(data stored in SCRATCH zone)

EMBL: D76434

ID   D76434; SV 2; linear; genomic DNA; STD; VRT; 23989 BP.
XX
AC   D76434; D76433;
XX
DT   19-OCT-1995 (Rel. 45, Created)
DT   23-DEC-2010 (Rel. 107, Last updated, Version 10)
XX
DE   Gallus gallus transposon CR1 gene for transcriptional repressor deltaEF1,
DE   complete cds.
XX
KW   .
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Testudines + Archosauria group; Archosauria; Dinosauria; Saurischia;
OC   Theropoda; Coelurosauria; Aves; Neognathae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-23989
RA   Sekido R.;
RT   ;
RL   Submitted (16-OCT-1995) to the INSDC.
RL   Contact:Ryohei Sekido Osaka University, Inst. for Molecular and Cellular
RL   Biology; 1-3 Yamadaoka, Suita, Osaka 565, Japan
XX
RN   [2]
RX   DOI; 10.1016/0378-1119(96)00185-0.
RX   PUBMED; 8964504.
RA   Sekido R., Takagi T., Okanami M., Moribe H., Yamamura M., Higashi Y.,
RA   Kondoh H.;
RT   "Organization of the gene encoding transcriptional repressor deltaEF1 and
RT   cross-species conservation of its domains";
RL   Gene 173(2):227-232(1996).
XX
DR   MD5; 2be99bc8b6ac26838cdae5569fd5ba34.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..23989
FT                   /organism="Gallus gallus"
FT                   /mol_type="genomic DNA"
FT                   /dev_stage="3 days old embryo"
FT                   /clone_lib="EMBL3, lambda FIXII and lambda gt11 libraries
FT                   of R.Sekido"
FT                   /clone="GEN[48, 23, 15, 24, 3, 4, 11]"
FT                   /tissue_type="whole embryo"
FT                   /db_xref="taxon:9031"
FT   mobile_element  417..952
FT                   /mobile_element_type="transposon: CR1"
FT   promoter        1100..1172
FT   exon            1173..1251
FT                   /number=1
FT   CDS_pept        join(1194..1251,3030..3230,6522..6581,7228..7389,
FT                   10109..10311,13953..14058,15481..17291,19158..19338,
FT                   20991..21553)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="transcriptional repressor deltaEF1"
FT                   /db_xref="GOA:P36197"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR008598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36197"
FT                   /protein_id="BAA11178.1"
FT                   /translation="MADGPRCKRRKQANPRRNNVTNYNNVIEANSDSDDEDKLHIVEEE
FT                   SITDAADCDASVPEDDLPTDHTVLPENSEREGSTNSCWEDEGKETKEILGPEAQSDEVG
FT                   CTVKEDECDSDAENEQNHDPNVEEFLQQEDTAVIYPEAPEEDQRQGTPEASGQDENGTP
FT                   DAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNEDNFSCSLCSYTFAYRTQLDRHMTSH
FT                   KSGRDQRHVTQSSGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSG
FT                   SYSSHISSKKCIGLMPVNGRARSGLKTSQCSSPSLSASPGSPARPQIRQKIENKPLQEQ
FT                   LPVNQIKTEPVDYEFKPIVVASGINCSTPLQNGVFSGGSPLQATSSPQGVVQAVVLPTV
FT                   GLVSPISINLSDIQNVLKVAVDGNVIRQVLENNHANLASKEQETISNASIQQAGHSLIS
FT                   AISLPLVDQDGTTKIIINYSLEQPSQLQVVPQNLKKEHSVPTNSCKNEKLPEDLTVKSE
FT                   KDKNFEGETNDSTCLLCDDCPGDLNALQELKHYETKNPPQLPQSSGTEAEKPSSPAPSE
FT                   TGENNLSPGQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAG
FT                   QISVQSSGPSSPEQVKISSPTDNDDQAATTNESEPQNSTNNSQNPANTSKSQTSSGGST
FT                   QNGSRSSTPSPSPLNLSSSRNSQGYTYTAEGVQEEPQMEPLDLSLPKQHGELLERSTIT
FT                   SVYQNSVYSVQEEPLNLTCAKKEPQKDNSITDSDPIVNVIPPSANPINIAIPTVTAQLP
FT                   TIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQETPPKQTQANGSQDERQ
FT                   DTSSEGVSNVEDQNDSDSTPPKKKMRKTENGMYACDLCDKIFQKSSSLLRHKYEHTGKR
FT                   PHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCKRE
FT                   AEERDSTEQEEVGQEVLSSEHAGARASPSQIDSDERESLTREEEEDSEKEEEEEEEKDV
FT                   EGLQEEKECRKLQDVEEEEEVEEEEEEEEGKTEGNKNDDVVNRASNAEPEVIQSNGQVS
FT                   EEKTNKA"
FT   intron          1252..>1621
FT                   /number=1
FT   gap             1622..1721
FT                   /estimated_length=unknown
FT   intron          <1722..3029
FT                   /number=1
FT   exon            3030..3230
FT                   /number=2
FT   intron          3231..6521
FT                   /number=2
FT   exon            6522..6581
FT                   /number=3
FT   intron          6582..7227
FT                   /number=3
FT   exon            7228..7389
FT                   /number=4
FT   intron          7390..10108
FT                   /number=4
FT   exon            10109..10311
FT                   /number=5
FT   intron          10312..13952
FT                   /number=5
FT   exon            13953..14058
FT                   /number=6
FT   intron          14059..15480
