(data stored in SCRATCH zone)

EMBL: D83717

ID   D83717; SV 1; linear; genomic DNA; STD; PRO; 4932 BP.
XX
AC   D83717;
XX
DT   03-OCT-1997 (Rel. 52, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Bacillus subtilis DNA for DnaJ, YqeT, YqeU, YqeV, YqeW, YqeX, YqeY,
DE   complete and partial cds.
XX
KW   DnaJ; YqeT; YqeU; YqeV; YqeW; YqeX; YqeY.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-4932
RA   Kobayashi Y.;
RT   ;
RL   Submitted (27-FEB-1996) to the INSDC.
RL   Yasuo Kobayashi, Tokyo University of Agriculture and Technology, Applied
RL   Biological Science; 3-5-8 Saiwai-cho, Fuchu, Tokyo 183, Japan
RL   (E-mail:ykobayas@cc.tuat.ac.jp, Tel:0423-67-5706, Fax:0423-67-5715)
XX
RN   [2]
RP   1-4932
RA   Masuda S., Kobayashi Y.;
RT   "Genes of downstream of dnaJ (yqeT, yqeU, yqeV, yqeW, and yqeX)";
RL   Unpublished.
XX
RN   [3]
RX   PUBMED; 9023197.
RA   Homuth G., Masuda S., Mogk A., Kobayashi Y., Schumann W.;
RT   "The dnaK operon of Bacillus subtilis is heptacistronic";
RL   J. Bacteriol. 179(4):1153-1164(1997).
XX
DR   MD5; c69bd499cbe164797f33214776067da5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4932
FT                   /organism="Bacillus subtilis"
FT                   /strain="JH642 (trpC2 pheA1)"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        <1..351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="DnaJ"
FT                   /note="C-terminal of dnaJ"
FT                   /db_xref="GOA:P17631"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17631"
FT                   /protein_id="BAA12077.1"
FT                   /translation="HEFFERDGDDIYCEMPLTFAQAALGDEVEVPTLHGKVKIPAGTQT
FT                   GTKFRLRGKGVQNVRGYGQGDQHIVVRVVTPTNLTDKQKDIIREFAEVSGNLPDEQEMS
FT                   FFDKVKRAFKGD"
FT   regulatory      362..366
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        376..1311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="YqeT"
FT                   /note="Similar to ribosomal protein L11 methyltransferase
FT                   (PrmA) of E. coli"
FT                   /db_xref="GOA:P54460"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54460"
FT                   /protein_id="BAA12078.1"
FT                   /translation="MKWSELSIHTTHEAVEPISNILHEAGASGVVIEDPLDLIKERENV
FT                   YGEIYQLDPNDYPDEGVIVKAYLPVNSFLGETVDGIKETINNLLLYNIDLGRNHITISE
FT                   VNEEEWATAWKKYYHPVKISEKFTIVPTWEEYTPVHTDELIIEMDPGMAFGTGTHPTTV
FT                   LCIQAHERFVQKGDKVIDVGTGSGILSIAAAMLEAESVHAYDLDPVAVESARLNLKLNK
FT                   VSDIAQVKQNNLLDGIEGEHDVIVANILAEVILRFTSQAYRLLKEGGHFITSGIIGHKK
FT                   QVVKEALEQAGFTIVEILSMEDWVSIIAKK"
FT   regulatory      1317..1324
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        1334..2104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="YqeU"
FT                   /note="Similar to 26.9 kDa protein (YggJ) of E. coli"
FT                   /db_xref="GOA:P54461"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="PDB:1VHK"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54461"
FT                   /protein_id="BAA12079.1"
FT                   /translation="MQRYFIELTKQQIEEAPTFSITGEEVHHIVNVMRMNEGDQIICCS
FT                   QDGFEAKCELQSVSKDKVSCLVIEWTNENRELPIKVYIASGLPKGDKLEWIIQKGTELG
FT                   AHAFIPFQAARSVVKLDDKKAKKKRERWTKIAKEAAEQSYRNEVPRVMDVHSFQQLLQR
