(data stored in SCRATCH zone)

EMBL: D84432

ID   D84432; SV 1; linear; genomic DNA; STD; PRO; 282700 BP.
XX
AC   D84432; D82370;
XX
DT   09-MAY-1996 (Rel. 47, Created)
DT   25-MAR-2006 (Rel. 87, Last updated, Version 11)
XX
DE   Bacillus subtilis DNA, 283 Kb region containing skin element.
XX
KW   AhrC; AnsA; AnsB; AnsR; AroD; BfmBAA; BfmBAB; BfmBB; Blt; BltD; BltR; Bmr;
KW   BmrR; BmrU; CccA; Cdd; ComEA; ComEB; ComEC; ComED; ComGA; ComGB; ComGC;
KW   ComGD; ComGE; ComGG; CwlA; DacF; DgkA; DnaE; DnaJ; DnaK; Gpr; GrpE; LysA;
KW   NucB; RecN; RpoD; SinI; SinR; Spo0A; SpoIIAA; spoIIAB; SpoIIAC; SpoIIIAA;
KW   SpoIIIAB; SpoIIIAC; SpoIIIAD; SpoIIIAE; SpoIIIAF; SpoIIIAG; SpoIIIAH;
KW   SpoIIIC; SpoIIM; SpoIIP; SpoIVB; SpoIVCA; SpoIVCB; SpoVAA; SpoVAB; SpoVAC;
KW   SpoVAD; SpoVAE; SpoVAF; YqaB; YqaC; YqaD; YqaE; YqaF; YqaG; YqaH; YqaI;
KW   YqaJ; YqaK; YqaL; YqaM; YqaN; YqaO; YqaP; YqaQ; YqaR; YqaS; YqaT; YqbA;
KW   YqbB; YqbC; YqbD; YqbE; YqbF; YqbG; YqbH; YqbI; YqbJ; YqbK; YqbL; YqbM;
KW   YqbN; YqbO; YqbP; YqbQ; YqbR; YqbS; YqbT; YqcA; YqcB; YqcC; YqcD; YqcE;
KW   YqcF; YqcG; YqcH; YqcI; YqcJ; YqcK; YqcL; YqcM; YqdA; YqdB; YqdC; YqdD;
KW   YqdE; YqdF; YqeB; YqeC; YqeD; YqeE; YqeF; YqeG; YqeH; YqeI; YqeJ; YqeK;
KW   YqeL; YqeM; YqeN; YqeO; YqeP; YqeQ; YqeR; YqeS; YqeT; YqeU; YqeV; YqeW;
KW   YqeX; YqeY; YqeZ; YqfA; YqfB; YqfC; YqfD; YqfE; YqfF; YqfG; YqfH; YqfI;
KW   YqfJ; YqfK; YqfL; YqfM; YqfN; YqfO; YqfP; YqfQ; YqfR; YqfS; YqfT; YqfU;
KW   YqfV; YqfW; YqfX; YqfY; YqfZ; YqgA; YqgB; YqgC; YqgD; YqgE; YqgF; YqgG;
KW   YqgH; YqgI; YqgJ; YqgK; YqgL; YqgM; YqgN; YqgO; YqgP; YqgQ; YqgR; YqgS;
KW   YqgT; YqgU; YqgV; YqgW; YqgX; YqgY; YqgZ; YqhA; YqhB; YqhC; YqhD; YqhE;
KW   YqhF; YqhG; YqhH; YqhI; YqhJ; YqhK; YqhL; YqhM; YqhN; YqhO; YqhP; YqhQ;
KW   YqhR; YqhS; YqhT; YqhU; YqhV; YqhW; YqhX; YqhY; YqhZ; YqiA; YqiB; YqiC;
KW   YqiD; YqiE; YqiF; YqiG; YqiH; YqiI; YqiJ; YqiK; YqiL; YqiM; YqiN; YqiO;
KW   YqiP; YqiQ; YqiR; YqiS; YqiT; YqiU; YqiV; YqiW; YqiX; YqiY; YqiZ; YqjA;
KW   YqjB; YqjC; YqjD; YqjE; YqjF; YqjG; YqjH; YqjI; YqjJ; YqjK; YqjL; YqjM;
KW   YqjN; YqjO; YqjP; YqjQ; YqjR; YqjS; YqjT; YqjU; YqjV; YqjW; YqjX; YqjY;
KW   YqjZ; YqkA; YqkB; YqkC; YqkD; YqkE; YqkF; YqkG; YqkH; YqkI; YqkJ; YqkK;
KW   YqkL; YqkM; YqkN; YqkO; YrkA; YrkB; YrkC; YrkD; YrkE; YrkF; YrkG; YrkH;
KW   YrkI; YrkJ; YrkK; YrkL; YrkM; YrkN; YrkO; YrkP; YrkQ; YrkR; YrkS.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-282700
RA   Sato T.;
RT   ;
RL   Submitted (16-APR-1996) to the INSDC.
RL   Tsutomu Sato, Tokyo University of Agriculture and Technology, Applied
RL   Biological Science; 3-5-8 Saiwai-cho, Fuchu, Tokyo 183, Japan
RL   (E-mail:subtilis@cc.tuat.ac.jp, Tel:81-423-67-5706, Fax:81-423-67-5715)
XX
RN   [2]
RA   Mizuno M., Masuda S., Takemaru K., Hosono S., Sato T., Takeuchi M.,
RA   Kobayashi Y.;
RT   "Systematic sequencing of the 283 kb 210 degrees-232 degrees region of the
RT   Bacillus subtilis genome containing the skin element and many sporulation
RT   genes";
RL   Microbiology 142:3103-3111(1996).
XX
DR   MD5; 7e012da2515cc43a35c676bad0ac6551.
DR   EuropePMC; PMC103788; 10515943.
DR   EuropePMC; PMC107166; 9573176.
DR   EuropePMC; PMC107342; 9658017.
DR   EuropePMC; PMC134890; 11872727.
DR   EuropePMC; PMC15522; 10655484.
DR   EuropePMC; PMC18359; 10518523.
DR   EuropePMC; PMC317044; 9694797.
DR   EuropePMC; PMC96457; 10024571.
DR   GOA; P56849.
DR   InterPro; IPR001705; Ribosomal_L33.
DR   InterPro; IPR011332; Ribosomal_zn-bd.
DR   InterPro; IPR018264; Ribosomal_L33_CS.
DR   InterPro; IPR038584; L33_sf.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00039; DicF.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01412; BsrG.
DR   UniProtKB/Swiss-Prot; P56849; RL331_BACSU.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..282700
FT                   /organism="Bacillus subtilis"
FT                   /strain="JH642(trpC2 PheA1)"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        <1..654
FT                   /transl_table=11
FT                   /product="YrkA"
FT                   /db_xref="GOA:P54428"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54428"
FT                   /protein_id="BAA12353.1"
FT                   /translation="VDLQVNGSIVAISSEDSYETIVKIIKTESYTRYPVLNGDKDSIIG
FT                   FINAKEFLSAYIDTDQKIKEDFKLENHINPVIHVIESVPIHDVLVKMQKERTHIAILVD
FT                   EYGGTSGLVTAEDILEEIVGEIRDEFDKDEVPNIRKVNDNHYILDSKVLIEDVNDLLGT
FT                   TLASDEVDTIGGWFMTQQIDAAVGSVIEADGYIFKVHETVGRHINYLEIVRKKE"
FT   CDS_pept        complement(811..1269)
FT                   /transl_table=11
FT                   /product="BltD"
FT                   /db_xref="GOA:P39909"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR027455"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39909"
FT                   /protein_id="BAA12354.1"
FT                   /translation="MSINIKAVTDDNRAAILDLHVSQNQLSYIESTKVCLEDAKECHYY
FT                   KPVGLYYEGDLVGFAMYGLFPEYDEDNKNGRVWLDRFFIDERYQGKGLGKKMLKALIQH
FT                   LAELYKCKRIYLSIFENNIHAIRLYQRFGFQFNGELDFNGEKVMVKEL"
FT   regulatory      complement(1278..1284)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(1438..2640)
FT                   /transl_table=11
FT                   /product="Blt"
FT                   /db_xref="GOA:P39843"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR004734"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39843"
FT                   /protein_id="BAA12355.1"
FT                   /translation="MKKSINEQKTIFIILLSNIFVAFLGIGLIIPVMPSFMKIMHLSGS
FT                   TMGYLVAAFAISQLITSPFAGRWVDRFGRKKMIILGLLIFSLSELIFGLGTHVSIFYFS
FT                   RILGGVSAAFIMPAVTAYVADITTLKERSKAMGYVSAAISTGFIIGPGAGGFIAGFGIR
FT                   MPFFFASAIALIAAVTSVFILKESLSIEERHQLSSHTKESNFIKDLKRSIHPVYFIAFI
FT                   IVFVMAFGLSAYETVFSLFSDHKFGFTPKDIAAIITISSIVAVVIQVLLFGKLVNKLGE
FT                   KRMIQLCLITGAILAFVSTVMSGFLTVLLVTCFIFLAFDLLRPALTAHLSNMAGNQQGF
FT                   VAGMNSTYTSLGNIFGPALGGILFDLNIHYPFLFAGFVMIVGLGLTMVWKEKKNDAAAL
FT                   N"
FT   regulatory      complement(2648..2654)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      2745..2752
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        2757..3578
FT                   /transl_table=11
FT                   /product="BltR"
FT                   /db_xref="GOA:P39842"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39842"
FT                   /protein_id="BAA12356.1"
FT                   /translation="MSEDVKKYFTTGEFSKLCRVKKQTLFHYDEIGLFSPEIKKENGYR
FT                   YYSYHQFETFQVISLFKELGVPLKEIKCLIKGKTPDKILHVLKEKSIEIDKKINELKQL
FT                   QTILQTKVTLTEQALETDFSSISFEYLNEETFMLSRKTLNLPERKYVAAISELIHEVQQ
FT                   YELDEGYPIGGIFAREQILEKDFYNYSYFYIKVKDGAENINYHVRPKGLYAVGYEIGGN
FT                   TEEAYRRIIEFIERNGMQIGENAYEEYMLDEMVVDGYENTYAKILLQVKEV"
FT   regulatory      3731..3736
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        3748..3894
FT                   /transl_table=11
FT                   /product="YrkB"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54429"
FT                   /protein_id="BAA12357.1"
FT                   /translation="MLLKNWPSRRIQRDKSKRAGIGGTNNRIPYTLLLCYVNVQKPFRI
FT                   VDL"
FT   regulatory      4108..4111
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        4120..4680
FT                   /transl_table=11
FT                   /product="YrkC"
FT                   /db_xref="GOA:P54430"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54430"
FT                   /protein_id="BAA12358.1"
FT                   /translation="MYYNPFSPQCYYYVTVPMYNDGRSVYWTIPNEMEKVHRGADLRSS
FT                   YEDRNLLLKDYGPKPFVVNINRATKQNNTFRTALWTGKHFQVTLMSLGIGEDIGLEIHP
FT                   NVDQFLRIEQGRGIVKMGKSKDHLNFQRNVYDDSAIVVPAGTWHNVINTGNTPLKLYSI
FT                   YAPPNHPFGTVHETKADAVAAED"
FT   regulatory      5458..5464
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        5473..5664
FT                   /transl_table=11
FT                   /product="YrkD"
FT                   /db_xref="GOA:P54431"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54431"
FT                   /protein_id="BAA12359.1"
FT                   /translation="MMEQGKDCREVVTQLAASRNAIDRAMGLIVSTNLEHCVRESLEKG
FT                   EDTQNLVKEAVDLLVKSR"
FT   regulatory      5797..5801
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        5809..6291
FT                   /transl_table=11
FT                   /product="YrkE"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54432"
FT                   /protein_id="BAA12360.1"
FT                   /translation="MTEQTKRTTIVLFSGDYDKAMAAYIIANGAAAYDHEVTIFHTFWG
FT                   FNALRKEELIPVKKGFLEKMFGKMMPRGADKMGLSKMNFAGMGPKMIKNVMKKHNVLTL
FT                   PQLIEMAQEQGVKLVACTMTMDLLGLQEKELLDDIDYAGVAAYLADAEEGSVNLFI"
FT   regulatory      6464..6471
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        6477..7034
FT                   /transl_table=11
FT                   /product="YrkF"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54433"
FT                   /protein_id="BAA12361.1"
FT                   /translation="MMKATIVLDAKGLACPMPIVKTKKRMKDLKAGEVLEIHATDKGST
FT                   ADLEAWAKSTGHEYLGTEAEGEILRHFLRKGGEHSSENASSIPEISLEAFKQKVDSDES
FT                   LNILDVREIEEYEKAHIPGVVHIPLGEVEKRANELNENDEIYIICHSGRRSEMAARTMK
FT                   KQGFKKVINVVPGMRDWTGKTE"
FT   regulatory      7361..7367
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        7376..7486
FT                   /transl_table=11
FT                   /product="YrkG"
FT                   /protein_id="BAA12362.1"
FT                   /translation="MTVKAMTPKEVTKKSLTKNLYLFWMCVMKMILVIGR"
FT   regulatory      7597..7605
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        7615..8502
FT                   /transl_table=11
FT                   /product="YrkH"
FT                   /db_xref="GOA:P54435"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54435"
FT                   /protein_id="BAA12363.1"
FT                   /translation="MVSEMLSEAGHSVSYLKGGMKAWSEHLEPVKVGDLKDGGEMYQFV
FT                   RIGKGCLSYMVISNGEAAIIDATRMVNFFIDFAKGKGATITHVFDTHLHADHISGGRVI
FT                   AEKTKATYWLPPKDAEEVEFDYQPLEEGNDIIIGNTTIKIQPIYSPGHTIGSTSFIVDD
FT                   QYLLSGDILFIDSIGRPDLAGMAEDWVGDLRKTLYSRYKALSKDLIVLPAHFMIIDELN
FT                   ENGSVGKQLSTLFSENHGLNIADETEFRHLVTDHLPPQPNAYQEIRETNMGKISPDEEK
FT                   QREMEIGPNRCAIR"
FT   regulatory      8523..8527
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        8536..8763
FT                   /transl_table=11
FT                   /product="YrkI"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54436"
FT                   /protein_id="BAA12364.1"
FT                   /translation="MKSDKVLDAKGLACPMPIVRTKKAMNELESGQILEVHATDKGAKN
FT                   DLTAWSKSGGHDLLEQTDEGDILKFWIQKG"
FT   regulatory      8807..8815
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        8824..9609
FT                   /transl_table=11
FT                   /product="YrkJ"
FT                   /db_xref="GOA:P54437"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54437"
FT                   /protein_id="BAA12365.1"
FT                   /translation="MDIAFITTLFIIGFIGAFISGMIGIGGAVINYPMLLYIPSLVGVM
FT                   SLTAHEVSGIGAIQVFFATLGGVWAYRKSGLINKTLIIYMGSSILLGSVLGSYFSHYIS
FT                   EKGINFIYGILAIIAVILMFIPKKGQKGQEHSEDKEVIFNKWLASSLAFIIGGVSGILG
FT                   AGGAFILVPIMLSILNIPVRVTVASSLAITFLSSIGATVGKVITGQVLFVPALVLMITS
FT                   LIASPIGASVGQKVNTKFLQWVLAQLIGATAIKIWLELL"
FT   regulatory      10177..10182
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        10192..10668
FT                   /transl_table=11
FT                   /product="YrkK"
FT                   /db_xref="GOA:P54438"
FT                   /db_xref="InterPro:IPR025671"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54438"
FT                   /protein_id="BAA12366.1"
FT                   /translation="MVYFVAFFCFAITLHNIEEAIWLPEWSQQSSKFQKPVTSNEFHFA
FT                   VIVITMLAYLSAFGFLYMPESDIAKWIFIGFLGSMVINAIFPHLIATVVMEKYAPGPLT
FT                   GLLLNIPVNSLVIYQMFLKNLIVWKELIISTLVVGIILLALIPLLFKVGDKVSP"
FT   regulatory      10893..10900
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        10912..11436
FT                   /transl_table=11
FT                   /product="YrkL"
FT                   /db_xref="GOA:P54439"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54439"
FT                   /protein_id="BAA12367.1"
FT                   /translation="MKTLVIVIHPNLETSVVNKTWMNRLKQEKDITVHDLYGEYPNFII
FT                   DVEKEQQLLLDHERIVFQFPMYWYSSPALLKQWEDDVLTHGWAYGTGGTKLHGKELLLA
FT                   ISSGAQESDYQAGGEYNITISELIRPFQVTANYIGMRFLPAFTQYGTLHLSKEDVKNSA
FT                   ERLVDYLKAEH"
FT   CDS_pept        complement(11741..11848)
FT                   /transl_table=11
FT                   /product="YrkM"
FT                   /protein_id="BAA12368.1"
FT                   /translation="MFKRCFDPCLINRGQNTFESSVSFLTYTTPTSPST"
FT   regulatory      complement(11856..11864)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(11927..12484)
FT                   /transl_table=11
FT                   /product="YrkN"
FT                   /db_xref="GOA:P54441"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54441"
FT                   /protein_id="BAA12369.1"
FT                   /translation="MKTKNEPKVILELAKESDLPEFQKKLQEAFAIAVIETFGDCEDGP
FT                   IPSDNDVQESFNAPGAVVYHILQDGKNVGGAVVRINSQTNHNSLDLFYVSPEYHSQGIG
FT                   LSAWKAIEAQYPDTVLWETVTPYFEKRNINFYVNKCGFHIVEFYNEHHSNPHMHRNGRE
FT                   DDKPLLNDDDFFRFVKIMKKKD"
FT   regulatory      complement(12491..12497)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(12996..14213)