FT                   /number=6
FT   exon            15481..17291
FT                   /number=7
FT   intron          17292..19157
FT                   /number=7
FT   exon            19158..19338
FT                   /number=8
FT   intron          19339..20990
FT                   /number=8
FT   exon            20991..23468
FT                   /number=9
XX
SQ   Sequence 23989 BP; 6892 A; 4672 C; 5034 G; 7291 T; 100 other;
     ggatcctact aagaaaaacg ctttcaatga aatttgtttg gataaaagca ttccccagaa        60
     gcatggagtt gtaaatgtag caagatagga gtaataataa taataaggag aaagaaaata       120
     agaaagcctg gagacaaatt gaaacatgct gaattatttt attgcctaag tgaaacacaa       180
     gaagaaataa atagtacaag catagaaccg tagaatcatt caagttggaa gggaccccca       240
     aagaccatca ggtccaacgc cctgcagtga acagggatac ctacagctcc atcaggtgct       300
     cagagcccca tccagcctga ccttgagtgt ctccatggac agggcactga acacctctct       360
     gggcaccctg tgtcagtgcc tcaccaccct cactgtaaaa aactttttcc ctatatccag       420
     tctaaatctc ccctctttaa gtttgaaacc atctcccctc gtcctgtcac agcagaccct       480
     gctacagtct gttcccttct ttcttacagc cccctgtaga tactgacagg tttctctcag       540
     ctctccccgg agccttctct tctccagcgg cacagccgca gctctctcag cctgtccctg       600
     taggagaggt gtttcattct tcggtcattt ttgtggccct cctcgtgttg cactccaaca       660
     ggtccacatc tctcctgcag gtgaggtccg tcagcgcaga gcagaggggc aggatcacct       720
     ccctcggtca cgccgctagc aacgcagccc tcgacacgtc ggcttcctgg ggccccgccg       780
     ggccgcgggc agcaccgggc ggcaccgctc cccgctccgc tgtggtacct ggccgctccc       840
     ggcggagctc ccctccgtgc cgcgccgcga ctgcgcgact ccccgtccgc cctcggtccc       900
     gcccccggcg ccccccccgc gcccgtcccg cgccccccga cgccggaggg ccccgtccgg       960
     ccccgcgccc ggtacctggg gcagcgcctt ttcccccgcc gccgttcaaa cgcgctgccg      1020
     taaagcgccg gtctcccctg gcaacaaggt tccggccgag cactaggtgt aggaaggtga      1080
     tgtaaaagta aaaccaccca gtgtcgtaaa ccaggtccgg gggggagggg agggcgggcg      1140
     ggggagggcg ggggaggagg tgactggagc atttagacac aagcgagagg atcatggcgg      1200
     atggccccag gtgtaagcgc aggaagcagg cgaacccgag gcgcaacaac ggtcagtgag      1260
     cggcggggcg gcgggcggcg gggcgggccg gacggcgggc cggtcgggcc gccgggagcg      1320
     cgacgggggg gaggtgggga gaagtagaaa gtaatttccc cgccgctccc cgccggcagc      1380
     gggctcgccc cgcaccgtta tatccgctac ctggcgccct cctccgccta gcggtgccgc      1440
     ccggccggga ccgttaggcg ctgcctcccg cctgccctgc ccgcagcggg accgcggccc      1500
     cgggcagcgc cgcgccgcgc cgtgccgggc ggggagcgcc gagcgccggg ggagcgcccg      1560
     gccccggcag cgccaactcc gaacttggta cctgcgggac cccggcgcgg gggcgggatc      1620
     cnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1680
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nggatcctcg cagcgctggg      1740
     cctcagagtc aaagcgtgct ccctttctga ttagtttttc atcttccctg caaaacactt      1800
     taaacttaat ataaggagct ctacttaatt tcccaaacca aacagggaaa tttaaaaaaa      1860
     ataattcaag aattagttat ctttgtaact gaaatctgaa catttacctg tatatataac      1920
     atatatctgt atatatattg catgtgaatt ttgatctcta ctgttattta tctcctttgc      1980
     ctgtagcaaa agtctgtgtg tcagggtttt ctagtcacag tcctccacat gtaagcgtca      2040
     ctgccaacgg gacaaaagga tttttccatg tcctccttgt atttcttgtc tgttcttgac      2100
     ctttttaaaa cttgcattta cacttttcat gcatggaaat tcataaatct cttctgctgt      2160
     ggtgagggtg tctatgcatg tcttaccttt cacctacgtt acctcagtac ctttttactt      2220
     tgcagaatcc gttacagaat attaagtgag aatcaatttc ttgatagaaa tgggtcaaat      2280
     acgagtattt aggcaatttt atctagattt gttaccttgg aatagcttga taccatgaat      2340
     tagggtgcat agtacatttt tcaaataatg ctacatgtgt aaaatatgga aacatgatta      2400
     ttttagattc aaaaggctct tttgtcatgc ttatgcatat ttgagaaggg aaaattggcc      2460
     cccaaaaggg gaagaaaaga aaaaaccgcc tggccaatca aaaagccaac caactttccc      2520
     tgcttaaatg cgtttttaaa tgactagagt atctttgaaa aaagaaggaa gaaagaacaa      2580
     ctaacttcag aagagctgga gttgaatctc ctatttatct gcattaataa gccgggttca      2640
     cttgagacga ccagtctatc ttgtggtgtg ctggcagtgc cagtaggcag gggttgcaga      2700
     gtctgcggct gtgtgcatct cagctgtggt tctgcaacca ccaaagggct cccgcagcca      2760
     gggagctctt ttgatttggt cgttggtaac tataatgacc tggtgcagcc tcatgctggg      2820
     ccgcatgtgc tgcaggtgcc ttctcctgtg ccgccattat gtccaggttg ctctcaagct      2880
     gctgctgtcc acatagggaa aaaaaaatta atgatgtgac tccatagaga tgccctagat      2940
     gtagcttctg gctacagcac tgaaggcttc ggagtttgca gtaaattaag agtgtattga      3000
     tcagtatttc gctttttgtc tgtccacagt caccaattac aataacgtga tagaagcaaa      3060
     ctcagattca gatgacgaag ataaattgca tatagtggaa gaagaaagta taactgatgc      3120
     agcagactgc gatgcaagtg tgccagaaga tgacttgcca acagaccaca ccgtgttacc      3180