FT                   MQDFDKCVVAYEESSKQGEISAFSAIVSSLPKGSSLLIVFGPEGGLTEAEVERLTEQDG
FT                   VTCGLGPRILRTETAPLYALSAISYQTELLRGDQ"
FT   regulatory      2089..2099
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        2104..3459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="YqeV"
FT                   /db_xref="GOA:P54462"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034557"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54462"
FT                   /protein_id="BAA12080.1"
FT                   /translation="MATVAFHTLGCKVNHYETEAIWQLFKEAGYERRDFEQTADVYVIN
FT                   TCTVTNTGDKKSRQVIRRAIRQNPDGVICVTGCYAQTSPAEIMAIPGVDIVVGTQDREK
FT                   MLGYIDQYREERQPINGVSNIMKARVYEELDVPAFTDRTRASLKIQEGCNNFCTFCIIP
FT                   WARGLLRSRDPEEVIKQAQQLVDAGYKEIVLTGIHTGGYGEDMKDYNFAKLLSELDTRV
FT                   EGVKRIRISSIEASQITDEVIEVLDRSDKIVNHLHIPIQSGSNTVLKRMRRKYTMEFFA
FT                   DRLNKLKKALPGLAVTSDVIVGFPGETEEEFMETYNFIKEHKFSELHVFPYSKRTGTPA
FT                   ARMEDQVDENVKNERVHRLIALSDQLAKEYASQYENEVLEIIPEEAFKETEEENMFVGY
FT                   TDNYMKVVFKGTEDMIGKIVKVKILKAGYPYNEGQFVRVVEDEITEHMRLSS"
FT   regulatory      3462..3498
FT                   /note="factor independent terminator"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(3496..4428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="YqeW"
FT                   /note="Similar to 59.6 kDa protein (YjbB) of E. coli"
FT                   /db_xref="GOA:P54463"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54463"
FT                   /protein_id="BAA12081.1"
FT                   /translation="MNRMLILISFTALILSFLAGMNMLRKGLISMAYSKIEERLLLFTD
FT                   HPLKAFLISIVFTGILQSSSAFMVIVIGFVSAGVLSFKRTIPMILGTNVGSTFTTEFIA
FT                   IKMDIVIWVLLIGGLLFFLTGRYPLKQLGTSFLGLGIIFFCISGFSHLAGPLTKLKTGA
FT                   DVLYHVNDSNWSALLIGMVLTAIIHSSSVCIGILMSFMNEGIIGLTQAMSVVLGSNIGT
FT                   CITAVMAAVSGGYAAKQTAYAHVVFNVLGVALVLPFLTAATGFVEQLSPDPAQKIAHFS
FT                   LLFNVVTALLFLPLTNLFYRLIHLLIPAK"
FT   regulatory      complement(4432..4440)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      4579..4583
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        4592..4765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="YqeX"
FT                   /note="Similar to 30S ribosomal protein S21 (RpsU) of B.
FT                   stearothermophilus"
FT                   /db_xref="GOA:P21478"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21478"
FT                   /protein_id="BAA12082.1"
FT                   /translation="MSKTVVRKNESLEDALRRFKRSVSKTGTLQEARKREFYEKPSVKR
FT                   KKKSEAARKRKF"
FT   regulatory      4764..4774
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        4780..>4932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="YqeY"
FT                   /note="N-terminal of YqeY"
FT                   /db_xref="GOA:P54464"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="PDB:1NG6"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54464"
FT                   /protein_id="BAA12083.1"
FT                   /translation="MSLLERLNQDMKLYMKNREKDKLTVVRMVKASLQNEAIKLKKDSL
FT                   TEDEEL"
XX
SQ   Sequence 4932 BP; 1576 A; 976 C; 1178 G; 1202 T; 0 other;
     cacgagttct tcgagcgtga cggcgatgat atttactgtg aaatgccgtt aacgtttgct        60