FT                   /transl_table=11
FT                   /product="YrkO"
FT                   /db_xref="GOA:P54442"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54442"
FT                   /protein_id="BAA12370.1"
FT                   /translation="MIVQKEGRGQPVSLRERVHFLDIVRGFALLGIIIVNYFLIVDSVK
FT                   GFEMASDDVLHKLVSWFAEGKFVTLFSFLFGVGFMIFMDRAAQKVESPNKLFARRLSIL
FT                   LGFGILHITFVWVGDILAFYAVSGFLLLAFYKRTAKTVLRWIIALIVFQFLTPVFTMLY
FT                   NVINTAGSKNPNFSEFTLFSHSSLTYMESISTRWTDMVTMAAGSFSMIYSMFLMFLLGV
FT                   YFVKMEFFKDMEAKKPIWKRIWIISTIAFLITQSSILLDMFNLSENMLWKDISSVLGQN
FT                   GGLTGSMFYMSTFAMLFLYLPQLRGPMMIFTKVGRMSLTCYLLHSIIGTVLFLRYGFGL
FT                   ADHIQSAGTFMFSLAVYFVLMSFSTLWLKRFRYGPMELVWRKLTYGKVNGSPKATPLHS
FT                   EKSIQK"
FT   regulatory      complement(14221..14228)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      14467..14473
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        14481..15176
FT                   /transl_table=11
FT                   /product="YrkP"
FT                   /db_xref="GOA:P54443"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54443"
FT                   /protein_id="BAA12371.1"
FT                   /translation="MAYRILVVEDDEDIGDLLEESLTRAGYEVLRAKDGKRALQLVNDS
FT                   LDLVILDIMMPGISGIETCQHIRKSSNVPILFLTARSSTLDKTEGLLAGGDDYMTKPFS
FT                   EEELHARVIAQLRRYTIYQEKKEQEETFLIGGKLRVSEEFNEVWKEEKQIKLSDLEYRI
FT                   LKLLMNKRNKIFSAQNIYESVWGQPYFYCSNNTVMVHIRKLRSKIEDDPARPVYIKTEW
FT                   GRGYRFGAS"
FT   regulatory      15148..15154
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        15163..16461
FT                   /transl_table=11
FT                   /product="YrkQ"
FT                   /db_xref="GOA:P54444"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54444"
FT                   /protein_id="BAA12372.1"
FT                   /translation="MAHLKFTLTKKLALLIMVAAIVSGVIFLTLQKITDDLIEGYLSSE
FT                   EYYHEESARYIQKFSKYVSENELSTSDRKAFGEWVKKENYINLTIFKDQELQYDSIYSE
FT                   SDYGKEKLTQYAQNHSHPVKFSDGEGRVIIDGFYSSRYYDLAFALDLLGATLIFLIIVL
FT                   FGIRQSLRYLKTIHQEIHILEGGELDYEMTIKGHDELAMIAKSIEDLRKAFLDKLKAIE
FT                   ELQAESRSLVTEMSHDMRTPLTSLIMNLEFAKKEGGEAGASKDRYVANAYGKALQLKSL
FT                   SDNLFAYFLLNKEYEADLETVAVKEVIYDLISDQIAILHQEHFRVHISGELPETYINVN
FT                   LEELGRVFDNVMSNLLKYADPEEKISITFVSDQEIFEIHVSNTIKLADITPESNGLGER
FT                   SIARMMSRMQGQFHSIQKNSKYYIVLRFWNTKM"
FT   regulatory      16494..16498
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        16504..16923
FT                   /transl_table=11
FT                   /product="YrkR"
FT                   /db_xref="GOA:P54445"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54445"
FT                   /protein_id="BAA12373.1"
FT                   /translation="MMRFSNKFKKVPYLLQALLNVCLSFLALALSALLISETWYIVLFV
FT                   YKSLFNKVDSYYEMLGELLIFFMYFEFIALIIKYFKSDFHFPLRYFIYIGITAVIRLII
FT                   IDHDQAISTFWWAMAILAMICGFFIANRRNSVVEH"
FT   regulatory      17451..17460
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        17468..17632
FT                   /transl_table=11
FT                   /product="YrkS"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54446"
FT                   /protein_id="BAA12374.1"
FT                   /translation="MKVIIIEGLQTDKCMNDCYHYLIKLYRQEIQGDSNISWNKRSRDR
FT                   ASTARSRPV"
FT   CDS_pept        complement(17857..18273)
FT                   /transl_table=11
FT                   /product="SpoIIIC"
FT                   /db_xref="GOA:P12254"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12254"
FT                   /protein_id="BAA12375.1"
FT                   /translation="MPPLFVMNNEILMHLRALKKTKKDVSLHDPIGQDKEGNEISLIDV
FT                   LKSENEDVIDTIQLNMELEKVKQYIDILDDREKEVIVGRFGLDLKKEKTQREIAKELGI
FT                   SRSYVSRIEKRALMKMFHEFYRAEKEKRKKAKGK"
FT   CDS_pept        complement(18255..18773)
FT                   /transl_table=11
FT                   /product="YqaB"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45899"
FT                   /protein_id="BAA12376.1"
FT                   /translation="MRYTNSHLEDWIENLYKKIDITEPEQINFERIAEALDIRLSFKPV
FT                   TSFALKHSGIYNICLDSRKSRTEQWYDFAHEFCHIYRHEGDKKTMPATWTDYLDWQSNY
FT                   FTYHFCIPTCMLRNINLPYIQSHAIENVAWLFKVSPSFAKKRLSIYYRKLTQHLFSQTV
FT                   TGNLCPPFL"
FT   regulatory      complement(18280..18282)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(18782..18787)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      19029..19035
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        19042..19578
FT                   /transl_table=11
FT                   /product="YqaC"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45900"
FT                   /protein_id="BAA12377.1"
FT                   /translation="MKKNIHILGASGVGTSTLGAALSKRLPHTHLDTDNYYWLDKFTKK
FT                   REIPERRKLLEKDLTINEKWILSGAVCGWGDNLKSYFDLVVFLWIPQDIRLERLRHREF
FT                   QRYGNEVLAGGSKYEQSKTFLEWASLYDNAGMEVRSRALHEHWMADLSCPVLKIEDDCS
FT                   VNERVDRVLDYLSSN"
FT   regulatory      19920..19926
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        19934..20101
FT                   /transl_table=11
FT                   /product="YqaD"
FT                   /db_xref="GOA:P45901"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45901"
FT                   /protein_id="BAA12378.1"
FT                   /translation="MKNNDKKKEVQRKYREEIKKKKQKNEDNKNFIKETIIVVTIIVLF
FT                   IFFTYTLQGF"
FT   CDS_pept        complement(20368..20718)
FT                   /transl_table=11
FT                   /product="YqaE"
FT                   /db_xref="GOA:P45902"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45902"
FT                   /protein_id="BAA12379.1"
FT                   /translation="MFSENLKKCRKQKKLTQQNMADKLGITRPAYTAYELGSREPDYKT
FT                   LINISNILDVSLDYLLKGESNEKVFQDEAKKVLNDPETFLAAKDGEVTDEILQAALEII
FT                   TEQLKERRKSDK"
FT   regulatory      complement(20722..20729)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      20882..20891
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        20895..21125
FT                   /transl_table=11
FT                   /product="YqaF"
FT                   /db_xref="GOA:P45903"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45903"
FT                   /protein_id="BAA12380.1"
FT                   /translation="MMRKWLKKNRLEKGFTQEEVAKAAQIGRAYYTMIENGTRKPSVIV
FT                   SKKIGEKLGFDWTIFFEDVCNETKHNSKDSA"
FT   regulatory      21137..21144
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        21155..21295
FT                   /transl_table=11
FT                   /product="YqdA"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54372"
FT                   /protein_id="BAA12381.1"
FT                   /translation="MKVILKKGPLFEQAEAKAYKYLSGILVQRMNEHQEKLAQKNKKES
FT                   A"
FT   regulatory      21355..21361
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        21369..21938
FT                   /transl_table=11
FT                   /product="YqaG"
FT                   /db_xref="GOA:P45904"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45904"
FT                   /protein_id="BAA12382.1"
FT                   /translation="MENNPYNMRNLPQIMRSARKAAGLSQYQIGKLIGGKDQRYVSDVE
FT                   NGLAKLTPELCIKWFEKCAAYEHIDLVHYLFKLHPTAAAPIDPALNECASNAVINMVHQ
FT                   LEEALQATKHLARWLTDNRPGKTEELPMADIKQIFDLIAANKTLIYSLVRTHGLKMQEL
FT                   ADRWTRKALVDQVAMAKQEGRQAVSV"
FT   regulatory      21922..21928
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        21935..22192
FT                   /transl_table=11
FT                   /product="YqaH"
FT                   /db_xref="InterPro:IPR020278"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45905"
FT                   /protein_id="BAA12383.1"
FT                   /translation="MNTNHFLKADVPIAKRKIESAEELSIMLSEALRDGDYEEAISLAG
FT                   SIKVLTEDISRLANKGRLYETALKMQQQGINLTVVSRCIG"
FT   regulatory      22310..22314
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        22322..22516
FT                   /transl_table=11
FT                   /product="YqaI"
FT                   /db_xref="InterPro:IPR018474"
FT                   /db_xref="InterPro:IPR023118"
FT                   /db_xref="PDB:2DSM"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45906"
FT                   /protein_id="BAA12384.1"
FT                   /translation="MVENPMVINNWHDKLTETDVQIDFYGDEVTPVDDYVIDGGEIILR
FT                   ENLERYLREQLGFEFKNAQ"
FT   regulatory      22608..22613
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        22622..23581
FT                   /transl_table=11
FT                   /product="YqaJ"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR017482"
FT                   /db_xref="InterPro:IPR019080"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45907"
FT                   /protein_id="BAA12385.1"
FT                   /translation="MTSKRAEVLAKNSEMSRDEWLIERRKGIGGSDASIILGLNKWKTP
FT                   FELWLDKTGQVPVSESQSEAAYFGSLLEDIVAKEFEIRSGKKVRRKKAILRHPEYNFIL
FT                   ANVDRMIVGEKAILECKTTSAYNLKEWEDEEIPESYIVQVQHYLGVLGPEYRKAYFAVL
FT                   IGGNKFVWKEIERDDELIDMIFKAEIEFWNDKVLGGQAPALDGSSAAEEYLKKRYAETE
FT                   NNKAIDLTAANRERIQQYLLIKEQISELQSQAKELENQIKHEMKDAEYGFIGNYQACWK
FT                   PVVSNRIDTKKLKDQFPDVYEKVKKETHFRRFGIKEVS"
FT   regulatory      23567..23574
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        23584..24438
FT                   /transl_table=11
FT                   /product="YqaK"
FT                   /db_xref="GOA:P45908"
FT                   /db_xref="InterPro:IPR004590"
FT                   /db_xref="InterPro:IPR018330"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45908"
FT                   /protein_id="BAA12386.1"
FT                   /translation="MATNQSIKNNIQKKQKNVPVQQQGATMKGLLSSPSVIKRFEEVLG
FT                   KRATQFTASILSLYNSEQMLQKTDPMSVISSAMVAATLDLPIDKNLGYAWIVPYGGKAQ
FT                   FQLGYKGYIQLALRTGQYKSINCIPIHEGELQKWNPLTEEIEIDFEKRESDAVIGYAAY
FT                   FELINGFRKTVYWTKAQVEKHKKKFSKSDFGWKNDWDAMALKTVLKAVLSKWGILSVEM
FT                   QKAVIEEDETRERIDITNEADSSEIIDSEPSNKDETEKPSAQETDPFDGKPVDIKDDEL
FT                   PFD"
FT   regulatory      24473..24479
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        24490..25191
FT                   /transl_table=11
FT                   /product="YqaL"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="InterPro:IPR034829"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45909"
FT                   /protein_id="BAA12387.1"
FT                   /translation="MDIKAMGYVVIPRLPFKEFRDEKIYDHLFKRAEYRPNQELELGQT
FT                   IIKVVELAKDFNWSAAQIKYSLDRMEKQGYIKLHRLPQKRGLIVTILHYADYIQLGNYM
FT                   KNKALEPAQIEHQEVDDKMKNAFELYENKVARSVGPMEAQRIGYMVDDYGEEKVMEAIK
FT                   TAFQLKGKAASLSYVQAILSNPFTQKRKEKQYGYKQSSQYRHRISNDHAGTSGKVSPLF
FT                   GNKTGRIRRKG"
FT   regulatory      25057..25065
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        25073..26014
FT                   /transl_table=11
FT                   /product="YqaM"
FT                   /db_xref="GOA:P45910"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45910"
FT                   /protein_id="BAA12388.1"
FT                   /translation="MAINKAVSIDTAFQTIMQELRERSARFLGTKQAVSEEKAEFDCPY
FT                   CKDRGIVVYRVHKDTSWHLDEQLDLMVPDDMVSEDDFLLGKVCTPDKASEWKDTYSKQC
FT                   ECVRRKKIARLMAASGITEEFEKLLFGNFITDGKPDMIKDAYECAVEYYKDFQKIKGER
FT                   QNSIALLGQPGSGKTHLLTAIMNNLIKKKSVHCMYFPYVEGMGDLKANFDNLEAKLDAM
FT                   RKVEVLFIDDLFKPINGQPRATDWQVEQIQSVLNYRYLNHKPLLISSELTIDEILDIDE
FT                   ALGSRIHQMCRDYIVIIRGDRMQLNHRLGDWE"
FT   regulatory      26235..26240
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        26250..26678
FT                   /transl_table=11
FT                   /product="YqaN"
FT                   /db_xref="GOA:P45911"
FT                   /db_xref="InterPro:IPR008822"
FT                   /db_xref="InterPro:IPR036614"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45911"
FT                   /protein_id="BAA12389.1"
FT                   /translation="MDCIKFTVYGEPVAQGRPRGSIRNGKVHMRDPAKSKYFKQYVALV
FT                   ASQHRPETIITGPVSMDVKVYRPMPKSVSNSKKKKEKAEKGLLRPTTKPDVDNYVKGVK
FT                   DALNHLIYKDDSQVVDLKVSKFYSEEPRVEVMIREVSA"
FT   regulatory      26746..26751
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        26760..26966
FT                   /transl_table=11
FT                   /product="YqaO"
FT                   /db_xref="InterPro:IPR035530"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45912"
FT                   /protein_id="BAA12390.1"
FT                   /translation="MYNPREINIKKDFTIQQKIDPGKVQIIVLDGNQGTAHVLDAPEHG
FT                   KTVIQTVKGSFARVDHEIGFKVK"
FT   CDS_pept        complement(27040..27969)
FT                   /transl_table=11
FT                   /product="YqaP"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45913"
FT                   /protein_id="BAA12391.1"
FT                   /translation="MRVREIKNLLDNYNKQIGVSVSHVPHSNRKTVLNLQKSLDAINEL
FT                   SKLGFLDDDIERFKDLGSIYYSRVPEDKIEVDNHIANQITNHIKIVKEKLRGFGILIDQ
FT                   SVSDQNENVISVKLPQYNSLEELEKFIKKLNNAFQNGITLEEINGHYKLQGFDTGSMWI
FT                   DILVNSSAAVIFVGQLIDAAINISKRSQELLITKANIEKLALQNEQLKLQVETSKALLD
FT                   GIEKGIDTITDAEIKNVTEGANYSTESIGHIKQSVKIFAELLHEGTQFHPSLDAPSETV
FT                   EAFPEPQKNLEEPQQLLETLADNLPEQE"