     agaaaacagt gagagggaag ggagcacaaa cagctgctgg gaagatgaag gtacgttcgt      3240
     tttcactgat ggtgctctgt aatgtttctg agaagactgg atagaatttt ttggttactt      3300
     tgttactgaa atgattagaa gtgataaaca tgtaattatt gtgctatact ttattttctt      3360
     aataaatgga aatcttcttc tcaaacgtgc cattttaatt aagatttgtt gactaaaatg      3420
     aagcatttga atcaaactct actgtaattg tgtagtgaga atgagattct ctctgccttg      3480
     gtcattggtt actcagccag gcttccatca gacagatgac tgtcttagag gcttactgaa      3540
     attactgtaa atttcttatg taaaaatgac gagttctgaa gccccttttg tagcagccag      3600
     gaggattttt tttatctgat agtaaggttt tttaaaatag attgtttgaa cctctggcaa      3660
     aagctgcgtg agaaaaatga aggctaaatt atgtttcatg gagctttgat ttgccatggt      3720
     aaaactctat ttactttttt atggctttca ttgaaagaaa ggtgcaagct gaaaatcaca      3780
     tcatcagtcc tggttgtaca ttagaaatcc taagagtaga gtattgaata cgtgatcttc      3840
     atctcaaagg gagcagtgct ggggtagtgt cagtgctgtg ctgacactgt cactgagagt      3900
     ggcaattgtc tttagagaac atgcagtttc agtaagttgt tttttatcac tggattagta      3960
     ctgaaagtcc ctacttgtag ttggacttgg cagaatgggt tttctacaca tttcttcggt      4020
     tcgcaaaagc acgagaatag gaacacacgt aacatctctt gatcagatta gtttccttcc      4080
     gtttccagtc attctaactg aacttctaca agaccttcag aacaggtggt ttaaatataa      4140
     ggtgtgtatc tccagaggtt taactgaagc agtcacgccg gtttgaagaa gtgaaccacg      4200
     tgtatccggc accagctgct ggcggggtgc cagcattcgt gtgtgcagtg atgctgtgat      4260
     gtgagctttt tttgctgtag gttagactaa accctctgct acaattaaga aaggaaatgt      4320
     caaaccccat tgactcgtta tgttaataaa cttgaaaaaa atactagtta tgtatttgag      4380
     tatttaggga atctggagat ctcaggcctg gaactaagct aggtttgaaa aattaacagt      4440
     taaaaaaaaa tgtgccaaca gtgaaataaa ctttcagaac caatgaaatt atgtttacgt      4500
     gtaaggtcct tctggaattc aaaatacctt taacatataa catgttaggt tgagcttacg      4560
     tacagtagga ttgtgttctc tcagtgtgat gggttgctag tgaaggatgc tgcactattt      4620
     tgtattaatt acatttgagg ggaggttaaa tgttcatggc atcaacttga ccaagttttc      4680
     tgcttacaac caaattttca gtttttctag tgagttatct tatccatctc cggatcctta      4740
     cagtcagctt gtgacatcgt ggtagtgtca tgtatggtgg aaattagcag catttagctc      4800
     tgaaagtccc ctgtatccct gagcagcagt tcaggagaaa tgatcggatg ctgcacagaa      4860
     cagagccaag tagtgctgcc atgctgaggt gtctatggca gggccaagca gagctcagtg      4920
     gccttaaaga agccattttt cacttggttg tggtttctga gtggctgact agatctaatt      4980
     cgatggctct accgggtgct gtagagatgc ataagagtgt ggctgtgtgt ccgtattccc      5040
     acccagtgca aggaacttcg tcagtccttc tgctgcttgc cagcagtaga atggaacttg      5100
     ctagagacac tataatttaa gcccctatag gtaataactt acagatagta gctctgttcc      5160
     tcatagtcta tttcataatg gggaaaaatc acaaactttt ttaggaagaa aaatagtgta      5220
     gttggtatca taaatatttt taagaaatcg aaattttgga tttgaatttt cattgcctgc      5280
     cacgactgcc atacatattc tgaacaaagc ctgtggtaca ggagccaaaa atacaattac      5340
     ttcacagtca gttattgact aatgtttttt gtactgtgga gagttttttt ttcagatgct      5400
     aattcaaatc aatgaaagat ttatgtctta cagtttcctt tttgcctttt ttgtttgttt      5460
     gtgactatct gcagatagag cttcccctcc tttccctcgt aagtctggtg ggttttgtaa      5520
     aggcagacca aactaagagt cttttccttt aaggaagcca tttgtatctg ggaaatcaag      5580
     cttgacctag gatttctcat ctcacatata aaggaggaat tggcttttcc tatatctaaa      5640
     tctggttcgt tctgcggttc tgactgagca tgccaaaaat ttttccctgc actgaattag      5700
     agtgaagtaa tgtaaataaa aatataacag ttggcatctt ggatcctgcc agtcatgcat      5760
     tctagcatct aaaatcacgt aagagtcttt ctttgctcta taggctctga agcacgtacc      5820
     atctccaaaa taaagctatg actattggct gctactgact gctatgctgt ttgcatacag      5880
     caacatagtg tactaacaga taaaggagtg aaaaaaatgg taccgtttca ctgtatgctc      5940
     caaagccttt ctatgtttct ctgaagaaag ggaaagtagc gtgcagcttt gcagacatga      6000
     cctgcaaatc atcaactgtt tccaaaaact gctaaatgaa ataatgaagt aaatttaata      6060
     tttttctgat actctgtttt tggaaaatga tgttcagtgt atcagttagc ttcatttaaa      6120
     tagctcattc catatttgct ggagaaacac actgtcctag tctttacctg tcttcacctg      6180
     tcttcaaatg ctgccctaat gtctactgtg tagtgtggct tcctttgaaa atttaatttc      6240
     tttcactgta aaatatctct gtggttcaac caattatgct ggagaaatgt ggaatccata      6300
     ttttttaaag taggttgtcc tttaatgcaa ttagagaagt ggaaaaaaaa tgctgtagaa      6360
     atagctcctc aaatacatta cacttgtggg tatgtggttc tgttgtgttt tgttgttgtt      6420
     gttgttattg tttgagggtg ttggtttggg gctttatttt ttttattttt tattttttgg      6480
     aatatttgtt gttctttttc tgaaatgtaa tatttcagca ggaaaagaaa caaaggaaat      6540
     cctggggcct gaagctcagt cagatgaagt tggatgtaca ggtatttgtt tgtttatctg      6600
     tttcccttat tcttatagct tgtctgccac agcttcagca atgagaacaa aaggggacat      6660