     caggctgctc ttggagatga ggtagaagtg ccgacgctgc atggaaaagt gaaaattccg       120
     gccggtacac aaacaggaac gaaattcaga ttaagaggca aaggcgttca aaatgtcaga       180
     ggctatggac agggtgacca gcatatcgtc gtccgcgtcg ttacgccgac aaatctgact       240
     gataaacaaa aagacattat ccgcgaattt gccgaagtca gcggaaacct gcctgacgaa       300
     caggaaatga gtttctttga caaggtaaaa cgcgcgttta aaggcgatta attattggat       360
     gaggagttgg tagttttgaa atggtccgaa ttaagcattc acacaacaca tgaagcggtc       420
     gaacctatct caaatatatt gcatgaagct ggtgcaagtg gggttgtgat agaggacccg       480
     cttgatttaa ttaaagaacg tgagaatgtg tacggggaaa tctaccagct cgaccccaat       540
     gattacccag atgagggtgt cattgtcaaa gcatatctgc cggttaacag ttttctgggc       600
     gaaactgtag acggcatcaa agaaacgatt aataatctcc ttctttacaa tattgatttg       660
     ggcagaaacc acatcactat ttctgaagta aatgaagaag agtgggcgac tgcctggaaa       720
     aagtattatc atcctgtgaa aatttctgaa aagtttacaa ttgtgccgac gtgggaggaa       780
     tatacgccgg tccatactga tgaactgatt attgaaatgg acccgggaat ggctttcggc       840
     acagggacac atccgacaac cgtactctgc attcaggcgc atgaacgctt tgtgcaaaag       900
     ggtgataagg tgattgatgt cggcactggt tcgggaattt taagtattgc ggctgcaatg       960
     cttgaggctg aatcggttca tgcctacgat cttgatcccg tggctgtaga aagtgcacgc      1020
     ctcaatctca agctgaacaa agtcagcgat attgctcaag tgaagcaaaa caatttgtta      1080
     gacgggattg aaggggaaca tgatgtcatt gtggccaaca ttttggctga agtcattctt      1140
     cgctttactt cacaagcgta caggctgtta aaagaaggcg gtcactttat tacgtcagga      1200
     atcatcggtc ataaaaaaca agtagtaaaa gaagcactgg aacaagctgg ctttaccatt      1260
     gtagaaatcc tttcaatgga agattgggtc agcattattg cgaaaaaata acagttagta      1320
     ggtgtcacag cgtatgcaac gatattttat cgagctcacg aagcagcaaa tagaggaagc      1380
     gccgactttt tcgattaccg gcgaagaagt tcatcatatt gtgaacgtga tgagaatgaa      1440
     tgagggagat cagattatct gctgctctca agacggcttc gaggcaaaat gtgaacttca      1500
     atctgtttcc aaagataaag tgtcctgcct tgtgatagaa tggacgaatg aaaacagaga      1560
     gcttccgata aaggtctata ttgcgagcgg ccttccgaaa ggagataagc ttgaatggat      1620
     tatccaaaag gggactgagc tcggagctca tgcctttatt cctttccaag ccgcgcgttc      1680
     tgttgtcaag ctggatgaca aaaaggcaaa gaaaaagcgg gaaagatgga cgaaaattgc      1740
     gaaggaagcg gctgagcaat cgtaccgtaa cgaagtgccg cgagtgatgg atgtccattc      1800
     ttttcagcag cttcttcaaa ggatgcagga tttcgataaa tgtgtcgttg catacgagga      1860
     gtcatcgaag caaggggaaa taagcgcatt cagcgcgatt gtaagcagcc ttccgaaagg      1920
     atcatctcta ttgatcgtat ttggtcccga aggcggttta acagaagcgg aggttgaacg      1980
     gctcacagag caagacggtg tgacgtgcgg ccttggaccg agaattttaa ggacagaaac      2040
     cgctccgcta tacgcgttga gtgcgatttc ttatcaaaca gagttattaa gaggtgatca      2100
     gtaatggcaa ctgttgcttt ccatacgctt ggctgtaaag tcaaccatta tgaaacagaa      2160
     gcaatctggc agcttttcaa agaagcgggc tatgaaagaa gagactttga acaaacagct      2220
     gatgtatatg tcattaatac atgtacggtt acaaatacgg gagataaaaa aagccgccaa      2280
     gtgatcagac gcgccattcg tcaaaatcct gacggtgtca tctgtgtcac aggctgctac      2340
     gcgcaaacct cacctgctga gattatggcg atccccggtg tcgacattgt agtcggaaca      2400
     caggaccgtg aaaaaatgct tggctacatt gaccaatacc gagaagaacg ccagccgatt      2460
     aatggcgtca gcaacatcat gaaagcaaga gtatatgaag agcttgatgt gcctgctttc      2520