FT   regulatory      complement(27976..27981)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      28151..28158
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        28167..28622
FT                   /transl_table=11
FT                   /product="YqaQ"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45948"
FT                   /protein_id="BAA12392.1"
FT                   /translation="MNRKEIENLINSYHWMVKEVRRLQRVLYGSVIPMKNWGVAQYGLE
FT                   ATMPKGSPGKSQAELRQMDMREERLFKRLKYYEERVYAVELGAEKIHGEQHKVIYDCMM
FT                   EGMSYRAISLHLGISRETVRKMKDEFISQLCQDCHFERLLNLKKSVV"
FT   regulatory      28750..28757
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        28766..29230
FT                   /transl_table=11
FT                   /product="YqaR"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45914"
FT                   /protein_id="BAA12393.1"
FT                   /translation="MIQIDFGTVITSAITAVFFTGGTNYVLQKKNRKGNEIFTKGYILI
FT                   DEIYNINNKRIETAAAFVPFYNHPEGYLEKLHTDYFKELSAFELIVKKFSILFDKELNI
FT                   KLQEYINYLREVEVALRGFMNDDPIIEVNFNQEYIERLIDEITNLIKKHI"
FT   regulatory      29275..29282
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        29298..30017
FT                   /transl_table=11
FT                   /product="YqaS"
FT                   /db_xref="InterPro:IPR018925"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45915"
FT                   /protein_id="BAA12394.1"
FT                   /translation="MVDKHIQAYKDYAKGMKYKDLAEKYGVSVNTIKSWKQRHGWQRKK
FT                   GAPLKKGVHTKKVGAPLGNKNALGNNGGAPKGNQNAVTHGFFSKFLPEETLSIMEGIQE
FT                   RSPVDMIWDQIQIQYAAIIRAQKIMFVSDKQEMIKELKKKKSVLSETNEVEEEEFEFQF
FT                   SWDRHATFLNAQSRAMAELRNLIKQFDELAHSEDERRLKLEHMRLNINKKKIEIEELTE
FT                   EDKPFEITIVNKGDDSD"
FT   regulatory      29997..30007
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        30010..31305
FT                   /transl_table=11
FT                   /product="YqaT"
FT                   /db_xref="GOA:P45916"
FT                   /db_xref="InterPro:IPR006437"
FT                   /db_xref="InterPro:IPR035412"
FT                   /db_xref="InterPro:IPR035413"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45916"
FT                   /protein_id="BAA12395.1"
FT                   /translation="MIKQVNPHFKEFLFDWNQKFQFLVGGYGSSKSYHVALKIVLKLLR
FT                   EKRTALVIREVYDTHRDSTFSLFDELVSDLKLDHIVRCVSSPMQIRFSNGSRIIFKGMD
FT                   KPAKLKSINNISLIWIEECSEVKYEGFKELLGRLRHPTLPLHMILSTNPVGEDNWTFKH
FT                   FFKDDREKRFVLDDKELYEKRIIVSNDTYYHHSTADDNLFLPESYVQQLEELKEYDPDL
FT                   YRIARKGHFGVNGIRVLPQFEERPHEEVMTAISNINRPLKRVGMDFGFVESYNAVVRVA
FT                   VDHEKKYLYIYWEYYKNGLTDDKTAEELKEFAETKELIKADSAEPKTIRYFQQHGFNMV
FT                   GARKYQGSRLQYTKKIKRFRKIICSDRCENTIYELKPLAYATDKLGNIIEDEFTIDPHT
FT                   LSAIWYALDDYEVTDLKEESKGRPQRSRPGRR"
FT   regulatory      31296..31303
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        31309..32841
FT                   /transl_table=11
FT                   /product="YqbA"
FT                   /db_xref="InterPro:IPR006430"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="InterPro:IPR016753"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45917"
FT                   /protein_id="BAA12396.1"
FT                   /translation="MSKKSVKARVIKASPPTESTKQIYEDEFADSYDSNILPPPYNLKE
FT                   LKMIAEYSTILQQCVDAYRTNIVGFGFDFEYSFDVNSPDVTNEEKTEAESEWTKLEEFV
FT                   KYLHFDESAETLLGFVIEDREKTGNGFIEVIRNGENKPAGIEYMDVQNVRVCKLSEPIE
FT                   VDFTYFEQGQMKSIKREKRFRKYVQMIDGRMVYFKEYGDPRTLNLETGQYDEQTPLEKR
FT                   ANEVVHFKIGSGIYGKPRWIGHIVNLYGARKAEELNFMYFKQGRHIPAAITIENGMLSE
FT                   DSYTQLQDYMNGLEGVENAHKFLLLEAEGIAKGKNIHGDEEIAPVKVDIKSLAEILQED
FT                   ALFLEYDQKNRDKIRSAFRLPPLYTGEAQDYNRATADTARKITEEQVFQPERKLITGKL
FT                   NALFLNDLEIHKVRLQLKGPDFRDPLEIAKVLTPFITAGAVSPNDLRDLAGRVLGKTLE
FT                   EWPEEEYNRPLGKTNESSVSDPLAALFKSKNGTPNMIGLLKDMRDVLEDLKR"
FT   regulatory      32823..32827
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        32838..33755
FT                   /transl_table=11
FT                   /product="YqbB"
FT                   /db_xref="InterPro:IPR006528"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45918"
FT                   /protein_id="BAA12397.1"
FT                   /translation="MNKTDKLLESLNVFIQKAEENQYKQLGEMVPDFPGKSNIPKYVEE
FT                   YEKGIARLLRRQHKKFLDGLKGFVSKDSEETLKALLVFFTQNLFAEDDFEEEFQELTEG
FT                   FLQQTIEEMAEVIMDSIDPEVPFKVLSNRTINWIKDWSKKLAEIMKLNTHEVVEDVLTN
FT                   AIENGSSIQDIELTLKDMPQFDRERARTTAITEVLAASSAAQHESYAQSPAVKKKKWRH
FT                   SGGKKNNPRENHIDLDGTVIGVDEEFQIPGSSETCMFPRDPKLSTRERVNCHCVLSPVV
FT                   DSKILGLSPEEKEEIQREVLANME"
FT   regulatory      33783..33788
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        33796..34449
FT                   /transl_table=11
FT                   /product="YqbC"
FT                   /db_xref="GOA:P45919"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45919"
FT                   /protein_id="BAA12398.1"
FT                   /translation="MNWMEFISSIVKSIIWPVAIIILVFKLKQPVSNLISTLAKIKYKD
FT                   WEFEFTIDQKLDKISFQLNKENQYGTDDQNLKDSLNLESNSEITEETHSHYNEKTSIKG
FT                   DNDLLLKMEMIRLYGAVKNLYEKVSEKDDAADKSQGIGMLYMVDYLKRHKILNDSFAES
FT                   LLDIMNIVHDLEKSHISQSYIMNKFFWNVDKSVKRLMEITSNYVAENTAGETSN"
FT   regulatory      34467..34476
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        34482..35450
FT                   /transl_table=11
FT                   /product="YqbD"
FT                   /db_xref="GOA:P45920"
FT                   /db_xref="InterPro:IPR027924"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45920"
FT                   /protein_id="BAA12399.1"
FT                   /translation="MPRELVNAKITHVSYVDKAANQKQFFIVKSEKQPDFQKEVRILAK
FT                   EADEQKLVYGIVYDPDTVDAHGDFMTAAEIEKAAHGFLKDARQIDKQHDFQGGVGEVVE
FT                   SYVAPADFEMNGETIKKGSWVLVTKASEEVWEQIKKGEITGYSMAGTAETIEKQEKPVS
FT                   QEKTDEKGLFNLLKNFFVGKQQQSYEEPVAKAGRKFSASNLQEIKNAHAALGNLLSQVE
FT                   TKEGEEEMTSEEVTKSIQEALEPIKKRLETLEKEEELNKKDKEKEEETEKEGEKLKKAI
FT                   SEAVQPLADRIEAIEKSRGTSKQTEESGSEQVQKSIWSGLF"
FT   regulatory      35456..35462
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        35469..36404
FT                   /transl_table=11
FT                   /product="YqbE"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45921"
FT                   /protein_id="BAA12400.1"
FT                   /translation="MRNQEVINKAEMTLSTLESGGIMNPTQASTFIRMVQDTPTILRDA
FT                   RVIQMDHDTQKIEKIGFGQRILRAAQEGVALTKDQKSVPSTSTVNLSTKEVIAEVNITY
FT                   DTLENNIEKDGLQNTIMQMIADRAAVDIEELLVNGDTSSSDSYLAQLDGIRKQATSHIV
FT                   DAAGEELTRQTFKRGYKAVPPKYLRIPQEFRFYTSPGIEVEWKDRVADRQTNLGDAAVQ
FT                   GGLSSAFGVPIKGIANLQPYTIGEGDTAADVSDIILTHPKNIILGFSRNIRIEVDKDIR
FT                   RRMFIIVLTAKLDSVFEEEDAVAKIVKVKE"
FT   regulatory      36402..36409
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        36415..36726
FT                   /transl_table=11
FT                   /product="YqbF"
FT                   /db_xref="InterPro:IPR027926"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR036840"
FT                   /db_xref="PDB:2HJQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45922"
FT                   /protein_id="BAA12401.1"
FT                   /translation="MFTAKLIKGKTYNVMGITFRAGVSQTVPKKLYEYLNENPYFILTQ
FT                   ELNNQKDDPINYTESELKGMNKAEHESIISNLGRNPSDFKNADERIAYILKQIDNKGE"
FT   regulatory      36715..36721
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        36730..37125
FT                   /transl_table=11
FT                   /product="YqbG"
FT                   /db_xref="InterPro:IPR013514"
FT                   /db_xref="InterPro:IPR036558"
FT                   /db_xref="PDB:1XN8"
FT                   /db_xref="PDB:1ZTS"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45923"
FT                   /protein_id="BAA12402.1"
FT                   /translation="MLLITPDELKSYSVFESVKTRPDELLKQDILEATADIILKVGHDF
FT                   SDAEYIPLPETVRLALLKLSQFYALINGDESIIKGYTTEKIGDYSYTLGDGSPLQKPDV
FT                   YALIKDYVKPADPDLEGIEAKVRMRSI"
FT   regulatory      37109..37118
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        37122..37484
FT                   /transl_table=11
FT                   /product="YqbH"
FT                   /db_xref="InterPro:IPR024556"
FT                   /db_xref="InterPro:IPR038667"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45924"
FT                   /protein_id="BAA12403.1"
FT                   /translation="MSYQSLLTHRCDIYHLQEKKENRKQKFGVPVEDVQPVFSYPDEPD
FT                   IENQPCYFTEKSQSIIQQESNVSIYQSFLVHFPATADIRVNDRAVWDGTAYKLQKPRKI
FT                   RNHHWEVTAVREVEYL"
FT   regulatory      37466..37474
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        37481..37984
FT                   /transl_table=11
FT                   /product="YqbI"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45925"
FT                   /protein_id="BAA12404.1"
FT                   /translation="MKIRGLDQFIQSLDRASRGGLKRKYEQWLESMGFEFLDIIQDEII
FT                   RTKTVDTRRLLNSFQKGDQDNIFSMTEGSLKLDVGTNLDYASYVNDGHFTIDPSKNQDR
FT                   RWVPGRWKGDRFEYDPAEKNSGMLLKFRWVDGSGFWDNAMAIFQLMFERSLERKLQQWI
FT                   YEEF"
FT   regulatory      37982..37991
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        37997..38434
FT                   /transl_table=11
FT                   /product="YqbJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45926"
FT                   /protein_id="BAA12405.1"
FT                   /translation="MNQEVGSIMGYLYKLYPVQVYEEEIPQDFSVPSLYFPPASTVDGV
FT                   DTVSTFQKAYVLNVKLFHENVQKAHNEAERIADTLRSRRGIIPLIQDSGEDTGDFIRLS
FT                   RIETRVSDDYATIVLNWTSRYWYEREDQRSIDGFKFKSGVK"
FT   regulatory      38607..38615
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        38623..39540
FT                   /transl_table=11
FT                   /product="YqbK"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="InterPro:IPR035326"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45927"
FT                   /protein_id="BAA12406.1"
FT                   /translation="MNGGTFTPGKEKERAGIYFNFKTTAENRVSAGERGTVALPIASSW
FT                   GEVKKFISISSIEDLNKKVGLNIDDPSLLLLREAMKKANTVLLYRLTEGLRASADISEG
FT                   VKATALYGGTKGNDIIISITENVIDSSKVDVTTYLDQSEVDKQTVSKAEELKPNKYVTF
FT                   TGKGDLTVTIPLTGTAPEDVSGALPATSGIRLSGGTDKTPTNADYTAFLEAAETEYFDT
FT                   IALPVEDNEQLKATFVAFIKRLRDNQGQKVQGVLSNYKGDHEGIINVTGGVLLEDGTEI
FT                   TPEKATAWVAGASAGLHLINHLHL"
FT   regulatory      39605..39612
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        39618..40022
FT                   /transl_table=11
FT                   /product="YqbL"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="InterPro:IPR035326"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45927"
FT                   /protein_id="BAA12407.1"
FT                   /translation="MFTYDSRDKSVSVEKDINSLTSLTAEKNKMFQKNKIVRVLDAINN
FT                   DLTSQLKALIKSRKASGSDVPATNDGLQFVKTLITQYLSVLQDNEGITDFDSENDITIA
FT                   LNNDRDGFLIDLAVQPVDAAEKFYFNVEVK"
FT   regulatory      40011..40017
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        40025..40468
FT                   /transl_table=11
FT                   /product="YqbM"
FT                   /db_xref="InterPro:IPR018989"
FT                   /db_xref="InterPro:IPR038628"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45929"
FT                   /protein_id="BAA12408.1"
FT                   /translation="MALKAQNTISGKEGRLFLDGEEMAHIKTFEANVEKNKSEVNIMGR
FT                   RMTGHKTTGANGTGTATFYKVTSQFVLIMMDYVKKGSDPYFTLQAVLDDASSGRGTERV
FT                   TLYDVNFDSPKIAGLDVDSEALEEEVPFTFEDFDVPEQLKSTF"
FT   CDS_pept        complement(41191..41370)
FT                   /transl_table=11
FT                   /product="YqdB"
FT                   /db_xref="GOA:P54373"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54373"
FT                   /protein_id="BAA12409.1"
FT                   /translation="MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYIT
FT                   VKEKCLHEDPPIKG"
FT   regulatory      complement(41376..41385)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      41500..41506
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        41516..41965
FT                   /transl_table=11
FT                   /product="YqbN"
FT                   /db_xref="InterPro:IPR014986"
FT                   /db_xref="InterPro:IPR038559"
FT                   /db_xref="PDB:3KLU"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45930"
FT                   /protein_id="BAA12410.1"
FT                   /translation="MSENQNEKVYDLSFFMPGQTIDAEEVEVPISKRFVDKEGNVVPFI
FT                   FKAITTDRIDELEKENTTYKNVKGRGRVKELDSQRFYARIAVETTVYPTFKAKELREAY
FT                   KTEDPVEVAKRVLSVGGEYANWLNKAIEINGFDDDLEDLEEAAKN"
FT   regulatory      42129..42137
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        42147..46904
FT                   /transl_table=11
FT                   /product="YqbO"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45931"
FT                   /protein_id="BAA12411.1"
FT                   /translation="MAKLTATFELHDKISRKLRMIQGNAERLKRAANGPLIFEAEDRTE
FT                   RVMRQIDRSANRLTARARLLEMGLDDRVSNGLHSIRQQAEDLTEGSHEVTVSVNDQATP
FT                   RFRLIRGGLTDLNSSHAEPTVSVRDHASNQLDEIRRHVTDVDSEHAEPTVSIKDRASAA