     aacactggtc ttattgggag aatacaacta caggccagta ggtagtgttt taaactagta      6720
     aggaatacac caaaacaaat gtaagctggt acttatcttc ttttccactc ctctacttgt      6780
     actgattata cagaaagcca aatgaaatgt ggaacttcag tatcagaatc aaaccaggac      6840
     agacttttcc agatgtagga agcaagatgt taagctgtct ttcaaactaa aaggcctaaa      6900
     tgatgatacg tgctgtattt aagaatttta ggggagataa acataaggtg caaaatgcat      6960
     tgggttaaac aatgcatttt tgcaaattct gcaaagaatg caaactgtgc ttttagtcat      7020
     ttttttaatt gtcattatgt cactgtttct ctgtgttaaa actctgtatg ttcctatacc      7080
     ttaaggagct taacctatgc tagtatttgt aaggagctgt gaaatccttg gacagaggtt      7140
     gatttggaaa tgtgagttac tgatctcttt tccttttttt ttttaagttt tcatttgaca      7200
     tcttgtatgt tggttttttg ctcttagtaa aagaagatga atgtgattct gatgcagaaa      7260
     atgaacagaa ccatgaccct aatgttgaag aattccttca acaagaagat acagctgtta      7320
     tttaccctga agcacctgag gaggaccaga gacaaggcac accagaagct agtggtcagg      7380
     atgaaaatgg taaatatgcc accagttagt tcgtacaaaa taaattatgt taagcacttg      7440
     atcccagagt tctgttgtgc tttgaaagac aacaacacat gatacttgat tttgtgaagc      7500
     aagacatgca ctgggagtca gttgtatggg tacctaaatg gtagttggaa gtaaaatcaa      7560
     tctctggtaa atacattggg gttattttcc caaaaagaca atgacagaga aaattgaaat      7620
     attacttaca caaaaatatt catatgattc ttaatggaag cccactgaga aatactgcct      7680
     ttccagtaga ctttgaaaat attgtttcat actggaataa gaaagttttt atttgattat      7740
     gacttgtttt tattcttagg taattctctg tgaaacactg agttgaaaat aacaccctac      7800
     ctaaatggtt tggagatgtt ctgatccagt tgtttattta aaaagtccat atttgaacaa      7860
     aaggtgtcgt tgtggctgta ttagtttact ggagtctaag ggagagcagt gaaaggggtg      7920
     ctgctgacaa attcgtcccg ctctctcaga gatcttctgt tattagacat tttagtaata      7980
     aaaaagaata tatttaagaa atgtgaactg agtacctgcc tatatatttc ataaatagga      8040
     catgagtttc caagattttg tgatttacct cacgtttagt aaaattcaac taagatatat      8100
     tcttaacagt agcattttga agttttttaa aattttaatc tgtagttgca gtggcacagc      8160
     ttgtcacgtt agttttacag acttgcaatg atttccatgt aatcattaaa aatacactta      8220
     agcattaata attgaaattg tacctaactc cgtaggttca gatggaagtg ctctgaaagt      8280
     cacaatgctg aacaatgatg ctcagtgttt gaattatttg gaatagaaaa tgccagaaat      8340
     gtagtgatat ttggtaaaga tggattcctc caaagcaggg gagggacaag tgaggtgaca      8400
     gagcatcaga gtatttagca ctgggctttg tgaaacctct gctatttcgg catttgctcc      8460
     aatggaaaca gaatttaggt tgtgcttgtg acatttccac tgacttgtgt ttgtgctgaa      8520
     atctgtgtcc ttgtgctgaa atttagtgtc gtatgaattg aattgtagat gtaaaaaatg      8580
     aacggaatgg aagcatgctg tatccacaca tgagcatgtg ttcattttac ttagtcatgg      8640
     agaaacagaa actgaactgg ttagaacagc ccaaaaacag tgaagtatga ctgttatcag      8700
     cttgttccca taagaagggg aaaagatccc gtgtgacaga aaagttctta tttctatgtg      8760
     ataaagaaaa ctggtctgac tcttcactgt tgcgaaagca atggcatgtt cagtgaaaat      8820
     ggcaggaaat cccacacaaa tagggattgc tactgtatgg agcacatacg caatctgtgg      8880
     caataactgc tggaagatgt catgaagata gataagtcag aagtacttca ggaactaccg      8940
     gttaatttta tcagtattaa taattgctga tagttcagca acatcaagtg acaatctgta      9000
     ccccagtttg cacctcacga ttcaaatcat aaagtaataa tctgtgcaga tgttccactt      9060
     tcctctcgta ctgtcactca gtccaatgga tagatgcttt gatgcaaaat ctgctttcca      9120
     tttcccttga atcgtggtca ttgaacgtta ccagaccttg taaacaggta gtgtgatcca      9180
     gtactgcgaa ccctgcattt ctggaagcac tttttccatt aatctgtaaa gtaagatgtt      9240
     ttttcaatct cagaaaaaaa tcttttctag catagaataa gttactatat gtgggggata      9300
     acaaaatgct gataagaaaa aatggagtta aagcttcata aatgatggct tctcagaaat      9360
     attcctgtca aattaatatc cagcttcaat ctgatttcac tttttgctgg tacagaaata      9420
     acttcacaga agccaataga ataaatccca tagattgtat tagaatcgta tttatggcat      9480
     cacattggat atctcttctt tctgtctctc atctgcttct cctgcatata gtatgtccta      9540
     catagttaag cataactata aagaatatca gctgtgtttc tgttctcctt tctcttacaa      9600
     ttttgtgtta agagacaaga aaatcattct ctgcaaccta aaaatattgc tcattcctca      9660
     ggatctggaa atagggtgac cattaagtgt cgcagtgcta gacttgtttt gtgaacgtga      9720
     tttcagggtt gctagtgtta gggctaacca ggcctacaga gattgctagg tctaaaacca      9780
     tgtgttacag tggtcagagt actttctcat cagagacacg tgcagaggct ctggtgctgt      9840
     gtggggacag aggtgtggtt ctggggaatg tcactgctga catcctgcag cacacgctgg      9900
     gacagctgca ccctaccgca gtcagtaaca taatacccga agaaagagta cgaacagtca      9960
     ttgttccttt tctaaaccag atggagcttt ccagcagctg cacgttttct tacagccata     10020
     tgtatgaatg tagaccatgt ctgtcagtgt tggttgagtt cagagtttac atctcatttc     10080
     aatacaccat gttgtgtctc ctgtgcagga acgcccgatg cattttccca gctgctcacc     10140