     acggaccgca caagagcgtc attgaaaata caggagggct gcaataattt ctgcacattc      2580
     tgtatcattc cgtgggcgag aggcctgctc cgctcccgcg accctgaaga agtcattaaa      2640
     caagcgcagc agcttgtcga tgccggatat aaggaaattg ttcttacggg tattcataca      2700
     ggcggctacg gcgaagatat gaaagattac aacttcgcga agcttttgag cgaattagac      2760
     acccgtgtgg aaggcgtgaa acggatcaga atttcttcaa tcgaagccag ccaaatcact      2820
     gacgaagtga tcgaggtctt agaccgctca gataagatag tgaatcattt gcatattcct      2880
     atccaatccg gatcaaacac agtgcttaaa cggatgagac gcaaatatac aatggaattc      2940
     tttgcagacc gtttaaataa attgaaaaaa gcactgccag gcttagctgt tacttctgat      3000
     gtcatcgtcg ggttccctgg agaaacagaa gaagaattta tggaaaccta taactttatt      3060
     aaagaacata aattctctga gctgcatgtt ttcccttaca gtaagcgtac aggaacacca      3120
     gctgcacgaa tggaagacca agtggatgaa aacgtgaaaa acgaacgtgt gcaccgcctg      3180
     attgctcttt ctgaccagct tgcaaaagaa tacgcttctc agtatgaaaa tgaagtgctt      3240
     gagattatcc ctgaggaagc gtttaaggaa acagaagaag aaaatatgtt tgtcggttac      3300
     acagacaatt atatgaaggt tgttttcaaa ggtacggaag atatgatcgg caaaatcgta      3360
     aaagtcaaaa tcctaaaagc aggttatcct tacaacgaag gacagtttgt ccgtgtggtt      3420
     gaggatgaaa taactgaaca catgcgtttg tcttcttaac ctaaaaaatc ggtgcattaa      3480
     aatgtaccga tttttttatt tagccgggat aagaaggtga atcaatcggt aaaacaagtt      3540
     tgtaagcgga agaaataaaa gagctgtcac cacattaaat aaaaggctga aatgcgcgat      3600
     cttttgtgcg ggatcaggtg ataactgctc tacaaagccg gtcgctgcgg tcagaaaagg      3660
     caatactaga gccaccccta gcacgttaaa taccacatgg gcatatgctg tctgtttcgc      3720
     cgcatatccg ccggatacag cagccatgac agctgtaatg catgtcccga tatttgatcc      3780
     gagtacgacg ctcatcgcct gtgtcagtcc gataatccct tcattcataa aactcatcaa      3840
     aatgccgata cagacagaac tggagtgaat gatggcagtt aacaccatgc cgatgagcaa      3900
     agcggaccag tttgaatcgt taacatggta tagaacgtcg gcgcccgttt tcagctttgt      3960
     cagcggcccg gcaagatggc tgaatccgct gatgcaaaag aagatgatgc ccagtccaag      4020
     gaagcttgtt cccagctgtt tcaaaggata cctgccagtc agaaaaaaca ataaacctcc      4080
     tattaaaaga acccaaatca caatatccat tttgatagca ataaattcag ttgtaaaagt      4140
     agagccaaca tttgtcccca gaatcatcgg gatcgtccgc ttaaaagaaa gaacgcccgc      4200
     acttacaaag ccgatgacaa tgaccataaa ggctgagctg ctctgaagta tccccgtaaa      4260
     tacaatactg ataagaaacg cttttaacgg atggtctgta aataaaagca aacgttcttc      4320
     aatttttgag tacgccattg aaattaagcc ctttcgaagc atgttcatgc ctgcgagaaa      4380
     ggataatata agagcagtaa agctaatcag aattaacatc ctattcacca acccctttct      4440
     ttcattatat agacaggcag tcgcactcat gacggaaaag tgaactcact tagttgacct      4500
     gactgatggc ttatattata atgtcaaagt acatgtttat atgtgtaact taaaggtagt      4560
     cgattggtgt attcggaggg agggaaagag aatgtcaaaa acggtcgtta gaaaaaacga      4620
     atcgcttgaa gatgctcttc gtcgcttcaa acgcagtgta tcaaagacag gtactttgca      4680
     agaagcaaga aagcgtgaat tttatgaaaa acctagcgta aagcgcaaga aaaagtctga      4740
     agctgctaga aaacgcaaat tctaaaagag ggtggattta tgagtcttct tgagcgtctc      4800
     aaccaggata tgaagctgta tatgaaaaac cgtgagaaag acaaactgac tgtcgttcga      4860
     atggttaagg cttcacttca aaatgaagca attaagctta agaaagacag tttgaccgag      4920
     gatgaggaac tc                                                          4932
//

If you have problems or comments...

PBIL Back to PBIL home page