440
     agaaatccca gcccctacaa acagctgcaa aagtgagaag ttaccagaag accttactgt      1500
     caaatcagaa acggacaaaa gctttgaggg ggccagggat gatagcactt gccttctgtg      1560
     tgaggactgc ccaggggacc tcaatgcact tccagaacta aagcactatg acccagagtg      1620
     ccctgctcag cctccacccc ctgccccagc caccgagaag ccagagtcct ctgcttcatc      1680
     agctggaaac ggagatttgt ctcccagtca gccaccttta aagaaccttc tgtcactctt      1740
     gaaagcctac tatgctctga acgcgcagcc aagcacagaa gagctctcaa agatcgccga      1800
     ttctgtgaac ctaccgctgg atggagttaa aaagtggttt gaaaagatgc aagctggaca      1860
     gattccagga cagtctcctg accccccttc tcctggaacc gggtcagtaa acatacctac      1920
     aaaaaccgat gagcagcctc aacctgcgga tggaaatgag ccccaggaag acagcacacg      1980
     cggacagagt cctgtcaaga taaggagctc tccggtttta cctgtaggat cagccatgaa      2040
     cggttccaga agctgcacat catccccatc ccctctaaac ctttgctcag ccaggaaccc      2100
     gcagggttac tcttgtgtgg cagagggtgc ccaggaggag ccccaagtag aacctcttga      2160
     tctctcacta ccaaagcaac agggagagtt actggaaagg tcgacagtca gtagcgttta      2220
     ccagaacagt gtttattctg tccaggaaga acccttgaac ttgtcttgtg caaaaaagga      2280
     accacaaaag gacagctgtg ttacagactc agaaccagtt gtaaatgtag tcccaccaag      2340
     tgccaacccc ataaacattg ctattcctac agtcactgcc cagttaccca caatcgtggc      2400
     cattgctgac cagaacagtg ttccatgttt aagagcactg gccgccaaca agcagactat      2460
     tctgattccc caagtggcat atacatattc agctactgtg agccctgccg tgcaggagcc      2520
     gccagtgaag gtgatccagc caaacggaaa ccaggatgaa agacaagaca ctagctcaga      2580
     aggagtctcc actgtggagg accagaatga ctctgactcc acgccaccca aaaagaaaac      2640
     tcggaagaca gagaatggaa tgtatgcatg tgacctgtgt gacaagatat ttcagaagag      2700
     cagctcactg ttgagacaca aatatgagca cacaggtaag aggcctcacg agtgtggaat      2760
     ctgtagaaag gcatttaaac acaagcatca tttgattgag cacatgcggc tgcactctgg      2820
     ggaaaagccc tatcaatgtg acaagtgtgg caagcgcttc tcacactccg gctcctactc      2880
     tcaacacatg aatcaccgct actcctactg caagagagga gctgaagaca gagatgctat      2940
     ggagcaggaa gacgctgggc ccgaagtcct gccggaagtc ctggcgactg agcatgttgg      3000
     tgcccgggcg tctccctcac aggctgactc ggacgagaga gaaagtctga caagggaaga      3060
     agatgaagac agtgaaaagg aggaggagga ggaagataaa gagatggaag aattacagga      3120
     aggaaaggaa tgtgagaacc cacaggggga ggaggaggag gaggaggagg aggaagagga      3180
     ggaagaagag gaggaagagg aggaagtgga agcggatgaa gccgagcatg aggcagcagc      3240
     caagactgat ggtacagtgg aggttggagc tgcacagcag gcaggcagct tagagcagaa      3300
     ggccagcgag agcgagatgg agagcgaaag cgagagtgag cagctgtctg aagagaagac      3360
     aaatgaagct taggagttct tctaaaagga aattctactt ggtaatgaaa tttgctctat      3420
     attacccacg cttttcatgg aaacatggct ccatggctcc tgtgctatgg ttcctgctca      3480
     ctactgtgta atgtcagaac tgaaaaaaaa aaattccggg tgtgcctgaa cctcaaacct      3540
     agtaattttt catgcagttt tcaaagttag gaacaaattt ataacatgaa gcagcttaga      3600
     aaacattaat gactcagaaa acaaaggttt ctcagcaggt tacaggaggc tggatgggcg      3660
     tccggcatgg ctagcagtat tatcactctt acgttggctc attcttaagc tctacaatgg      3720
     gagaaatttt ataatttttt tattggtaaa catatgctaa atccgcttca gtattttatt      3780
     atgtttttta aaatgtgaga acttctgcac tacagaattc ccttcacaga gcagtagaaa      3840
     gcagttcaaa ccgcgctggc tacctgctgc tacccagtca gtcaggagat aggacctctg      3900
     acgttagatg ccgtgttgcc atctaacatg tattgctagc cttaaggaag cagccagaga      3960
     agagctggag tttcttactc gtgtgatttt taaatggagt tcaaggttgt cgtgagtcct      4020
     gactccaggg acgaccagtg ttgatgtggc aaggccggca gaggcggcag aatcagtgtt      4080
     cgtgattgtt tgcgtacgtt agcaaccatg aaggatctat aggaagcaag cgctgtgtcc      4140
     ctttggcctt aagcaagacc tgtgctctaa gtgccattct cagtattgca aggctctgac      4200
     agccttcccg cagtgtggcc tatattaact agcagttgtt gattcgtttg ttgtgtcaaa      4260
     attcccaaac aaaactcaaa accactgact gtgagagaag ctgaagcact ggggcatctc      4320
     acacttttgt tcctcagtag tcatttcatg ttgattgact ctcagaagtc tctacagaaa      4380
     taaaagggaa attctccaaa ctacttaatc catgtacttg cgtgtcaggc atggatacgc      4440
     tattggtttt tggttcacag ccgttttcca aatgttagtt attacggacc caggtgatga      4500
     acaacagcag ctgattttta cctaccagta ttattttatt tctttagttt atagatctgt      4560
     gcaacatttt tgtactgtat gtctttaagc ctggcagtat taataccctt cttactgaca      4620
     cgtactttta gttttagaaa acttttatat ttatgtgtct tatttttata tttctttatt      4680
     tattacacag tgtagtgtat aatactgtag tttgtattaa tacaataata tattttagta      4740
     tgaaattttg gaaagttgct aagatttaca gtagagatgc agttggttcc cgtgcgttga      4800
     gatttgattt aacagcgttc tgttaacatt tatacttgcc tccgactgta gaccagcctt      4860
     taaatgggaa ggtattagtt ttacaactac aatcaagtca ttctcccttt ccccagtttt      4920
     taataggaaa ctcttacact ttgacactca ctgtgtgcga ctcatagcat gccgctctgc      4980
     agtcttctgt taagagttgg cccagccata actcattccc ttagcaagcc aaaatagaat      5040
     tgccttctgt aaacagtgtt gggggcaatg tttaacatgt gccaatttgt tcctgtatcc      5100
     atgaatgtaa gctaccaatc tgactcttcc ttttaagttc cttgttacac catggtcatt      5160
     ttctagtttt ttaccagact ccccagctca caataaacgc atcaacaaac ctga            5214
//

If you have problems or comments...

PBIL Back to PBIL home page