     tgcccgtact gtgacagagg gtacaaacgc ttcacctctc tgaaggaaca cattaaatac     10200
     cgccatgaaa agaacgagga taacttcagt tgctccctct gcagttacac gtttgcgtat     10260
     agaacacagc tggaccgcca catgacgtcg cacaagtcgg gacgagatca ggtcagtggc     10320
     agttggctgc aggccctgct gtcctctaca gcagcatctg gtgtgtgagc agagacctac     10380
     agagcatgct ggacgtttgt ctcagagctt tgtgggctga agtaccaatc ctggagcact     10440
     tcaacctgct gctgaagtca gagttcttcc gtagctaaca aagggtgtga tctgagttgc     10500
     tgtacttcct tcatctaggc agtacggttg ggtctgaatt ttagtttcag aagtgcaaaa     10560
     gatattctga gcttgtttcc tgtggttctt ttgttgacct gagggcatgg ttccttaaaa     10620
     tgcccatgag gagttaacca ccccattatt gctgaggtgc ctgaggttcc cctctccctg     10680
     cttttctatt tttcttttat ccctaggatt tcccatcacc caaccccaat tacatgcttt     10740
     catagcttac cagaggtgct gaagctcagt aagcccagtg aagctcaccg aaacagtcag     10800
     gaattagcca agaaaacaga tacagatttt tgaccaccag gttagagaga ggcttggaaa     10860
     ctctcccttc tgagggcaga ctacaaagat tgatactcat tggagctgaa agaggaggga     10920
     aacattgcag aaatacacaa agccagaata gtgaagagaa tatatttctt acagctccaa     10980
     aacaacagta tttcgttaaa ctgaaaagct ctgacgtaaa attaaccaaa aaaggagatg     11040
     atcttttaca tactgcatat taattattgt tcttcaaatt atcactaatt cgaaggattt     11100
     atcagggtta aaagtgcact gtccttcatc cccaagtgaa tactttcagg gaacattaca     11160
     agaagtatag gcagtcctgt ccaagggttc tgttgttctg cagggcttgg aataacctca     11220
     ccagcatgtt ctggcacagt ggctctgatt tattcccaac aaacaattca tttctgcctt     11280
     gtgctcttac tgccttggct tccactttaa aggtgctatc atcccatata cagctgatat     11340
     caatgcctat aaaatctgtg catgcttttt gtaaaatcta gttgtgtgaa aatttccact     11400
     ttttccaact agaaacctaa aagcagaaga aaagagtagt tggaaggact tcccattttt     11460
     gctgctagtt gtaatgaaaa gagaaaaaat gatcaggtga acagccagcc ttagaagaat     11520
     gggtagaaag ggaaacttag attgtatcgc tgaaggaaaa gtttcagata tattttaata     11580
     agcttatact tttgaaggca catggctgca tgcgccaagc aggaatgttg tttctttgaa     11640
     gtatctggaa ctcactatta caccagctta cctgtaattc tctagagcca tacccagagt     11700
     caaaacaata actgatcaga tgcttggtaa agttgaaatg ctgatttgtt tatgttactg     11760
     tcatgaaggt gtcatgtctt cagattgcct acctttttat atacatgatt tcatcatttc     11820
     tgcaatggaa aattgagttt tatctatggt aaagtgtaga cctcttggct gtgagtctta     11880
     aacagcaaca tcttcaaaac tgtttactgt ctttctcctt gttcataaag gacttaacct     11940
     gaaaatagat ggtttggata actttatgtt ggcttatgca tgtgacagtt ctgtatttgt     12000
     tctgcaaaag gaagcagtga gcaaagataa tttgcagtgt agcagaggcc atgtgagagg     12060
     tacacatagg ctgtgcttcc tctgagaagg tgccaacctg ccaggctttg ctgctgctct     12120
     gcttctggag atatacttac acaaatacat ttgctgtatt gccaatacaa gaaggatgga     12180
     ggtgctacct aaccaaaagc tcaaggcagc ctacagctgt aagcaggaaa cagaaaaact     12240
     cattaaaaat ttggtaagag aaaacgtgag tttccatgcc ttggaagtag aatgttgaat     12300
     tactaagact ggggcagaaa cttatttgac agattgcatc catgcagtaa ttgtgaagca     12360
     ttaggatgca gcgcggcatc cgcagtggct gtttgtgtgc tgagagcctt taacttgccg     12420
     aatgtcgagt caaacagcgg taactgattc tctacaggct taagagaatc ctgacacagc     12480
     tctgtgtact cagcggagtt ggatcagaga agtgcagcaa gtcagctgca gtctccaaag     12540
     catctccttc ccagtgctta aacagagccc caaagatgtg tggacgccat tggatcccag     12600
     cacaggccct ggcactgctg ggcggctcct ggacatcctc cttaccacag ctcacccaga     12660
     tggctgagtg cagcctgaaa gcagctgctg ctttttaaat aagcaactgc tttgaataga     12720
     taaaaactcc aattcctcta tctcatgtca taaataaaca tatttcctgt ttacaagagt     12780
     ggatagtgat aggacaaggg ggaatggtct taaattggga cgggggagat ttaggttgga     12840
     tatcaggtgg aagtttttca cacagagggt ggtgacgcac tggaacagcc caaggaggtt     12900
     gtggatgctc catcactgga gccattcaag gccaggctgg atgtggctct gggcagcctg     12960
     gtctggtggt cgacaacact gcacatagca ggggggttga aactagatca tcattgtggt     13020
     ccttttcaac ccaggccatt ctatgtcagt aaataagtag ctccaagttt taatgtgtga     13080
     gctatttttg tcataaaaag tgcacattaa tagattataa agtttgtaat aaaattatat     13140
     cttgcacgta tgtgtgtcac acataccatg cacatttaca catctttctt cacttctgct     13200
     tctttgaagc tagtacggtg ataatgctaa attaaatgtc attggcatta aaagtttaaa     13260
     gtacttgata ataagtgctc tcaaaaggtg aaatatgaca gaaataatta cagagcttca     13320
     gtgcaaacag tgaagaactg tgatgttgca tactgaggaa ctccatccat actgttattt     13380
     actgcaattg aggtttttat ttattttgag aattaatttt gactgatcac ctttgctgcc     13440
     actgagctgt cttctcttgt gcagtcttgt ggcactgtta tgtaaaggaa tcccaggcca     13500
     agtactgcag gcacgtaaat ggaaaagtca agtcaactga ttaaacttta aacaggcttt     13560
     tatacgcttt aatgtttctg tcttccatga catattctgt gattggtggg cttgggcttt     13620