FT                   LDAIEAKIDSLKGATITLAVAGGFPAGSIMGSGKSTMSQDAYVSATSNVNKKDVAKMTD
FT                   QIYFNNKAGSSREEVSLSLRNLSQQTGASKKALAELTESSSKIAQLMNADQAEVDRAFS
FT                   SMYNNLKLSGKQSGDLIAYVYRNAGDQADDLLDTMNEYSSTFKDLKLTGGQIANAMIKG
FT                   TKGGARNFDNLADSMREFNIRRTEMSDSQVDAFKTLFGAKETKKMFKGFKDGSISGEES
FT                   LFRVAKALSKVKDKTKRAAIATELIGTQYEDLKQPILDMAEGIGTSAKTSGELERSFTK
FT                   LRDNNPMTPVNDAMRDFESISKDMGTSLLTGLGPAFDKISSFINSKEGQEKLKEIKKDI
FT                   ADLGEEIGDKLNVAIEWSVNHWDDLKTAIKVVIPSLIGLIGYLKILRPLLKGIGTVGSD
FT                   AAGVIRKLIPKRTPKAGTNTQSERRNRNSNRNASTRGRESKTATGPTSLPRSGSLTYCC
FT                   CSDGGKNDRIRRRRGKRVLGRRGNPNRMNPSDSSIAVSSERLERRRSGRTVGTNPTRDS
FT                   RSAIITTRSELYSAGRAAGGTSKFGKVLSPLKSVGKFAKGVPLLGTALAATDLIGMNKD
FT                   NVGEKIGSAGGGLAGAATGAAIGSVIPGVGTAIGGLVGGIAGTMGGSSLGKAFDGSEVK
FT                   KKLNSTLFDQKWWSEKWSGIKSNAKTSINGLSDTWSNVKEKVKSTLFNSEWWSEKWSGV
FT                   KSWAQNKWNSASPVWESVKGKIKSTLFSEKWWSGKWEGVKSWAQSKWDSASSVWQSVKG
FT                   KLKSTLFSEKWWSGKWESVKSWSKNKWDNAKSIWKSVKSSISETLFSKKWWSEKWQSVK
FT                   ELGSSILGGVKEVGGKVASSAKKTAGKAWGYVKSGVNYLFGSGKEKPKKHATGGYITKP
FT                   TISWIGEAGKEFVIPVENNKGRGKMLLSQAASKLGMSVVDDIASASSAGGEPATSPLVR
FT                   SAAVTASVSPIIDTSSLDEQATSFGQQFTKSFDQGIRDNVVSMEAWKQKNVGQPMNNLI
FT                   SYSPNYGKQVVNGYAKGQNSTSTGTDGFLQTKVKMPFQNTVNKSSSWGSGTIKGFASGQ
FT                   NSSQTGTDQYVSTHINKPFIRSKESSNGWGSGMIGNFVSGMTSKASEVNEAAKELAKKV
FT                   EKAFREELDIHSPSRVMMSLGRFASIGIVKGLDSVDVKKFAEKQAGSLAAAYSGMGAVS
FT                   GNVKQWLMAAIMATKTPMSWLPGLMTIAQHESGGNPKAINLWDSNAKAGHPSQGLMQTI
FT                   PSTFNAHKLPGMNNILNPIHNAAAAIGYIKSRYGSINNVPGIRSMRHGGPYVGYANGGL
FT                   ITKEQIARVGEGNKREWIIPEERGIRGRYLLAQAAKALGMEVTDPSEKGQTELSSGQVT
FT                   AATTGRNQTTFKAAGGKEVIIQFNGDQHFHNDQDMNSLVAKIKQALVDELEQDINIGTK
FT                   GVVAFD"
FT   regulatory      46880..46887
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        46897..47556
FT                   /transl_table=11
FT                   /product="YqbP"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45932"
FT                   /protein_id="BAA12412.1"
FT                   /translation="MTKSIYEFWISQGKDKLRLPVLPEQIDISNTIQNESVKVASFGEI
FT                   TFIDKPGAKEISFSSFFPKKHSPLAEYKGFPSPENAIAKIEKWVKSKKPVQFLITGTKI
FT                   NLTCSIEVFSYTEGQKDIGDRDYEIKLKEYKTASPRKIKQKKKTKKKRPSKSAPKTYTV
FT                   KKGDTLWDLAGKFYGDSTKWRKIWKVNKKAMIKRSKRNIRQPGHWIFPGQKLKIPQ"
FT   regulatory      47559..47565
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        47569..48549
FT                   /transl_table=11
FT                   /product="YqbQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45950"
FT                   /protein_id="BAA12413.1"
FT                   /translation="MIELFVIKETEWLELVTESVSLEGQRYQAPRSITAKIITKQGTHS
FT                   YYSVSEGDTVLFKWKGKELFRGIVFSRNPEEHWMTFTAYDMLQYLVKNKDVYVFSNQRA
FT                   DEIIKRLARDFQIPTTSIANTGYTIKSLVFKDDTSLYDMILKALKQTKSQTGRNYQLYS
FT                   AKGKLGLRAWPDLSEVWVLETGVNITGYQYSTSINDTATKVKLRRQKDNKTYTATASDS
FT                   SGISKYGVLQYVETVSDNINQAQLQERAKVKQAQKKGVKKELKSIQAIGIPDLQSGLPI
FT                   YISIPEVGVKKTYWIDTDKHEFKGSTHTMTIDVVEKNSIPDGVSS"
FT   regulatory      48532..48538
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        48546..48809
FT                   /transl_table=11
FT                   /product="YqbR"
FT                   /db_xref="InterPro:IPR022555"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45933"
FT                   /protein_id="BAA12414.1"
FT                   /translation="MRLSEAIKHLAVRAVDSESPVDILPAEVVSVSPVEIRLNENDKLI
FT                   IPADLIIVPKRLRAGEEALNTGERVMIVSLKGGQSFFILDKI"
FT   regulatory      48808..48815
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        48822..49247
FT                   /transl_table=11
FT                   /product="YqbS"
FT                   /db_xref="InterPro:IPR020288"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45934"
FT                   /protein_id="BAA12415.1"
FT                   /translation="MALSPEIEFEDIEDDSEVIETSQTYKIDFENGRITNEIITGLEAI
FT                   KQFVYLSLHTERYAYSVYSHDIGNELQDVLADNETTDAYKKMEIPRLIEEALIYDDRIS
FT                   AVTDFEIEKQGESFRVSFTVETDEGTLEIEEVLGEDV"
FT   regulatory      49222..49229
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        49240..50286
FT                   /transl_table=11
FT                   /product="YqbT"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45935"
FT                   /protein_id="BAA12416.1"
FT                   /translation="MFEDQTYESIMDRMLNSISADIDKREGSVIYNALAPVAAELAKSY
FT                   IWLDTVLELVFSDTAQGEFLDRRATEAGIERTAATKAVRAGEFTEGVTIPVGSRFYVDN
FT                   LYFQYTADGTLECETAGEAGNANISGQNLLSLDTIPGLQKAIVKEILIPGREEEDDDSL
FT                   RARYFTRVRREAVSANKAHYKQWAEEVDGVGKVKVFPLWNGDGTVKIVVTNANLEPASD
FT                   ILISKVKNYIDPEPGQGEGQAPIGAFVTVESAVWKEVEISAEVLPEVNSSIDQVKQEIE
FT                   SGVLNLFKKIAFEDNVIRLSQINNIVYNSPSVSDYADIKINGVAENLVLSAVEIPKLGQ
FT                   VNIIEQTR"
FT   regulatory      50258..50262
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        50270..50848
FT                   /transl_table=11
FT                   /product="YqcA"
FT                   /db_xref="InterPro:IPR018755"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45936"
FT                   /protein_id="BAA12417.1"
FT                   /translation="MSKLDEMTAYLPPFLTKLKEMAELLKAEAPEFEKQNNSIFDLTDQ
FT                   LFVTTATWGLERWEKILNVPRESGDTDEIRRLRLISKMSNIPPATYRAIEHALNRFLKN
FT                   PSAQVRLLPGEYRFKVDIDIDDMQHMSELIETLENMKPAHLAYTLRAALNEPLQIKDTV
FT                   ILNYRRYRKASELKVGYSVTLNNNEVVLV"
FT   regulatory      50832..50838
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        50845..51117
FT                   /transl_table=11
FT                   /product="YqcB"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45937"
FT                   /protein_id="BAA12418.1"
FT                   /translation="MITQLYRERTAADLKNRISKVLLNGNETEIVELTIQGAVVTVLTQ
FT                   REEDIKHIKSVQILDDQNNVITERTTDLDVSNNRTLDFRITFEVV"
FT   regulatory      51107..51113
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        51120..52220
FT                   /transl_table=11
FT                   /product="YqcC"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45938"
FT                   /protein_id="BAA12419.1"
FT                   /translation="MAYDAKTDWLPDDPINEDDVNRWEKGIQDAHKDLAVHKNDMNNPH
FT                   NTTKAQIGLGNVDNVQQASKKEFEEHRNDLQRHITPVERENWNAKETIVGAQEKADKAL
FT                   SDAKYYVDTNYKNNNLTLITGDNAIQDARPGGEEYPLGLTLMDIGQGNTTGYPLGYGIV
FT                   KNEKYNNYRSLNTFTEQGMSLGLTMTVQEFGLDTGGVVHGWTPWQKISGFAHANIGTTG
FT                   VQYLKKIDHTKIAFNRVIKDSHNAFDTKNNRFIAPNDGMYLIGASIYTLNYTSYINFHL
FT                   KVYLNGKAYKTLHHVRGDFQEKDNGMNLGLNGNATVPMNKGDYVEIWCYCNYGGDETLK
FT                   RAVDDKNGVFNFFDIQELGGRNYPRF"
FT   regulatory      52219..52225
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        52230..52565
FT                   /transl_table=11
FT                   /product="YqcD"
FT                   /db_xref="InterPro:IPR019094"
FT                   /db_xref="InterPro:IPR035950"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45939"
FT                   /protein_id="BAA12420.1"
FT                   /translation="MNIGEAILFKYPTADPTKDFIVQNNGDGTPSYIAEWNIRAPIPTE
FT                   AELKTWWEELQSTSAYEPPVQVDLLARELSQEKLARKQLEELNQTLGSELSKIKLQLLT
FT                   LQGGQGS"
FT   regulatory      52546..52552
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        52562..52726
FT                   /transl_table=11
FT                   /product="YqcE"
FT                   /db_xref="InterPro:IPR010022"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45940"
FT                   /protein_id="BAA12421.1"
FT                   /translation="MNYWVLALHYNWASSEMVKQAIHLKDCSPEDLQEGIEKKLITAEQ
FT                   YKEITGEAI"
FT   regulatory      52800..52806
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        52814..53707
FT                   /transl_table=11
FT                   /product="YqdC"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24810"
FT                   /protein_id="BAA12422.1"
FT                   /translation="MASYSFQFSTDATGKPGAAKPYREGNRDFVVPVASISGNSELLTN
FT                   AVLKATEVYTQYGQDRLGQVLISKVKGHAYSDREGTLFIEESNDMNSWTTISSLVVKAN
FT                   TLGETEWIHLTKRYFRFRYANGNLQQSEFLLYQSLGAGEEDININHTVPITAVAPFSVQ
FT                   LDKSGLTNDGRLKVQTEGLNLSSLDTQSKTMDIVFHDKTETIGEGNPFTVGSFKTLLIE
FT                   VYGTAETSELKFWGKSLSGTKRALRGQKVDDGTFATSTKGKSEAWSFSITGFKEIVMEL
FT                   TALTNGNFSVRGTAVS"
FT   regulatory      53738..53747
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        53752..54174
FT                   /transl_table=11
FT                   /product="YqdD"
FT                   /db_xref="GOA:P24811"
FT                   /db_xref="InterPro:IPR006480"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24811"
FT                   /protein_id="BAA12423.1"
FT                   /translation="MEETSLFINFETLDLARVYLFGGVKYLDLLLVLSIIDVLTGVIKA
FT                   WKFKKLRSRSAWFGYVRKLLNFFAVILANVIDTVLNLNGVLTFGTVLFYIANEGLSITE
FT                   NLAQIGVKIPSSITDRLQTIENEKEQSKNNADKAAG"
FT   regulatory      54202..54209
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        54219..55037
FT                   /transl_table=11
FT                   /product="CwlA"
FT                   /db_xref="GOA:P24808"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24808"
FT                   /protein_id="BAA12424.1"
FT                   /translation="MAIKVVKNLVSKSKYGLKCPNPMKAEYITIHNTANDASAANEISY
FT                   MKNNSSSTSFHFAVDDKQVIQGIPTNRNAWHTGDGTNGTGNRKSIGVEICYSKSGGVRY
FT                   KAAEKLAIKFVAQLLKERGWGIDRVRKHQDWNGKYCPHRILSEGRWIQVKTAIEAELKK
FT                   LGGKTNSSKASVAKKKTTNTSSKKTSYALPSGIFKVKSPMMRGEKVTQIQKALAALYFY
FT                   PDKGAKNNGIDGVYGPKTADAIRRFQSMYGLTQDGIYGPKTKAKLEALLK"
FT   regulatory      55185..55191
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        55202..55681
FT                   /transl_table=11
FT                   /product="YqdE"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24812"
FT                   /protein_id="BAA12425.1"
FT                   /translation="MFKKLLLATSALTFSLSLVLPLDGHAKAQEVTLQAQQEVTYQTPV
FT                   KLSELPTNTTEQSGEFHTNGIKKWIAKEAMKATASALRHGGRIVGEVVDELGGSAGKTF
FT                   AKHTDDVADALDELVKRGDVVEDAIIDTVSSYLIDAGVKSSTARTIASVFTFLAF"
FT   regulatory      55684..55691
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        55697..56059
FT                   /transl_table=11
FT                   /product="YqdF"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24809"
FT                   /protein_id="BAA12426.1"
FT                   /translation="MVTVEERLDNLEKKVEKQAFQLRLVQQLAADYDRFGLFDQVLAYD
FT                   LSEKQYQELRELTSQYTDKIKNGEEVSLHNFTEEFKRILKDIEKEVDFEKFISLWLKGP
FT                   EEGFGFSKALHNHFFN"
FT   CDS_pept        complement(56320..56898)
FT                   /transl_table=11
FT                   /product="YqcF"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45941"
FT                   /protein_id="BAA12427.1"
FT                   /translation="MGVTQENKVIARTVLGAFGGKPKVTKYWDDNKNSSIDILSVSDQP
FT                   QEGITSYSTLGLSDHSINYEVNGTPLRIEIVAAMESASDIYANVLSTCAFNIINSNFTC
FT                   APGVIFKNVISMYDQETDMKHIMFVPPFLWEEDLELLEFSNKNVTWLMALPISEGELQV
FT                   AEKHGSDYLQDLLESKQIDIFDIKRESVV"
FT   regulatory      complement(56909..56914)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(56913..58508)
FT                   /transl_table=11
FT                   /product="YqcG"
FT                   /db_xref="GOA:P45942"
FT                   /db_xref="InterPro:IPR006829"
FT                   /db_xref="InterPro:IPR026835"
FT                   /db_xref="InterPro:IPR027797"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45942"
FT                   /protein_id="BAA12428.1"
FT                   /translation="MKVFEAKTLLTEAEKRAQEYKDLKSKMVKLKKAFKAVADLDDSEF
FT                   SGKGANNIKSFYEDQAGIADQWIDLIEMKISFLTSIPGFLEDANLSDAYIEETFLAHEL
FT                   ANAYTKSKSIMSEQKKAMKDILNDINDILPLDLFSTETFKNELSSAEKKRKEAIEKMDE
FT                   VDQNLTSEYGLSEANEQMIQADYQALMNATAKGKSASPIHYNAKAYRDSEIHKMTEDVK
FT                   KQSTDYISFKDQQAEQRRIAKEQEELANRPWYEKSWDAVCNFTGEVSGYYDYKRAADGV
FT                   DPVTGEKLTAGQRVAAGAMAAAGYIPIVGWAGKLAKGGKAVYSTSKALYRADKALDVYK
FT                   TPKTFHALQNSSKGLYGLASANGFSEAITGRDMFGNKVSKERQEQSLSGAMAMLVPFGA
FT                   RGINKKLNAKSSSRVSEASTNTSKKPKVPKTYKRPTYFRKGVRDKVWENAKDSTGSVKD
FT                   PLTKQVMKKDEPWDMGHKPGYEFRKHQQSAMERNISRKQFLDEHNNPDHYQPELPSSNR
FT                   SHKGEDMTDDYFGD"
FT   regulatory      complement(58516..58522)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(59270..60397)
FT                   /transl_table=11
FT                   /product="YqcH"
FT                   /db_xref="GOA:P45943"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR040702"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45943"
FT                   /protein_id="BAA12429.1"
FT                   /translation="MISITSAEVGMKINEWHRHIQKFNVTDAEMLKAEIERDIEVMEED
FT                   QDLLIYYQLMAFRHKIMLEYTLPSDENRMELSEYLNKIEGHKKKLDNMRAYYYNFFRGM
FT                   YEFRNGEYTRAITYYKKAERKIPTISDKIEKAEFYFKLSEVYYHMKMTHISMHYAELSY
FT                   NIYKKHELYSVRRIQCHFVIAGNYDDLENHEKALPHLQEALKGAELLKSKNTHIYATAF
FT                   FNLGNCYHKMDNLNKAARYIEQALVQYRKINSDVLPQAYHDLALIYFKQGKKGQAMDCF
FT                   RKGIRSAVDFKDELFMNLFEALDVLYIRNGDTPKLLNIFSRLENGKGYPYLEELALLGG
FT                   NLFDYNGKIEDSIICFKKMVYAQKQISKGECMYEI"
FT   regulatory      complement(60403..60415)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      60828..60834
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        60841..61605
FT                   /transl_table=11
FT                   /product="YqcI"
FT                   /db_xref="InterPro:IPR014988"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45944"
FT                   /protein_id="BAA12430.1"
FT                   /translation="MTELYAKSDLEKIKETLPGWQLDSFNYLNEKIGDKENKFPCIPGR
FT                   QAFLSDQLRIAFVGDPRNPETAKELAPLLTRYGTISRETGKYASLTVIFHTPEELLTDY
FT                   KIEDYESLFWQLLNSLSMEDPADWPDDIPENPDNFQWEYCFNGEPYFVLCATPAHSKRK
FT                   SRSFPYFMLTFQPRWVFEDLNDTTAFGRNMSKQIRKRLEAYDEVPIHPHLGWYGKKDNL
FT                   EWKQYFLRDDENQVSQCPFMKMKNLFKKERSD"
FT   regulatory      61961..61972
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        61977..62294
FT                   /transl_table=11
FT                   /product="YqcJ"
FT                   /db_xref="GOA:P45949"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45949"
FT                   /protein_id="BAA12431.1"
FT                   /translation="MDETKSELLRKYEQKFKALADQKRLEIMYELCQRGKTCVCDLTEI
FT                   FEVTQSKLSYHLKILLDANLITKETKGTWSYYDLNDEEVNGLLSEELCCIFRKKGEGDC
FT                   C"
FT   regulatory      62340..62347
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        62355..62795
FT                   /transl_table=11
FT                   /product="YqcK"
FT                   /db_xref="GOA:P45945"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45945"
FT                   /protein_id="BAA12432.1"
FT                   /translation="MKYVHVGVNVVSLEKSINFYEKVFGVKAVKVKTDYAKFLLETPGL
FT                   NFTLNVADEVKGNQVNHFGFQVDSLEEVLKHKKRLEKEGFFAREEMDTTCCYAVQDKFW
FT                   ITDPDGNEWEFSYTKSNSEVQKQDSSSCCVTPPSDITTNSCC"
FT   regulatory      62800..62809
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        62818..63858
FT                   /transl_table=11
FT                   /product="YqcL"
FT                   /db_xref="GOA:P45946"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45946"
FT                   /protein_id="BAA12433.1"
FT                   /translation="MKRLSFLDRYLTIWIFLAMALGIGLGFIFPSFVGGLNKLQVGTTS
FT                   IPLAIGLVLMMYPPLAKVRYEEIGRVFKDIKVLILSLVQNWIIGPTLMFILAIIFLPDK
FT                   PEYMIGLIMIGLARCIAMVIVWNDLSKGDTEYAAGLVAFNSIFQMLFSSVYAYIFVTVI
FT                   PQWLGMEGAVVNITMAEVAKSVFIYLGVPFIAGMVTRYIFVKVKGKEWYEKVFIPKISP
FT                   ITLIALLFTIIVMFSLKGDVIVSLPLDVVRVAIPLLIYFVLMFFVSFFLGKKIGANYAV
FT                   TTTLAFTAGSNNFELAIAVAVGVFGIHSGAAFAAVIGPLVEVPVMIALVKVALWFQRKY
FT                   FGSHSM"
FT   regulatory      63858..63863
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        63870..64289
FT                   /transl_table=11
FT                   /product="YqcM"
FT                   /db_xref="GOA:P45947"
FT                   /db_xref="InterPro:IPR014064"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="PDB:1JL3"
FT                   /db_xref="PDB:1Z2D"
FT                   /db_xref="PDB:1Z2E"
FT                   /db_xref="PDB:2IPA"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45947"
FT                   /protein_id="BAA12434.1"
FT                   /translation="MENKIIYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIEAHGLN
FT                   PNAVKAMKEVGIDISNQTSDIIDSDILNNADLVVTLCGDAADKCPMTPPHVKREHWGFD
FT                   DPARAQGTEEEKWAFFQRVRDEIGNRLKEFAETGK"
FT   regulatory      64725..64730
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        64738..66240
FT                   /transl_table=11
FT                   /product="SpoIVCA"
FT                   /db_xref="GOA:P17867"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17867"
FT                   /protein_id="BAA12435.1"
FT                   /translation="MIAIYVRVSTEEQAIKGSSIDSQIEACIKKAGTKDVLKYADEGFS
FT                   GELLERPALNRLREDASKGLISQVICYDPDRLSRKLMNQLIIDDELRKRNIPLIFVNGE
FT                   YANSPEGQLFFAMRGAISEFEKAKIKERTSSGRLQKMKKGMIIKDSKLYGYKFVKEKRT
FT                   LEILEEEAKIIRMIFNYFTDHKSPFFGRVNGIALHLTQMGVKTKKGAKVWHRQVVRQIL
FT                   MNSSYKGEHRQYKYDTEGSYVSKQAGNKSIIKIRPEEEQITVTIPAIVPAEQWDYAQEL
FT                   LGQSKRKHLSISPHNYLLSGLVRCGKCGNTMTGKKRKSHGKDYYVYTCRKNYSGAKDRG
FT                   CGKEMSENKLNRHVWGEIFKFITNPQKYVSFKEAEQSNHLSDELELIEKEIEKTKKGRK
FT                   RLLTLISLSDDDDLDIDEIKAQIIELQKKQNQLTEKCNRIQSKMKVLDDTSSSENALKR
FT                   AIDYFQSIGADNLTLEDKKTIVNFIVKEVTIVDSDTIYIETY"
FT   CDS_pept        complement(66148..66618)
FT                   /transl_table=11
FT                   /product="SpoIVCB"
FT                   /db_xref="GOA:P12254"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12254"
FT                   /protein_id="BAA12436.1"
FT                   /translation="MVTGVFAALGFVVKELVFLVSYVKNNAFPQPLSSSEEKKYLELMA
FT                   KGDEHARNMLIEHNLRLVAHIVKKFENTGEDAEDLISIGTIGLIKGIESYSAGKGTKVA
FT                   TYAARCIENEIVITKGGCIHPSLIRFNIYGVRIHNGNFFHDKVNNCFFIFKS"
FT   regulatory      complement(66624..66628)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      66803..66810
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        66814..67224
FT                   /transl_table=11
FT                   /product="NucB"
FT                   /db_xref="GOA:P42983"
FT                   /db_xref="InterPro:IPR029476"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42983"
FT                   /protein_id="BAA12437.1"
FT                   /translation="MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETG
FT                   SHIRDAIAEGHPDICTIDRDGADKRREESLKGIPTKPGYDRDEWPMAVCEEGGAGADVR
FT                   YVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ"
FT   CDS_pept        complement(67257..67982)
FT                   /transl_table=11
FT                   /product="YqeB"
FT                   /db_xref="GOA:P54447"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54447"
FT                   /protein_id="BAA12438.1"
FT                   /translation="MLQNQSHTLIGVTKTAVFFLYAALAIIGFAIGYFIPQIAKWALSL
FT                   PWIPLEGPLRLITLFSRVLQFHLSLLFSVCVRGFGSLILLLQCCCLSKLTDHTVEFIKG
FT                   KKVQTIHSDDIALVFMDHKRLVLLGTAGYELVREEIDEKPVNVEKAFRQHHYEWATDGD
FT                   PFKDQFRRWIPDAPDLSQGAHALLKARHKALQDEEKDDIEEFRLELAQLGIVVRDEGTR
FT                   QYWRKAETYPPKIQLGEGL"
FT   regulatory      complement(67984..67991)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      68221..68226
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        68234..69127
FT                   /transl_table=11
FT                   /product="YqeC"
FT                   /db_xref="GOA:P54448"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54448"
FT                   /protein_id="BAA12439.1"
FT                   /translation="MKIGLIGLGKMGINIGKQFIDRNHQVVGYDVNQAAVDELKAYGAE
FT                   GTTNLKEFISLLHPPRILWVMVPHGIVDAVLRDVSPLLSKGDMIIEAGNSHYKESIRRY
FT                   NQMKEAGIHYLDAGTSGGMEGARHGACFMVGGDHEAWEIVEPLFRDTAVENGYLYAGEA
FT                   GSGHFLKMIHNGIEYGMMAAIGEGFEVLENSQFDFDYEKVARVWNHGSVIRSWLMGLTE
FT                   RAFAKDAKLDQIKGIMHSSGEGKWTVETALDLQTATPVIAMSLMMRYRSLTDDTFTGKV
FT                   VAALRNEFGGHATEKK"
FT   CDS_pept        complement(69146..69772)
FT                   /transl_table=11
FT                   /product="YqeD"
FT                   /db_xref="GOA:P54449"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54449"
FT                   /protein_id="BAA12440.1"
FT                   /translation="MLKKVIGILVIIAIISVGFFQKEAWLDAIKAGGMFSVLFSMLLIA
FT                   ADVFFPIVPFALIAALNGAVFGTANGIWITLTGSMLGTILLFFLARYSFRDWARKKVQA
FT                   YPAIQSYEASFNKNAFTAVLLGRLIPVIPSLVMNVICGLSQVRWHVFFFASLIGKIPNI
FT                   VVVTIAGANFTSNKLLSISIYGTYILIIMLVIYKKFPHLLKVPKK"
FT   regulatory      complement(69781..69788)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      69947..69951
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        69959..70711
FT                   /transl_table=11
FT                   /product="YqeE"
FT                   /db_xref="GOA:P54450"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54450"
FT                   /protein_id="BAA12441.1"
FT                   /translation="MVTIKKDFIPVSNDNRPGYAMAPAYITVHNTANTAKGADAKMHAK
FT                   FVKNPNTSESWHFTVDDSVIYQHLPIDENGWHAGDGTNGTGNRKSIGIEICENADGDFE
FT                   KATSNAQWLIRKLMKENNIPLNRVVPHKKWSGKECPRKLLDHWNSFLNGISSSDTPPKE
FT                   TSPSYPLPSGVIKLTSPYRKGTNILQLQKALAVLHFYPDKGAKNNGIDGVYGPKTANAV
FT                   KRFQLMNGLTADGIYGPKTKAKLKSKLK"
FT   regulatory      70951..70957
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        70963..71694
FT                   /transl_table=11
FT                   /product="YqeF"
FT                   /db_xref="GOA:P54451"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54451"
FT                   /protein_id="BAA12442.1"
FT                   /translation="MKHFIILFLLLFVTAGCEGRGYEDVVAFGDSNTRGSNWDYRDYPK
FT                   AQQWVNILKTAERGNLDILNAGIGGQTTEDARLRFQTDVLDQKPKYLFIMFGTNDAAIL
FT                   TEGKPRVSKQRFRENLVYFIEESRKHGIKPILMTCIPIIEGNGKHHLFYYSRYQAAAFE
FT                   PKGGARKWHNSYNDITRDVSKRLDVPLVDNWKHFIEADGGKATDEALIQSGLIDPSGNH
FT                   MTPKGARIVYEGIQDGQILQR"
FT   regulatory      72483..72492
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        72502..73020
FT                   /transl_table=11
FT                   /product="YqeG"
FT                   /db_xref="GOA:P54452"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54452"
FT                   /protein_id="BAA12443.1"
FT                   /translation="MLKKFFLPDEFVKNIFHITPEKLKERNVKGIITDLDNTLVEWDRP
FT                   NATPRLIEWFEEMKEHGIKVTIVSNNNERRVKLFSEPLGIPFIYKARKPMGKAFNRAVR
FT                   NMELKKEDCVVIGDQLLTDVLGGNRNGYHTILVVPVASSDGFITRFNRQVERRILSALK
FT                   RKGHIQWEE"
FT   regulatory      73011..73015
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        73024..74124
FT                   /transl_table=11
FT                   /product="YqeH"
FT                   /db_xref="GOA:P54453"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019988"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54453"
FT                   /protein_id="BAA12444.1"
FT                   /translation="MEKVVCIGCGVTIQTEDKTGLGYAPPASLTKENVICQRCFRLKNY
FT                   NEIQDVSLTDDDFLNILHGIGETDSLVVKIVDIFDFNGSWINGLQRLVGGNPILLVGNK
FT                   ADILPKSLKRERLIQWMKREAKELGLKPVDVFLVSAGRGQGIREVIDAIEHYRNGKDVY
FT                   VVGCTNVGKSTFINRIIKEVSGEEDIITTSQFPGTTLDAIEIPLDDGSSLYDTPGIINN
FT                   HQMAHYVNKKDLKILSPKKELKPRTFQLNDQQTLYFGGLARFDYVSGERSPFICYMPNE
FT                   LMIHRTKLENADALYEKHAGELLTPPGKDEMDEFPELVAHTFTIKDKKTDIVFSGLGWV
FT                   TVHDADKKVTAYAPKGVHVFVRRSLI"
FT   regulatory      74134..74140
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        74142..74984
FT                   /transl_table=11
FT                   /product="AroD"
FT                   /db_xref="GOA:P54374"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54374"
FT                   /protein_id="BAA12445.1"
FT                   /translation="MKKLYGVIGNPIGHSMSPDIHNASLKDLGLDGHYHAFKVEENDLE
FT                   DAVKGIRALGVQGINVTVPHKVSIMDYLDHIDESAKVLGAVNTVRREGDKLVGYNTDGE
FT                   GFVKSLMKVLDKPISELSFLMIGAGGAARAIFTTFVRNTPKKFDICNRTLEKAKRLTEA
FT                   TPSFHNKEVLSIKEAEERLEQYDVIIHTTSVGMYPNVDDVPLSLQRAASSAVVCDIVYN
FT                   PIQTALLKEASQKGLKTLDGVGMFVEQAALSFQLWTGQEPNIEKMRSIVIGKLGGTEC"
FT   regulatory      74966..74971
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        74978..75268
FT                   /transl_table=11
FT                   /product="YqeI"
FT                   /db_xref="GOA:P54454"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54454"
FT                   /protein_id="BAA12446.1"
FT                   /translation="MLTGKQKRFLRSKAHHLTPIFQVGKGGVNDNMIKQIAEALEAREL
FT                   IKVSVLQNCEEDKNDVAEALVKGSRSQLVQTIGNTIVLYKESKENKQIELP"
FT   regulatory      75267..75275
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        75280..75849
FT                   /transl_table=11
FT                   /product="YqeJ"
FT                   /db_xref="GOA:P54455"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="PDB:1KAM"
FT                   /db_xref="PDB:1KAQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54455"
FT                   /protein_id="BAA12447.1"
FT                   /translation="MKKIGIFGGTFDPPHNGHLLMANEVLYQAGLDEIWFMPNQIPPHK
FT                   QNEDYTDSFHRVEMLKLAIQSNPSFKLELVEMEREGPSYTFDTVSLLKQRYPNDQLFFI
FT                   IGADMIEYLPKWYKLDELLNLIQFIGVKRPGFHVETPYPLLFADVPEFEVSSTMIRERF
FT                   KSKKPTDYLIPDKVKKYVEENGLYES"
FT   regulatory      75824..75828
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        75839..76399
FT                   /transl_table=11
FT                   /product="YqeK"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54456"
FT                   /protein_id="BAA12448.1"
FT                   /translation="MNREEALACVKQQLTEHRYIHTVGVMNTAIELAERFGADSKKAEI
FT                   AAIFHDYAKFRPKEEMKQIIAREKMPAHLLDHNPELWHAPVGAYLVQREAGVQDEDILD
FT                   AIRYHTSGRPGMTLLEKVIYVADYIEPNRAFPGVDEVRKLAETDLNQALIQSIKNTMVF
FT                   LMKKNQPVFPDTFLTYNWLVSGS"
FT   regulatory      76402..76407
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        76417..76773
FT                   /transl_table=11
FT                   /product="YqeL"
FT                   /db_xref="GOA:P54457"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54457"