     ttttggtttt tgctttcaca cattgaatct gtgtatatgt tggaacttac tcacacagtg     13680
     ggtcagagca agcttcacct gaagtcagga gaaggagtga atacttttga ttccctttca     13740
     ttgtaccaga tttattcaga agatgcacat gtttcggttt taacctgact tctaatttgt     13800
     ttcttttcca tgcataacac atgccaattt cagtctctta aaattgtgat tattttcagt     13860
     tttgtattac attttctctg ttaccgtgtg aaaatacagg cttttttccc agcatgctgt     13920
     ttgttgcaat aattgcaaat tctgtcttgc agagacatgt gacgcagtcc agtggtaatc     13980
     gaaaattcaa gtgcactgaa tgtggaaaag cttttaaata taaacatcat ctaaaggaac     14040
     acctacgaat ccacagtggt aaataaaaca agcgctgaat tatgtactaa tgctaccatt     14100
     tctactctgt ataactttga tgcaatgtca gtcttgtaag tgtaagctta aaatactagg     14160
     gctttccttt cgctttctct aagactcagt acctactgac tgcagccttc aactgtgcac     14220
     agaaaatatg taggataact caagaggatt tacatttgca acttgagctc tgatatttaa     14280
     ggaagcttca cacgtggcag aagaaatggg gcatctttct ggtctttctc gcttgtccgt     14340
     tttttctcag cgtttgcaga ccacttagct agttgtgagc cttgctagaa aactttaatt     14400
     gatagcaatc agggtatagc aactatactt ccttactgtg gctgctattt tccccagtac     14460
     atgatgataa aaatagcctc agagcacaaa tgtgagattg tcatacccat cccagtggct     14520
     tcaatttata aataattaac ttataatgtt atatatttat aaatactata taataataag     14580
     taagcctcaa tttctctgtt tgacccaatt ttactcacta gcagtaagtc tgaaaacaag     14640
     gtgttgggcc atcttttcct ttcttattgg ttgctcagcc atggtaatag caattaagtg     14700
     cacttagaag cccttcctca ggaaacctca tcttcatttc atttacacag agcagtggca     14760
     tctgctcctg tgcatgggaa ggcattagcc aacaggcttt tcagtccaac acaggttagc     14820
     tgttcttttt ccttcttttc tttcttcttc ctctgtaacc cagggcccct gaaaagtcac     14880
     ttctgtctgt ggctgtcatg attgcatcgt tgtatgcatc ttcccaacca ttcagcccgg     14940
     ggtacacctc tgaaggcaaa tgttcagctg ctttatgcat gtgtctagtt tccctcaact     15000
     cttcatttaa ttatgatttg catttatgcc acttatagtt cttctttggt taagcatatc     15060
     tatgtgttgt tttttttctg aagtggctta tgctgcttct gacattagta gtgctgttac     15120
     tggaatggag cttaatgaaa tcttcaagta ccacatagac tcatttatgt gatatgtagc     15180
     cagttactag aaagtactgg aatgtgtcat ggtcacatag gtgccattct gtgtgtactg     15240
     ttgggtcaca gtgagactta gcacaggacc ctgggatcgg agctatagat gatataattg     15300
     ctcttagtct tcggttcact gtaaaggact cttttcccta ggactctgag gggtaatttt     15360
     aatatattct tttctaatta ctattgtttg atgaagctac attgtaacct agcaaactat     15420
     tgcatatgtc ttttttcttt ctttttttct tcttttttgt tttctttttt taatctttag     15480
     gagagaagcc atatgagtgc ccaaactgca agaaacgttt ttcccattct ggttcataca     15540
     gctcacacat aagcagtaag aagtgtattg gtttgatgcc cgtgaatggt cgagctcggt     15600
     cagggctcaa gacgtctcag tgctcctccc cttccctttc tgcatcgccc ggtagcccag     15660
     caagaccaca gatacgacaa aagatagaaa ataaaccctt gcaagagcaa cttcctgtta     15720
     accaaattaa aactgaacct gtggattatg aattcaagcc catagtggtt gcttcaggaa     15780
     ttaattgttc gacccctttg cagaatgggg tttttagtgg tggtagcccg ttgcaggcaa     15840
     ccagttctcc tcagggtgtg gtgcaagctg ttgttctgcc aacagtgggt ctggtgtctc     15900
     ccataagcat caacttaagt gacattcaaa atgtacttaa agtggcagtg gatggtaatg     15960
     taataaggca agtattggaa aacaatcacg ctaatcttgc atccaaagaa caagaaacaa     16020
     tcagcaatgc atctatacaa caagctggcc attccctcat ttcagctatc agtcttcctt     16080
     tggttgacca agatgggaca accaaaatta tcatcaacta cagcttggag cagccaagtc     16140
     aacttcaggt tgttccccaa aatctaaaaa aagaacattc tgttcctaca aacagttgca     16200
     aaaatgaaaa gttaccagaa gatcttacgg tgaagtctga gaaagataaa aactttgaag     16260
     gagagaccaa cgatagcact tgtcttcttt gtgatgactg tccaggagat cttaatgcac     16320
     ttcaagaatt aaagcactat gaaacaaaaa atcctcctca gcttccccag tccagtggaa     16380
     cagaagctga gaagcccagc tcccctgccc catcagaaac tggggagaac aacttatctc     16440
     ctggtcagcc acccttaaag aaccttttat cgctcctaaa agcatattat gcattaaatg     16500
     cacaaccaag cgcagaagag ctttcaaaaa tcgccgattc cgtgaaccta ccactggatg     16560
     tggtaaaaaa gtggtttgaa aaaatgcaag ctggacaaat ttctgtgcag tcttctggac     16620
     catcttctcc tgaacaagtt aaaataagca gtcccacaga taacgatgat caagcagcaa     16680
     ctacaaatga gagtgaaccc cagaacagca caaacaactc acaaaatccg gccaatacaa     16740
     gtaaatctca gacttcatca gggggatcaa ctcagaatgg ttcgcgcagt agcacgccat     16800
     ccccatcacc actaaacctt tcttcatcaa gaaattcaca gggttatacg tacacagcag     16860
     agggtgtaca agaagagcca caaatggaac ctcttgacct ttcactacca aagcaacatg     16920
     gagaactgtt ggaaagatct accataacta gtgtttacca gaacagtgtt tattctgtcc     16980
     aggaagaacc tttgaactta acttgtgcaa aaaaagaacc acaaaaggac aacagtatta     17040
     cagactctga tcctattgta aatgtaatcc caccaagtgc caatcccata aatattgcta     17100
     tacctacagt cactgcccag ttacctacaa ttgttgccat tgctgaccag aacagtgttc     17160
     catgcttgag agctcttgct gccaataagc aaaccatttt gattccccag gtggcttata     17220
     cgtactctac tacagttagt cctgcagttc aggaaacacc accaaaacag acccaagcca     17280
     acggaagtca ggtaccgaag cctttgtgtt cctgtgcttt gtatattatg tgttcatggt     17340
     gtatccttat taaagttaca taaaattgtc aaaataaatt aaataatatt tagggtgttg     17400
     aaatgctgga acaggctgtc cggagaggct atgcatgccc catctctgaa ggtgttgaag     17460
     gccagggtgg atggagacct gggcagcctg agctgctgcg taggaatcct gcctatggca     17520
     ggggggctgg aactgggtaa tctttaagat cccttctaac caagccattc tatgattctg     17580
     cgattctatg actctgagaa aatgtaagca caaactatcc tggacattat tcttgtttgt     17640
     taaggggtaa taaatgtcac cattaacacc tctgcaaagc tggtcagctc aaacaatgta     17700
     ggtctagact gacagcagca atctagttct gtgcatggac aagttagttc ttcactaaat     17760
     tctaccattc aaaagggttt tctagaacat agtactcaat attttgagga cagcttagtt     17820
     ctccggatga aaaaccagtg tgaagtccta gtgtatattt gttggtggct ccttatctcc     17880
     tctttctcaa catccagaaa atgaactgct tgtaaattct tgatactctc ttcactctgc     17940
     tgtgctttct tagcttgcag agtagcataa tttgtcctac accgtaatgg cactttaaac     18000
     aaaattcaga agtattttca attggaacta gggtgggtat tcaccatact ttgttcctgt     18060
     accctgttct gttcctttct gagtccttcc agacatgacc taaccacact cagtcctgct     18120
     gagcattacc tatgcacatg gaggcaggga cactgcagaa cagaagtgga tcacataaag     18180
     acttagcgtt tctaattaaa tcttaaaaat tgttcacgat tttatgcagg cttctctata     18240
     gccagaaact gaagaacctt gaagatttat gagattgctt gtatgttaaa gtttatgaga     18300
     cagacaaaat ttcaggtagc taatacatac gtttttatgt tcaggcttga taatgtatga     18360
     caaaattaat tctgatacct ctaatgtcag tggaaattac tatgctactt agcattaagc     18420
     ttcgtcactt gaaatgctca gaaatagact acagttacaa aacatggaaa agtttttatt     18480
     aatgaaatgt ttggaatccc cagattttgg tttaactagg attctggtac atttgtgagg     18540
     aggaggatgg tcaattatgt aaatgtgaac catgagtagc ttttgtgatg acctggtcta     18600
     aaaaatcttc cattagattg tgaagtagcg aaacgtgggt gacaagcatt cattcagaaa     18660
     cgcatttagt tatctaatag actctttttt tacttctaac actggttaag atactttaca     18720
     actgcacaac cttattttcc ttcctaacat tacacttatt ttaagggtct taaaacacgg     18780
     tatgccaatg tagcttagct ctgaccagca gtcatatttt tagatgtggt actaagggac     18840
     gtggtttagt tgggaaagac tggtggtagg tggatggttg gaccggatga tcttggaggc     18900
     tttttccaac cttggtgatt ctgtgaatat gattacagtc ggtcccactg gggattgggc     18960
     atctatatga tggtggggtc tacagagcag ataggtgcag tgaaagattt tgttgactgt     19020
     gtaagtttaa acaattttgt ttgtccattt actgaatgga atgaaataac tgtgcagctt     19080
     cagcttatgt tttataaatt gtgtgctgca tcagtgcatt ttttcttgaa cccaaccttt     19140
     ttgtgctttt tcttaaggac gaaaggcagg acactagctc agaaggagta tcgaatgtag     19200
     aagatcaaaa tgattctgat tcaacacccc caaagaaaaa gatgagaaag acagaaaatg     19260
     ggatgtatgc atgtgatttg tgtgacaaaa tattccagaa gagcagctca ttattgagac     19320
     ataagtatga acacacaggt atgtactagg aaatgcagtt tcagatcttt gttttgttga     19380
     tactgagtaa ctgataagct caactgaaat tcagttctca gaacacactg taagaacagg     19440
     gggaagtata gtagtcctta ttatgatccg tgcccagcct tgcttagaac ccgtgcttta     19500
     tatacttgtt tgacagaact gcaattccgt gtttaaattt gtaagatcta aaccctgaat     19560
     aaaatactgg gattttcttc catctggctc atggacagtc atctgtgtgc tacagtatgc     19620
     aattaaggat gtattatttc tgatttatct tgcctggttt taaataagaa aagttataaa     19680
     ttataaaaaa ggactatgtg tatgtatgat actttaccat gaaagccagt gtacctgcat     19740
     gaaggattct ccagttgagc caaacttgta gttatctgaa cttactaaac attcgttggg     19800
     cacggaatct aatctcaaag gaatatcatt ttggctttgg tttttatttc taatttttca     19860
     taattgttct ttttagttcc agttctggta tcttcagcct tcttttgaat gagtgttgct     19920
     ctcttatttc ttcagcgatc tcttcaaaaa ggcccctgct gcttaattaa ttgcctacat     19980
     tatgtttctg catatcaatg tttttattta attttactta aatatacagc cgaaaacata     20040
     aaaggctccc ctttgtcttc accatttgtt taaacctctc gacttgtgtt cattaagaat     20100
     atcttctatt ttcatacctt cccactctga gactctctaa tcctcctttt cataacacag     20160
     ttgtgctttc cattctgctc ttaaatgaag tgcagtgttc agaaatgctg cttgtttgcc     20220
     atggtgtgac gtggagcaca accagtgagc cgctgtccca ttgtctgggt cttttatgtc     20280
     tgggcggaaa ctctatgttt gttttgccta acaacttgga gtgttggaat caagataacg     20340
     tatctgggtc catgctatct ttataagagt ctctaaacac agcagtggga aggaagtagt     20400
     aaagaggtga gtagaaagct ggaaaaaaga gcaggaagaa aagtagatga aacaaagtgg     20460
     atttttccag ttgatatacg tgtagtcagc aagtttggta cataaggcac ctgtcccagg     20520
     caagattttg gaatgatttg ccttttacct ttgacatgat acaagggctt gtgcatgaaa     20580