FT                   /protein_id="BAA12449.1"
FT                   /translation="MNQKSILKIAAAACDDKRAEDILALDMEGISLVADYFLICHGNSD
FT                   KQVQAIAREIKDQADENGIQVKKMEGFDEARWVLVDLGDVVVHVFHKDERSYYNLEKLW
FT                   GDAPLADLDFGMNQ"
FT   regulatory      76759..76765
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        76770..77513
FT                   /transl_table=11
FT                   /product="YqeM"
FT                   /db_xref="GOA:P54458"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54458"
FT                   /protein_id="BAA12450.1"
FT                   /translation="MIYQGFASVYDELMSHAPYDQWTKWIEASLPEKGRILDLACGTGE
FT                   ISIRLAEKGFEVTGIDLSEEMLSFAQQKVSSSQPILFLQQDMREITGFDGQFDAVVICC
FT                   DSLNYLKTKNDVIETFKSVFRVLKPEGILLFDVHSSFKIAEVFPDSTFADQDEDISYIW
FT                   QSFAGSDELSVIHDMSFFVWNGEAYDRFDETHEQRTFPVEEYEEMLKNCGFQLHRVTAD
FT                   FTDTEPSAQSERLFFKAQKSKTIVS"
FT   CDS_pept        complement(77579..78400)
FT                   /transl_table=11
FT                   /product="ComED"
FT                   /db_xref="GOA:P39696"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39696"
FT                   /protein_id="BAA12451.1"
FT                   /translation="MKIGFIGTGNMGTILIESFIESKAADPSNMTITNRTIEKALHIKN
FT                   RYNSINVTESLEKLVSENEMIFICVKPLDIYPLLARALPYLRKDHILISITSPVQTEQL
FT                   EQYVPCQVARVIPSITNRALAGVSLVTFGTSCGESAKAKINELMQHISHPLQIESDITR
FT                   VASDIVSCGPAFMSYLIQRFIDAAVSETSVSKQDAILMCKEMLVGMGKLLETELYTLPA
FT                   LQEKVCVKGGVTGEGIKALESGVQDMFHRVFQNTHMKYEEDISAVKKQFHV"
FT   regulatory      complement(78409..78416)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      78465..78471
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        78484..79101
FT                   /transl_table=11
FT                   /product="ComEA"
FT                   /db_xref="GOA:P39694"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR004787"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39694"
FT                   /protein_id="BAA12452.1"
FT                   /translation="MNWLNQHKKAIILAASAAVFTAIMIFLATGKNKEPVKQAVPTETE
FT                   NTVVKQEANNDESNETIVIDIKGAVQHPGVYEMRTGDRVSQAIEKAGGTSEQADEAQVN
FT                   LAEILQDGTVVYIPKKGEETAVQQGGGGSVQSDGGKGALVNINTATLEELQGISGVGPS
FT                   KAEAIIAYREENGRFQTIEDITKVSGIGEKSFEKIKSSITVK"
FT   regulatory      79156..79160
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        79168..79737
FT                   /transl_table=11
FT                   /product="ComEB"
FT                   /db_xref="GOA:P32393"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR013404"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32393"
FT                   /protein_id="BAA12453.1"
FT                   /translation="MERISWNQYFMAQSHLLALRSTCPRLSVGATIVRDKRMIAGGYNG
FT                   SIAGGVHCADEGCLMIDDHCARTIHAEMNAILQCSKFGVPTDGAEIYVTHYPCIQCCKS
FT                   IIQAGIKTVYYAEDYKTHPYAQELFEQAGVTVEQVELDEMIVDLKNREKLSFVAGLIGK
FT                   LADAGLAEEELKKIHEQANTLFTSYV"
FT   regulatory      79732..79738
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        79741..82071
FT                   /transl_table=11
FT                   /product="ComEC"
FT                   /db_xref="GOA:P39695"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR004797"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39695"
FT                   /protein_id="BAA12454.1"
FT                   /translation="MRNSRLLLPMAAASATAGITAAAYFPAIFLFILFLLIILIKTRHA
FT                   FLIIVCFFSFILFFVLYAVTDSQNVSSYRQGTYQFKAVIDTIPKIDGDRMSMMVETPDK
FT                   EKWAAAYRIQSAGEKEQLLYIEPGMSCELTGTLEEPNHATVPGAFDYNEYLYRQHIHWN
FT                   YSVTSIQNCSEPENFKYKVLSLRKHIISFTNSLLPPDSTGIVQALTVGDRFYVEDEVLT
FT                   AYQKLGVVHLLAISGLHVGILTAGLFYIMIRLGITREKASILLLLFLPLYVMLTGAAPS
FT                   VLRAALMSGVYLAGSLVKWRVRSATAICLSYIVLLLFNPYHLFEAGFQLSFAVSFSLIL
FT                   SSSIFQQVKTSLGQLTIVSLIAQLGSLPILLYHFHQFSIISVPMNMLMVPFYTFCILPG
FT                   AVAGVLLLSLSASFGRLFFSWFDLLISWINRLITNIADVDVFTIMIAHPAPVLLFLFTV
FT                   TIILLLMAIEKRSLSQLMVTGGICCTVMFLLFIYPCLSSEGEVDMIDIGQGDSMFVGAP
FT                   HQRGRVLIDTGGTLSYSSEPWREKQHPFSLGEKVLIPFLTAKGIKQLDALILTHADQDH
FT                   IGEAEILLKHHKVKRLVIPKGFVSEPKDEKVLQAAREEGVAIEEVKRGDVLQIKDLQFH
FT                   VLSPEAPDPASKNNSSLVLWMETGGMSWILTGDLEKEGEQEVMNVFPNIKADVLKVGHH
FT                   GSKGSTGEEFIQQLQPKTAIISAGKNNRYHHPHQKVLQLLQRHSIRVLRTDQNGTIQYR
FT                   YKNRVGTFSVYPPYDTSDITETN"
FT   regulatory      82453..82461
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        82475..83518
FT                   /transl_table=11
FT                   /product="YqeN"
FT                   /db_xref="GOA:P54459"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:3ZH9"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54459"
FT                   /protein_id="BAA12455.1"
FT                   /translation="MVFDVWKSLKKGEVHPVYCLYGKETYLLQETVSRIRQTVVDQETK
FT                   DFNLSVFDLEEDPLDQAIADAETFPFMGERRLVIVKNPYFLTGEKKKEKIEHNVSALES
FT                   YIQSPAPYTVFVLLAPYEKLDERKKLTKALKKHAFMMEAKELNAKETTDFTVNLAKTEQ
FT                   KTIGTEAAEHLVLLVNGHLSSIFQEIQKLCTFIGDREEITLDDVKMLVARSLEQNIFEL
FT                   INKIVNRKRTESLQIFYDLLKQNEEPIKIMALISNQFRLILQTKYFAEQGYGQKQIASN
FT                   LKVHPFRVKLAMDQARLFSEEELRLIIEQLAVMDYEMKTGKKDKQLLLELFLLQLLKRN
FT                   EKNDPHY"
FT   CDS_pept        complement(83533..83799)
FT                   /transl_table=11
FT                   /product="YqeO"
FT                   /db_xref="GOA:P21477"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21477"
FT                   /protein_id="BAA12456.1"
FT                   /translation="MPNIKSAIKRTKTNNERGVHNATIKSAMRTAIKQVEASVANNEAD
FT                   KAKTALTEAAKRIDKAVKTGLVHKNTAARYKSRLAKKVNGLSA"
FT   regulatory      complement(83805..83813)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      83989..83995
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        84003..85109
FT                   /transl_table=11
FT                   /product="Gpr"
FT                   /db_xref="GOA:P22322"
FT                   /db_xref="InterPro:IPR005080"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22322"
FT                   /protein_id="BAA12457.1"
FT                   /translation="MKKSELDVNQYLIRTDLAVETKEAMANQQAVPTKEIKGFIEKERD
FT                   HGGIKIRTVDVTKEGAELSGKKEGRYLTLEAQGIRENDSEMQEKVSAVFAEEFSAFLEN
FT                   LNISKDASCLIVGLGNWNVTPDALGPMAVENLLVTRHLFKLQPENVQEGYRPVSAFAPG
FT                   VMGITGIETSDIIKGVIEQSKPDFVIAIDALAARAVERVNTTIQISDTGIHPGSGVGNK
FT                   RKDLSKDTLGVPVIAIGVPTVVDAVTIASDTVDYILKHFGREMKDNRPSRSLVPAGMTF
FT                   GKKKVLTEDDLPDQKQRQSFLGIVGTLQEDEKRQLIHEVLSPLGHNLMVTPKEVDSFID
FT                   DMANVLANGLNTALHEKVSQENKGSYNH"
FT   regulatory      85161..85165
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        85172..86377
FT                   /transl_table=11
FT                   /product="SpoIIP"
FT                   /db_xref="GOA:P37968"
FT                   /db_xref="InterPro:IPR010897"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37968"
FT                   /protein_id="BAA12458.1"
FT                   /translation="MRNKRRNRQIVVAVNGGKAVKAIFLFIVSLIVIFVLSGVLTSLRP
FT                   ELRPSSDSFYGIAEELPGDVFAHLLQMENHYFASDLSQTDSSFHLSRLSLKLATSINLE
FT                   DPRSFLGRELPGFAQFDTEILLAGQGTDYTNMPAESPPPSKVMEEEREANLAEIEKQQT
FT                   QSDNAQKDPPKQTTGDKKVVFIYHTHNTESYLPLLKGETDPDMARHSKANVTLVGDMFG
FT                   QALESQGIGATVNKTDIQSKLNKKGLNYARSYDESRPVVKDALASNKNLQYIIDIHRDS
FT                   RRKKDTTATIKGKSYARVAFVVGKKSKNFEENYKIASELHKLMEKKYPGLSTGVFSKGS
FT                   PGDNGVYNQDLTDRALLLEFGGVDNNLEELQRAANAAADVFSEMYWDAEKVNAASGETK
FT                   KQ"
FT   regulatory      86383..86389
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        86394..86732
FT                   /transl_table=11
FT                   /product="YqeP"
FT                   /db_xref="InterPro:IPR020534"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38425"
FT                   /protein_id="BAA12459.1"
FT                   /translation="MIAYFGKCLLLVTIMFLGVLFGMQQANHGMLSMKGYHDPSLKGAF
FT                   TLTDGKDNEKEASILGETVTAKDLVEKQKELEKVETFNMFSKAGKALSDTVTNTAQSMY
FT                   EWIRDMNQ"
FT   regulatory      86852..86860
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        86866..88704
FT                   /transl_table=11
FT                   /product="YqeQ"
FT                   /db_xref="GOA:P37949"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37949"
FT                   /protein_id="BAA12460.1"
FT                   /translation="MTDKEKRLERQSRIRNFSIIAHIDHGKSTLADRILEKTSAITQRE
FT                   MKEQLLDSMDLERERGITIKLNSVQLKYKAKDGEEYIFHLIDTPGHVDFTYEVSRSLAA
FT                   CEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPSAEPERVRQEVEDVIGL
FT                   DASEAVLASAKAGIGIEEILEQIVEKVPAPTGDPEAPLKALIFDSLYDAYRGVVAYIRV
FT                   VEGTVKPGQKIKMMATGKEFEVTEVGVFTPKATPTNELTVGDVGFLTASIKNVGDTRVG
FT                   DTITSAANPAEEALPGYRKLNPMVYCGLYPIDTAKYNDLREALEKLELNDSSLQYEAET
FT                   SQALGFGFRCGFLGMLHMEIIQERIEREFNIDLITTAPSVIYDVYMTDGEKVVVDNPSN
FT                   MPDPQKIERVEEPYVKATMMVPNDYVGAVMELCQGKRGNFIDMQYLDANRVSIIYDMPL
FT                   AEIVYEFFDQLKSSTKGYASFDYELIGYKPSKLVKMDIMLNGEKIDALSFIVHRDYAYE
FT                   RGKVIVEKLKELIPRQQFEVPVQAAIGQKIVARSTIKAMRKNVLAKCYGGDISRKRKLL
FT                   EKQKEGKRRMKQVGSVEVPQEAFMAVLKMDDSPKKQ"
FT   regulatory      88741..88751
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        88757..89857
FT                   /transl_table=11
FT                   /product="YqeR"
FT                   /db_xref="GOA:P54304"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54304"
FT                   /protein_id="BAA12461.1"
FT                   /translation="MKSAYIHIPFCEHICHYCDFNKYFIQSQPVDEYLNALEQEMINTI
FT                   AKTGQPDLKTIFIGGGTPTSLSEEQLKKLMDMINRVLKPSSDLSEFAVDANPDDLSAEK
FT                   LKILKEAGVNRLSFGVQTFEDDLLEKIGRVHKQKDVFTSFERAREIGFENISLDLMFGL
FT                   PGQTLKHLEHSINTALSLDAEHYSVYSLIVEPKTVFYNLMQKGRLHLPPQEQEAEMYEI
FT                   VMSKMEAHGIHQYEISNFAKAGMESKHNLTYWSNEQYFGFGAGAHGYIGGTRTVNVGPV
FT                   KHYIDLIAEKGFPYRDTHEVTTEEQIEEEMFLGLRKTAGVSKKRFAEKYGRSLDGLFPS
FT                   VLKDLAEKGLIHNSESAVYLTHQGNY"
FT   regulatory      89965..89972
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        89977..91008
FT                   /transl_table=11
FT                   /product="YqeS"
FT                   /db_xref="GOA:P25499"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25499"
FT                   /protein_id="BAA12462.1"
FT                   /translation="MLTNRQLLILQVIINDFIKSAQPVGSRTLSKKDEITFSSATIRNE
FT                   MADLEELGFIEKTHSSSGRVPSEKGYRYYVDHLLSPVKLTKSDLDQIHSIFKEKIFELE
FT                   KTVQKSAQILSDLTNYTSIVLGPKLSENYLKQIQIIPIQPDMAVAILVTNTGHVENKTI
FT                   NFPTKMDLSDIEKLVNILNDRLSGVPMDELNERIFKEVVMYLRQHIKNYDNILDALRST
FT                   FHSTNHVEKLFFGGKINMLNQPEFHDITRVRSLLSLIEKEQDVLKLVQSPHTGISIKIG
FT                   KENDYEEMENCSLITASYSVDQKQIGSIAIIGPTRMNYSRVVSLLQHVTSDLSKALTSL
FT                   YDE"
FT   regulatory      91067..91074
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        91080..91643
FT                   /transl_table=11
FT                   /product="GrpE"
FT                   /db_xref="GOA:P15874"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="PDB:2G61"
FT                   /db_xref="UniProtKB/Swiss-Prot:P15874"
FT                   /protein_id="BAA12463.1"
FT                   /translation="MSEEKQTVEQNETEEQEIIEEQAAADEQQEETNESELLQNQINEL
FT                   QGLLEEKENKLLRVQADFENYKRRSRLEMEASQKYRSQNIVTDLLPALDSFERALQVEA
FT                   DNEQTKSLLQGMEMVHRQLVEALKKEGVEAIEAVGQEFDPNLHQAVMQAEDENYGSNIV
FT                   VEEMQKGYKLKDRVIRPSMVKVNQ"
FT   regulatory      91653..91659
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        91667..93502
FT                   /transl_table=11
FT                   /product="DnaK"
FT                   /db_xref="GOA:P17820"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="PDB:2FZO"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17820"
FT                   /protein_id="BAA12464.1"
FT                   /translation="MSKVIGIDLGTTNSCVAVLEGGEPKVIANAEGNRTTPSVVAFKNG
FT                   ERQVGEVAKRQSITNPNTIMSIKRHMGTDYKVEIEGKDYTPQEVSAIILQHLKSYAESY
FT                   LGETVSKAVITVPAYFNDAERQATKDAGKIAGLEVERIINEPTAAALAYGLDKTDEDQT
FT                   ILVYDLGGGTFDVSILELGDGVFEVRSTAGDNRLGGDDFDQVIIDHLVSEFKKENGIDL
FT                   SKDKMALQRLKDAAEKAKKDLSGVSSTQISLPFITAGEAGPLHLELTLTRAKFEELSSH
FT                   LVERTMGPVRQALQDAGLSASEIDKVILVGGSTRIPAVQEAIKKETGKEAHKGVNPDEV
FT                   VALGAAIQGGVITGDVKDVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFSTA
FT                   ADNQTAVDIHVLQGERPMSADNKTLGRFQLTDIPPAPRGVPQIEVSFDIDKNGIVNVRA
FT                   KDLGTGKEQNITIKSSSGLSDEEIERMVKEAEENADADAKKKEEIEVRNEADQLVFQTE
FT                   KTLKDLEGKVDEEQVKKANDAKDALKAAIEKNEFEEIKAKKDELQTIVQELSMKLYEEA
FT                   AKAQQAQGGANAEGKADDNVVDAEYEEVNDDQNKK"
FT   regulatory      93687..93695
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        93702..94820
FT                   /transl_table=11
FT                   /product="DnaJ"
FT                   /db_xref="GOA:P17631"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17631"
FT                   /protein_id="BAA12465.1"
FT                   /translation="MSKRDYYEVLGVSKSASKDEIKKAYRKLSKKYHPDINKEAGSDEK
FT                   FKEVKEAYETLSDDQKRAHYDQFGHTDPNQGFGGGGFGGGDFGGFGFDDIFSSIFGGGT
FT                   RRRDPKLRARGADLQYTMTLSFEDAAFGKETTIEIPREETCETCKGSGAKPGTNPETCS
FT                   HCGGSGQLNVEQNTPFGKVVNRRVCHHCEGTGKIIKNKCADCGGKGKIKKRKKINVTIP
FT                   AGVDDGQQLRLSGQGEPGINGGLPDLFVVFHVRAHEFFERDGDDIYCEMPLTFAQAALG
FT                   DEVEVPTLHGKVKIPAGTQTGTKFRLRGKGVQNVRGYGQGDQHIVVRVVTPTNLTDKQK
FT                   DIIREFAEVSGNLPDEQEMSFFDKVKRAFKGD"
FT   regulatory      94831..94835
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        94845..95780
FT                   /transl_table=11
FT                   /product="YqeT"
FT                   /db_xref="GOA:P54460"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54460"
FT                   /protein_id="BAA12466.1"
FT                   /translation="MKWSELSIHTTHEAVEPISNILHEAGASGVVIEDPLDLIKERENV
FT                   YGEIYQLDPNDYPDEGVIVKAYLPVNSFLGETVDGIKETINNLLLYNIDLGRNHITISE
FT                   VNEEEWATAWKKYYHPVKISEKFTIVPTWEEYTPVHTDELIIEMDPGMAFGTGTHPTTV
FT                   LCIQAHERFVQKGDKVIDVGTGSGILSIAAAMLEAESVHAYDLDPVAVESARLNLKLNK
FT                   VSDIAQVKQNNLLDGIEGEHDVIVANILAEVILRFTSQAYRLLKEGGHFITSGIIGHKK
FT                   QVVKEALEQAGFTIVEILSMEDWVSIIAKK"
FT   regulatory      95786..95793
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        95803..96573
FT                   /transl_table=11
FT                   /product="YqeU"
FT                   /db_xref="GOA:P54461"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="PDB:1VHK"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54461"
FT                   /protein_id="BAA12467.1"
FT                   /translation="MQRYFIELTKQQIEEAPTFSITGEEVHHIVNVMRMNEGDQIICCS
FT                   QDGFEAKCELQSVSKDKVSCLVIEWTNENRELPIKVYIASGLPKGDKLEWIIQKGTELG
FT                   AHAFIPFQAARSVVKLDDKKAKKKRERWTKIAKEAAEQSYRNEVPRVMDVHSFQQLLQR
FT                   MQDFDKCVVAYEESSKQGEISAFSAIVSSLPKGSSLLIVFGPEGGLTEAEVERLTEQDG
FT                   VTCGLGPRILRTETAPLYALSAISYQTELLRGDQ"
FT   regulatory      96558..96568
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        96573..97928
FT                   /transl_table=11
FT                   /product="YqeV"
FT                   /db_xref="GOA:P54462"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034557"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54462"
FT                   /protein_id="BAA12468.1"
FT                   /translation="MATVAFHTLGCKVNHYETEAIWQLFKEAGYERRDFEQTADVYVIN
FT                   TCTVTNTGDKKSRQVIRRAIRQNPDGVICVTGCYAQTSPAEIMAIPGVDIVVGTQDREK
FT                   MLGYIDQYREERQPINGVSNIMKARVYEELDVPAFTDRTRASLKIQEGCNNFCTFCIIP
FT                   WARGLLRSRDPEEVIKQAQQLVDAGYKEIVLTGIHTGGYGEDMKDYNFAKLLSELDTRV
FT                   EGVKRIRISSIEASQITDEVIEVLDRSDKIVNHLHIPIQSGSNTVLKRMRRKYTMEFFA
FT                   DRLNKLKKALPGLAVTSDVIVGFPGETEEEFMETYNFIKEHKFSELHVFPYSKRTGTPA
FT                   ARMEDQVDENVKNERVHRLIALSDQLAKEYASQYENEVLEIIPEEAFKETEEENMFVGY
FT                   TDNYMKVVFKGTEDMIGKIVKVKILKAGYPYNEGQFVRVVEDEITEHMRLSS"
FT   CDS_pept        complement(97965..98897)
FT                   /transl_table=11
FT                   /product="YqeW"
FT                   /db_xref="GOA:P54463"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54463"
FT                   /protein_id="BAA12469.1"
FT                   /translation="MNRMLILISFTALILSFLAGMNMLRKGLISMAYSKIEERLLLFTD
FT                   HPLKAFLISIVFTGILQSSSAFMVIVIGFVSAGVLSFKRTIPMILGTNVGSTFTTEFIA
FT                   IKMDIVIWVLLIGGLLFFLTGRYPLKQLGTSFLGLGIIFFCISGFSHLAGPLTKLKTGA
FT                   DVLYHVNDSNWSALLIGMVLTAIIHSSSVCIGILMSFMNEGIIGLTQAMSVVLGSNIGT
FT                   CITAVMAAVSGGYAAKQTAYAHVVFNVLGVALVLPFLTAATGFVEQLSPDPAQKIAHFS
FT                   LLFNVVTALLFLPLTNLFYRLIHLLIPAK"
FT   regulatory      complement(98900..98907)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      99048..99052
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        99061..99234
FT                   /transl_table=11
FT                   /product="YqeX"
FT                   /db_xref="GOA:P21478"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21478"
FT                   /protein_id="BAA12470.1"
FT                   /translation="MSKTVVRKNESLEDALRRFKRSVSKTGTLQEARKREFYEKPSVKR
FT                   KKKSEAARKRKF"
FT   regulatory      99234..99243
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        99249..99695
FT                   /transl_table=11
FT                   /product="YqeY"
FT                   /db_xref="GOA:P54464"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="PDB:1NG6"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54464"
FT                   /protein_id="BAA12471.1"
FT                   /translation="MSLLERLNQDMKLYMKNREKDKLTVVRMVKASLQNEAIKLKKDSL
FT                   TEDEELTVLSRELKQRKDSLQEFSNANRLDLVDKVQKELDILEVYLPEQLSEEELRTIV
FT                   NETIAEVGASSKADMGKVMGAIMPKVKGKADGSLINKLVSSQLS"
FT   regulatory      99807..99813
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        99826..101139
FT                   /transl_table=11
FT                   /product="YqeZ"
FT                   /db_xref="GOA:P54465"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR002825"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54465"
FT                   /protein_id="BAA12472.1"
FT                   /translation="MLQIKGFRAALLGIFLLSLLGVQLNAKAEKQTVYVIPVEKNVEQG
FT                   LASFLSRSLQDAKDAHADHIILDINTPGGLVKSAIDMADLITESEIPVTAYVNKRALSA
FT                   GAYIALQADHIYMAPGGKMGAAAIVDGQGNAADQKAQSLWLAEMEDAAVKNNRDPKYAL
FT                   AMADPDIDAKEVGAPKGDLLTLNADKAIEVGYSEGTADNLSTLVKKLGFEKAQISYAKE
FT                   SFAEKTARWLTNPVIVPILLTIAFLGLTVELFSPGVGLPGTAGLIALLLFFYGHLAAGL
FT                   AGYETVLLFIAGVILILLEIFLPGGIIGLLGLGAIIASLFLAAGSFTVMAVSLLIASAV
FT                   SITAFILLTRVLGKRMKFFKKLILNDSTNTESGYVSNQTRTDLMGKVGITFTPLRPSGT
FT                   VIIDDERLDVVSEGSFTEKDKKVKVIKVEGSRIVVREI"
FT   regulatory      101149..101153
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        101161..102156
FT                   /transl_table=11
FT                   /product="YqfA"
FT                   /db_xref="GOA:P54466"
FT                   /db_xref="InterPro:IPR022853"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54466"
FT                   /protein_id="BAA12473.1"
FT                   /translation="MDPSTLMILAIVAVAIIVLAVFFTFVPVMLWISALAAGVKISIFT
FT                   LVGMRLRRVIPNRVVNPLIKAHKAGLNVGTNQLESHYLAGGNVDRVVNALIAAQRANIE
FT                   LTFERCAAIDLAGRDVLEAVQMSVNPKVIETPFIAGVAMDGIEVKAKARITVRANIERL
FT                   VGGAGEETIVARVGEGIVSTIGSSDNHKKVLENPDMISQTVLGKGLDSGTAFEILSIDI
FT                   ADVDIGKNIGAILQTDQAEADKNIAQAKAEERRAMAVAQEQEMRARVEEMRAKVVEAEA
FT                   EVPLAMAEALREGNIGVMDYMNIKNIDADTEMRDSFGKLTKDPSDEDRKS"
FT   regulatory      102170..102173
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        102181..102600
FT                   /transl_table=11
FT                   /product="YqfB"
FT                   /db_xref="GOA:P54467"
FT                   /db_xref="InterPro:IPR016788"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54467"
FT                   /protein_id="BAA12474.1"
FT                   /translation="MEDLLTNPLIIAAIIGIISAIFGKKSKEEKQNSQKRKKPQHVQSA
FT                   SPQKKQSKEDAPAPIPNRMVQARREAEERRRETARNLKGLERDLAAAKQKTVYTKQKML
FT                   QVNKDTVVQGIVLGEVFGPPRAKKPHRTMRPARKN"
FT   regulatory      102638..102645
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        102657..102938
FT                   /transl_table=11
FT                   /product="YqfC"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR022477"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54468"
FT                   /protein_id="BAA12475.1"
FT                   /translation="MGQRKNRMKAWLTRALEIPPDVMMDLPRITMVGRLHIYIENHRGL
FT                   LLFSENEVRLMLKQGQCIISGKNFVIKAILPEEILLEGTIDVVRYVES"
FT   regulatory      102944..102949
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        102957..104153
FT                   /transl_table=11
FT                   /product="YqfD"
FT                   /db_xref="GOA:P54469"
FT                   /db_xref="InterPro:IPR010690"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54469"
FT                   /protein_id="BAA12476.1"
FT                   /translation="MKNKWLSFFSGKVQLELTGRGIERLLNECTKQGIPVFHVKKKKEA
FT                   VSLYIQLQDVHAFRRVRSKFKCKARFINRKGFPFLLLKSKLNIGFTIGFAIFFILLFLL
FT                   SNMVWKIDVTGAKPETEHQMRQHLNEIGVKKGRLQFLMMSPEKIQKSLTNGIDNITWVG
FT                   VDLKGTTIHMKVVEKNEPEKEKYVSPRNIVAKKKATITRMSVQKGQPMAAIHDHVEKGQ
FT                   LLVSGLIGSEDHQQEVASKAEIYGETWYRSEVTVPLETLFNVYTGKVRTKHKLSFGSLA
FT                   IPIWGMTFKKEELKHPKTEQEKHSLHFLGFKLPVSYVKEQTRESEEALRKYTKEEAVQE
FT                   GIKLGKQDVEDKIGENGEVKSEKVLHQTVENGKVKLIILYQVIEDIVQTTPIVRETEE"
FT   regulatory      104138..104141
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        104150..105109
FT                   /transl_table=11
FT                   /product="YqfE"
FT                   /db_xref="GOA:P46343"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46343"
FT                   /protein_id="BAA12477.1"
FT                   /translation="MTEHLLAMNQKLKNPDEALSLFGNQDSFLKLMEKDLNLNIITRGE
FT                   TIYVSGDDESFQIADRLLGSLLALIRKGIEISERDVIYAIKMAKKNELEYFESMYEEEI
FT                   TKNAKGKSIRVKTMGQREYVAAMKRNDLVFGIGPAGTGKTYLAVVKAVHALKNGHIKKI
FT                   ILTRPAVEAGESLGFLPGDLKEKVDPYLRPLYDALHDVLGADHTERLMERGIIEIAPLA
FT                   YMRGRTLDDAYVILDEAQNTTPAQMKMFLTRLGFSSKMIITGDVSQIDLPKGVKSGLAV
FT                   AKEMLKGIDGISMIELDQTDVVRHPLVAKIIEAYDKQN"
FT   regulatory      105177..105183
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        105188..107323
FT                   /transl_table=11
FT                   /product="YqfF"
FT                   /db_xref="GOA:P46344"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR011621"
FT                   /db_xref="InterPro:IPR011624"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46344"
FT                   /protein_id="BAA12478.1"
FT                   /translation="MLKKKAKTKSSSKKWSSFKNARSMHVLLYLLLAAIMFALLFVHVK
FT                   PETLDLDLFSVSDKTIYAPATVEDQKATEEKKQAAEDAVEDQYTLKKEYTDNRIDLVSS
FT                   IFDSISEVKKSSEEGSKSPSEKSMVKSVKDKLTSDVNDSISEDSIKTLLKADSEDFSFV
FT                   RDTVITAVNTVMSSEIPSDKLSDAKDKVEKELKSNSIPSKYLGAATEIGRFAIIPNYVF
FT                   DPKATEAKRQEASDNVQQVQIKQGQVLVEENDLIDREVYRKLELTGLLNNSNLFKPISG
FT                   LLIMIGLFIATLVYYFEKQKQNLKFKNQSILLFSIITTLLLVIMEVVSLFQKMEYNNIG
FT                   YLVPIAAGAILIKLLMNERIAILGSIILAICGSMMFNQGVTGTFNYVIGIYYLISGISG
FT                   VLFLGKHNARSKILQTGLFVAFINMVVVLSLLLIQNTALSGLEIGTLMLMGVVSGFASS
FT                   VLIIGLMPFFETGFGILSTMRLLELSNPNHPLLRKILTETPGTYHHSVMVANLSEAACE
FT                   AVGANGLLARVGAYYHDLGKTKRPQYFIENQMNIDNPHDKLSPQLSKNIIISHTTDGAN
FT                   MLRSYKFPKELVDIAEQHHGTSLLKFFYYKAKEKGDQITEEEFRYPGPKPQSKEAAIIS
FT                   VADSVEAAVRSMHNPNPERIEKLVRGIISDKLQDGQFSECDLTFKELDTIAKTLCATLK
FT                   GIFHSRIEYPEATKKVK"
FT   regulatory      107309..107318
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        107324..107797
FT                   /transl_table=11
FT                   /product="YqfG"
FT                   /db_xref="GOA:P46347"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46347"
FT                   /protein_id="BAA12479.1"
FT                   /translation="MSLLIDIVDETGSVSEEMLKEVENLLQFAAEREGVQDQAEVSVTI
FT                   VSNDDIHQINKEYRGKDAPTDVISFALEEEGEGEIEIVGAEMPPVLGNIIISADRTREQ
FT                   AEEYNHSFKRELGFLAVHGFLHLLGYDHMTKEEEEEMFTKQKELLDAYGLKRS"
FT   regulatory      107787..107791
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        107804..108148
FT                   /transl_table=11
FT                   /product="DgkA"
FT                   /db_xref="GOA:P19638"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033717"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19638"
FT                   /protein_id="BAA12480.1"
FT                   /translation="MNRFFKSFVHAGRGIWETARTERNFQFHAAAACAVLICGFLVELS
FT                   IIEWMIIFLLIGGMFSLELLNTAIEHTVDLITDKHHPLAKAAKDAAAGAVCVFAVISCI
FT                   IGLLIFLPKL"
FT   regulatory      108254..108257
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        108267..108677
FT                   /transl_table=11
FT                   /product="Cdd"
FT                   /db_xref="GOA:P19079"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="PDB:1JTK"
FT                   /db_xref="PDB:1UWZ"
FT                   /db_xref="PDB:1UX0"
FT                   /db_xref="PDB:1UX1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19079"
FT                   /protein_id="BAA12481.1"
FT                   /translation="MNRQELITEALKARDMAYAPYSKFQVGAALLTKDGKVYRGCNIEN
FT                   AAYSMCNCAERTALFKAVSEGDTEFQMLAVAADTPGPVSPCGACRQVISELCTKDVIVV
FT                   LTNLQGQIKEMTVEELLPGAFSSEDLHDERKL"
FT   regulatory      108647..108651
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        108658..109563
FT                   /transl_table=11
FT                   /product="YqfH"
FT                   /db_xref="GOA:P42182"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42182"
FT                   /protein_id="BAA12482.1"
FT                   /translation="MTNESFKSGFVSIIGRPNVGKSTFLNRVIGQKIAIMSDKPQTTRN
FT                   KVQGVLTTGTSQTIFIDTPGIHKPKHKLGDFMMKVAQNTLKEVDLILFMINAEEGYGKG
FT                   DEFIIEKLQTMSTPVFLIVNKIDKIHPDQLLLLIDEYRKRYPFKEIVPISALEGNNIET
FT                   LLAQIEAYLPEGPQFYPSDQVTDHPERFIISELIREKVLHLTREEIPHSIAVAIESIKG
FT                   QDNGSVHVAATIVVERDSQKGIVIGKKGSLLKEVGKRARADIEALLGSRVYLELWVKVQ
FT                   KDWRNKMSQLRDFGFKEDEY"