     gcgaacgtga agctcattga tcttaaattt ccatcaggat agaagagctg aaatggtttt     20640
     gagtttcagt aacttttatt gcaagaaaaa tgcctccttt tctaatctat ttatattcac     20700
     acttgttttg tgctctgagt tgcatctgag aatctattta tctcttgatg ttcatttttc     20760
     ctaagaaggt tacaaatacc tttgtagttt agcaccgtgc ccttgtattc ctatgcaaga     20820
     aacccaggct gacaatgctg agagcaaact gttaaataca attacttgtt gttggcaata     20880
     cattcaccaa cagcatatta ttatgaaagc agcagcacag agtttaaaat attacattta     20940
     aggaatcctt tttttttgtt tgtttgtttg tttttgtgct tattttctag gtaaaagacc     21000
     tcatgagtgt ggaatctgta aaaaagcctt caaacacaaa caccatttga tcgaacacat     21060
     gcgactgcat tctggggaga aaccctacca atgtgacaaa tgcgggaagc gcttctcaca     21120
     ctcggggtcg tactctcagc acatgaatca tcgctactcc tattgcaaaa gagaggcaga     21180
     ggagcgtgac agcacagagc aggaggaggt gggacaggag gtgctcagca gcgagcatgc     21240
     tggtgccagg gcatcgccat cgcagatcga ctccgatgag agagagagtc taaccaggga     21300
     agaagaggaa gatagtgaaa aagaggaaga ggaggaggaa gaaaaggacg tagaaggact     21360
     tcaggaagaa aaagaatgta gaaaactaca agatgtagag gaggaagaag aagtagaaga     21420
     agaagaagaa gaagaggaag ggaaaactga aggtaacaag aacgatgacg ttgtaaatcg     21480
     agcaagcaat gcagaaccag aagttataca gagcaatggg caggtgtcag aagaaaaaac     21540
     aaataaagct taaatgatag ttttttctat atggaaaaaa ataaatcagt aatgaagatc     21600
     gttctatatt atacatgctt ttcatggaaa cacggtagcc tgcatactgt gatttctgtt     21660
     cactactgtg taaaaaaata tatatataaa aaaaaagaaa aaagaaaaaa aaaagaaatc     21720
     caggtgtgcc tgaacctcaa acttagtaat ttttcacaca gttttcaaag ttaggaacaa     21780
     gtttgtaaca tgaagcagat tagaaaaata cagtgactct ggaagcaaag gtttaacagg     21840
     ttgtaggaaa cctgatttat tagacaagca tctggcattg tttgttttat cagtattaat     21900
     tctcattctt acgttcatta atttttaagc tgtacaattg ggagagattt atatgatttt     21960
     tttttttttt atggcaaaac atttcctaaa tccgcttcag tattttatta tgtttttaaa     22020
     atgtgagaac ttctgcacta cagaattccc ttctgcagaa acctctaaca gtgcttggct     22080
     acctttgtaa attcaaccta gaaggtagcg gttataacat tagatgttgt agtagagcat     22140
     attatcattt aaagtgtatt gttagcctta agaaagcaga tgatagaaga actgaagttt     22200
     cttactcatg tggttaaaaa tgtagttgaa aagattgttg ttgagttctg attgcaggga     22260
     ctaacagtgt taataccggt aaggacagca aagtcgtcaa aatcagtgtt tgtaattgtg     22320
     ttttgagtat gtagtaacaa tatgaaggat atgatatgaa gctttgtatc tcctttggcc     22380
     ttatgcaaga cctgtgtgct gtaagtgcca tttatcagta ttacaaaggc tctcaccggc     22440
     ctttctccaa tgcgtggcct acaataacta gcatttgttg atttgtatca aacttctaat     22500
     ctaatcatgg gggaaaaaac actcagccat cagagaagta agaacactgg tatctttcat     22560
     tatttaatta tttggtggta tttttggtta atacctgact tgcagaattt ctctacgata     22620
     attacaaggg aaattttcta atctgcttta ttgctttatc agtttacttt aatttcagac     22680
     acatacatga catgttatct ggctcataag tattttcaaa tgttagttat tatggacccc     22740
     atttattaac aatgttagct gatttttacc tatcagtatt attttatttc ttttagttta     22800
     tagatctgtg caacattttg tactgtatgt ctccaaacct ggcagtatta atacccttct     22860
     tactgacata tgtacctttt tagttttaga aaacttttat atttatgtgt cttattttta     22920
     tatttcttta tttattacac agtgtagtgt ataatactgt agtttgtatt aatacaataa     22980
     tatattttag tatgaaaatt tggaaagttg ataagattta aagtagagat gcaatcggtt     23040
     ctcttgcatt gagatttgat ttaacagtgt tatgttaaca tttatacttg ccttggactg     23100
     tagaacagat gaattaaaat gggaatgtat taattttaca attgcaatca attcatttta     23160
     cctttaccca gtttttaata taaagctctt aaattttgaa attcactgtg tgactaatag     23220
     catgatgctc tgcagtttta ttaagagatt agcctaacca taaaactctc atttccttag     23280
     taagccaaat tagagtaatc ttataaacag tgttgggaac aacgtttaac ttttttgtgc     23340
     caatttgttc ctgtattcat gtatgtatgt tacaaatctg aaacttcatt tttaagttcc     23400
     ttgttacatc atggtcattt tctagttttt taccagactc cccatctcac aataaaatac     23460
     gtcaacaagt ctgacttatg tcattattcc agtaacttca tgtgactgct gtcagttatc     23520
     cctaccccgt cagtgggacg tgggctgttt ccacacggct gctcagtttc ggttgtctgc     23580
     aaggagcgtg gaaggaaggg aatgttggac gctgtgcaag gcaagggact gctgcattac     23640
     gttgtccact cctcaaactg aagtagaaaa aaacaagttt ctgacacgag ccatacgctt     23700
     ctgtgatttt tttccctcct tagtctgtac aatacacgtt ttattgcttt atttaaacaa     23760
     ggctgctttg aaatgaggta ggcctgtggc tgttttctcg acgtagcaat aaggcagtga     23820
     aaaggttact tctgtgtatc gctgctgagt tctccgaagg tacggcacca gcattacaga     23880
     agtggcttct gtcacctgag tgtgaaggtt tgaacgttgc actaaatctt catttgtaca     23940
     gcattttcca gtcgtagcaa tgttgagaga gtgctattta agcgaattc                 23989
//

If you have problems or comments...

PBIL Back to PBIL home page