FT   regulatory      109881..109885
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        109891..110658
FT                   /transl_table=11
FT                   /product="YqfI"
FT                   /db_xref="GOA:P42095"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR042242"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42095"
FT                   /protein_id="BAA12483.1"
FT                   /translation="MLTKCEGIVLRTNDYGETNKIVTLLTREHGKIGVMARGAKKPNSR
FT                   LSAVSQPFLYGSFLMQKTSGLGTLQQGEMILSMRGIREDLFLTAYAAYVAELVDRGTEE
FT                   KKPNPYLFEFILESLKQMNEGTDPDVITFIVQMKMLGVMGLYPELNHCVHCKSQDGTFH
FT                   FSVRDNGFICHRCFEKDPYRIPIKPQTARLLRLFYYFDLSRLGNVSLKEETKAELKQVI
FT                   DLYYEEYSGLYLKSKRFLDQMESMKHLMGENKS"
FT   regulatory      110942..110948
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        110955..111842
FT                   /transl_table=11
FT                   /product="YqfJ"
FT                   /db_xref="GOA:P54380"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54380"
FT                   /protein_id="BAA12484.1"
FT                   /translation="MNIQDMILTLQKHWSSQGCVLMQAYDVEKGAGTMSPYTFLRSIGP
FT                   EPWKVAYVEPSRRPADGRYGENPNRLYQHHQFQVIIKPSPDNIQELYLDSLRALGIDPL
FT                   EHDIRFVEDNWENPSLGCAGLGWEVWLDGMEITQFTYFQQVGGLECKPVSVEITYGIER
FT                   LASYIQDKENVFDLEWTSGFTVKDLFMMAEYEHSVYTFETSDVDMLFQLFSTYEKEAIK
FT                   QMDNGLVHPAYDYVLKCSHTFNLLDAKGAISVTERTGYIARVRNLARKVAKTYYEEREK
FT                   LGFPMLKGEGSSHE"
FT   regulatory      111821..111825
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        111835..113874
FT                   /transl_table=11
FT                   /product="YqfK"
FT                   /db_xref="GOA:P54381"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54381"
FT                   /protein_id="BAA12485.1"
FT                   /translation="MSKQDLLLEIGLEEMPARFLNESMVQLGDKLTGWLKEKNITHGEV
FT                   KLFNTPRRLAVFVKDVAEKQDDIKEEAKGPAKKIALDADGNWTKAAIGFSKGQGANVED
FT                   LYIKEVKGIEYVFVQKFQAGQETKSLLPELSGLITSLHFPKNMRWGNEDLRYIRPIKWI
FT                   VALFGQDVIPFSITNVESGRTTQGHRFLGHEVSIESPSAYEEQLKGQHVIADPSVRKQM
FT                   IQSQLETMAAENNWSIPVDEDLLDEVNHLVEYPTALYGSFESEFLSIPEEVLVTTMKEH
FT                   QRYFPVKDKNGDLLPHFITVRNGNSHAIENVARGNEKVLRARLSDASFFYKEDQKLNID
FT                   ANVKKLENIVFHEELGSLADKVRRVTSIAEKLAVRLQADEDTLKHVKRAAEISKFDLVT
FT                   HMIYEFPELQGIMGEKYARMLGEDEAVAAAVNEHYMPRSAGGETPSTFTGAVVAMADKL
FT                   DTIASFFSIGVIPTGSQDPYGLPRQASGIVAILLDRNWGISFEELLTFVQTDKENELLD
FT                   FFTQRLKYVLNAEQIRHDVIDAVLESSELEPYSALHKAQVLEQKLGAPGFKETAEALGR
FT                   VISISKKGVRGDIQPDLFENEYEAKLFDAYQTAKENLQENFSKKDYEAALASLAALKEP
FT                   IDAYFDHTMVIADNESLKANRLAQMVSLADEIKSFANMNALIVK"
FT   regulatory      114660..114665
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        114671..115483
FT                   /transl_table=11
FT                   /product="YqfL"
FT                   /db_xref="GOA:P54470"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54470"
FT                   /protein_id="BAA12486.1"
FT                   /translation="MNNRIIYVVSDSVGETAELVVKAALSQFNGSADDTHVRRIPYVED
FT                   IGTINEVISLAKADGGIICFTLVVPEIREYLIAEAEKANVLYYDIIGPLIDKMETAYGL
FT                   TAKYEPGRVRQLDEDYFKKVEAIEFAVKYDDGRDPRGILKADIVLIGVSRTSKTPLSQY
FT                   LAHKRLKVANVPIVPEVDPPEELFNVDPKKCIGLKISPDKLNHIRKERLKSLGLNDKAI
FT                   YANINRIKEELEYFEKIVDRIGCQVVDVSNKAVEETANIIHHLKTKNI"
FT   regulatory      115634..115637
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        115641..116231
FT                   /transl_table=11
FT                   /product="YqfM"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17868"
FT                   /protein_id="BAA12487.1"
FT                   /translation="MSRISPGNFSTNSYTSTIIKDVRFCLLLCRSLMEGWRITLLNEQE
FT                   KTIFVDADACPVKDEILQTASEYEVQVLFVASFEHYQLSRSNEEKWKYVDPHKEAADLY
FT                   IANHVKPGDIVVTQDIGLASLLLNRNVSVMSERGRLYKEDTIDFALEGRHFSGKQRRKG
FT                   VYAKGPKKLNKEDRERFITLLQKILSNDEGILH"
FT   regulatory      116252..116257
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        116265..118076
FT                   /transl_table=11
FT                   /product="DnaE"
FT                   /db_xref="GOA:P05096"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="PDB:5GUJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05096"
FT                   /protein_id="BAA12488.1"
FT                   /translation="MGNRIPDEIVDQVQKSADIVEVIGDYVQLKKQGRNYFGLCPFHGE
FT                   STPSFSVSPDKQIFHCFGCGAGGNVFSFLRQMEGYSFAESVSHLADKYQIDFPDDITVH
FT                   SGARPESSGEQKMAEAHELLKKFYHHLLINTKEGQEALDYLLSRGFTKELINEFQIGYA
FT                   LDSWDFITKFLVKRGFSEAQMEKAGLLIRREDGSGYFDRFRNRVMFPIHDHHGAVVAFS
FT                   GRALGSQQPKYMNSPETPLFHKSKLLYNFYKARLHIRKQERAVLFEGFADVYTAVSSDV
FT                   KESIATMGTSLTDDHVKILRRNVEEIILCYDSDKAGYEATLKASELLQKKGCKVRVAMI
FT                   PDGLDPDDYIKKFGGEKFKNDIIDASVTVMAFKMQYFRKGKNLSDEGDRLAYIKDVLKE
FT                   ISTLSGSLEQEVYVKQLASEFSLSQESLTEQLSVFSKQNKPADNSGETKTRRAHLTTKA
FT                   RQKRLRPAYENAERLLLAHMLRDRSVIKKVIDRVGFQFNIDEHRALAAYLYAFYEEGAE
FT                   LTPQHLMARVTDDHISQLLSDILMLQVNQELSEAELSDYVKKVLNQRNWSMIKEKEAER
FT                   AEAERQKDFLRAASLAQEIVTLNRSLK"
FT   regulatory      118260..118266
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        118275..119390
FT                   /transl_table=11
FT                   /product="RpoD"
FT                   /db_xref="GOA:P06224"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="PDB:5MWW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06224"
FT                   /protein_id="BAA12489.1"
FT                   /translation="MADKQTHETELTFDQVKEQLTESGKKRGVLTYEEIAERMSSFEIE
FT                   SDQMDEYYEFLGEQGVELISENEETEDPNIQQLAKAEEEFDLNDLSVPPGVKINDPVRM
FT                   YLKEIGRVNLLSAKEEIAYAQKIEEGDEESKRRLAEANLRLVVSIAKRYVGRGMLFLDL
FT                   IHEGNMGLMKAVEKFDYRKGYKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKL
FT                   IRVQRQLLQDLGREPTPEEIAEDMDLTPEKVREILKIAQEPVSLETPIGEEDDSHLGDF
FT                   IEDQEATSPSDHAAYELLKEQLEDVLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFG
FT                   VTRERIRQIEAKALRKLRHPSRSKRLKDFLE"
FT   regulatory      119704..119711
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        119719..120081
FT                   /transl_table=11
FT                   /product="CccA"
FT                   /db_xref="GOA:P24469"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR012218"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24469"
FT                   /protein_id="BAA12490.1"
FT                   /translation="MKWNPLIPFLLIAVLGIGLTFFLSVKGLDDSREIASGGESKSAEK
FT                   KDANASPEEIYKANCIACHGENYEGVSGPSLKGVGDKKDVAEIKTKIEKGGNGMPSGLV
FT                   PADKLDDMAEWVSKIK"
FT   regulatory      120329..120332
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        120338..120988
FT                   /transl_table=11
FT                   /product="YqfN"
FT                   /db_xref="GOA:P54471"
FT                   /db_xref="InterPro:IPR006901"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:6Q56"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54471"
FT                   /protein_id="BAA12491.1"
FT                   /translation="MADIGSDHAYLPCYAVLNHKASGAIAGEITDGPFLSAKRQVEKSG
FT                   LNSHISVRQGDGLEVIKKGEADAITIAGMGGALIAHILEAGKDKLTGKERLILQPNIHA
FT                   VHIREWLYKERYALIDEVILEEDGKCYEVLVAEAGDRDAAYDGISLSAGMLVGPFLAKE
FT                   KNAVFLKKWTQELQHTQSIYEQISQAADTEQNKQKLKELADRMELLKEVIDHG"
FT   regulatory      120964..120972
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        120981..121820
FT                   /transl_table=11
FT                   /product="YqfO"
FT                   /db_xref="GOA:P54472"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017221"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54472"
FT                   /protein_id="BAA12492.1"
FT                   /translation="MAKSVNGQQIIQLFEQFSPKAYAVEGDKIGLQIGTLNKPIKNVMV
FT                   TLDVLESVIDEAIEKEVDLIIAHHPPIFRSLKHISTDQPAGRLIEKCLKHDIAVYAAHT
FT                   NLDVADGGVNDLLAEALELSETEVLAPTYTDPLKKLAVYVPKEYEEQVRAALGNAGAGH
FT                   IGEYSHCAFSSEGIGSFKPLDGAKPFIGEVGELELVHEVRLETVFPKSVEKAVINAMIK
FT                   SHPYEEVAYDIYPVEQTPAEKGLGRVGTLKNEMTLKEFALFVFCKLDRQWCQNGWGC"
FT   CDS_pept        complement(122126..123070)
FT                   /transl_table=11
FT                   /product="YqfP"
FT                   /db_xref="GOA:P54473"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54473"
FT                   /protein_id="BAA12493.1"
FT                   /translation="MDVIKISPRGYCYGVVDAMVIAKNASLDKSLPRPIYILGMIVHNK
FT                   HVTDAFEEEGILTLDGSNRLDILKQVDKGTVIFTAHGVSPEVRRIAEEKGLVAIDATCP
FT                   DVTKTHNLILEMKEKGYHVIYIGKKGHPEPEGAVGVAPEIVHLVETEEDVKNLDIQSEK
FT                   LIVTNQTTMSQWDVHDIMELVKEKYPHVEYHQEICLATQVRQEAVSEQAKKADLTIVVG
FT                   DPKSNNSNRLAQVSEEIAGTKAYRIGDLSELKLEWLKGVNTVAVTAGASTPTPITKEVI
FT                   RFLEQFDHEDPSTWTTEHNIPLKKILPKVKAKN"
FT   regulatory      complement(123081..123085)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(123193..123936)
FT                   /transl_table=11
FT                   /product="YqfQ"
FT                   /db_xref="InterPro:IPR025571"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54474"
FT                   /protein_id="BAA12494.1"
FT                   /translation="MFSPQQPMRNYPQPGPPRPMPNQRMMGRRPPNMRGPSFGAQQQGF
FT                   QQAGQFLPQANAGARNGAGAGGGLKGMLSRFLPGGGGAGSAGVPGIPGAGAAASGGAGL
FT                   QGIQNIANPASLSSMLGNVQKVLGMAQQVTPMIQQYGPLVRNLPAMMKLYSQLSKSDDT
FT                   ETEANEESEKQSVSEESSEKEKETETKTSDGNKKSKPKSSSLPKKSKTTDNKEQELKTS
FT                   APKKKEAASPAPKRTSGSSKPRLYI"
FT   regulatory      complement(123943..123952)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      124090..124098
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        124105..125421
FT                   /transl_table=11
FT                   /product="YqfR"
FT                   /db_xref="GOA:P54475"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030881"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54475"
FT                   /protein_id="BAA12495.1"
FT                   /translation="MKETKFELYELKPFIIDAVHRLGFYEPTDIQKRLIPAVLKKESVI
FT                   GQSQTGTGKTHAYLLPLLNKIDPAKDVVQVVITAPTRELANQIYQEALKITQGEEGSQI
FT                   RSKCFIGGTDKQKSIDKLKIQPHLVVGTPGRIADLIKEQALSVHKAESLVIDEADLMLD
FT                   MGFLADVDYIGSRMPEDLQMLVFSATIPEKLKPFLKKYMENPKYAHVEPKQVTAAKIEH
FT                   ILIPSKHRDKDKLLFDIMSHLNPYLGIVFANTKNTADHIAQYLTGKGMKIGLLHGGLTP
FT                   RERKKVMKQINDLEFTYIIATDLAARGIDIKGVSHVINYELPDDLDFYVHRVGRTARAG
FT                   SSGQAMTIYELTDEDALVRLEKMGIEFEYLELEKGEWKKGDDRQRRKKRKKTPNEADEI
FT                   AHRLVKKPKKVKPGYKKKMSYEMEKIKKKQRRNQSKKRK"
FT   regulatory      125420..125424
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        125431..126324
FT                   /transl_table=11
FT                   /product="YqfS"
FT                   /db_xref="GOA:P54476"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54476"
FT                   /protein_id="BAA12496.1"
FT                   /translation="MLRIGSHVSMSGKHMLLAASQEAVSYGANTFMIYTGAPQNTRRKK
FT                   IEDLNIEAGRAHMQENGIDEIIVHAPYIINIGNTTNPSTFELGVDFLRSEIERTAAIGA
FT                   KQIVLHPGAHVGAGAEAGIKKIIEGLNEVIDPNQNVQIALETMAGKGSECGRSFEELAQ
FT                   IIEGVTHNEQLSVCFDTCHTHDAGYNIVEDFDGVLNEFDKIIGIDRIKVLHINDSKNVK
FT                   GARKDRHENIGFGEIGFDALQYVVHHEQLKDIPKILETPYVGEDKKNKKPPYRFEIEML
FT                   KEKQFDDTLLEKILQQ"
FT   CDS_pept        complement(126351..126605)
FT                   /transl_table=11
FT                   /product="YqfT"
FT                   /db_xref="InterPro:IPR020277"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54477"
FT                   /protein_id="BAA12497.1"
FT                   /translation="MILFQRIILQRLNQATADDLLKYSKQYGISLTRSQAVEVANLLYG
FT                   KNVNIFNESERMRLLKQVETITSKETAQTVNELFKQFTS"
FT   regulatory      complement(126615..126621)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      126709..126716
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        126721..127602
FT                   /transl_table=11
FT                   /product="YqfU"
FT                   /db_xref="GOA:P54478"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54478"
FT                   /protein_id="BAA12498.1"
FT                   /translation="MTPTKQHKKETFTHFIFRVFMILVGAASAAVSIELFLIPNDFIDG
FT                   GIIGVSLILDHLFMSNPFLNFAFSVVILNIPFMIFGYKYIGKTFLVSTFIGIVGLAVIE
FT                   SSLHHVEAITTQPILATVFGGLLLGFGVGLVIRNGGSMDGTEILGILLTKKLPFSVGEF
FT                   VMFINVFIFIWAVFVFGPEQAMYSFMTYYIAMKTIDAVIQGLDETKAVIIVSEQYDEIS
FT                   DAILHRLGRGTTKLKGKGGYTDEEKDVIYAVVTRLEVTKLKSIVFEVDQNAFITIMNTH
FT                   ETRGGKFKNAIH"
FT   regulatory      127725..127732
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        127740..128177
FT                   /transl_table=11
FT                   /product="YqfV"
FT                   /db_xref="GOA:P54479"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54479"
FT                   /protein_id="BAA12499.1"
FT                   /translation="MNVQEALNLLKGNGYKYTNKREDMLQLFADSDRYLTAKNVLSALN
FT                   DDYPGLSFDTIYRNLSLYEELGILETTELSGEKLFRFKCSFTHHHHHFICLACGKTKEI
FT                   ESCPMDKLCDDLDGYQVSGHKFEIYGTCPDCTAENQENTTA"
FT   CDS_pept        complement(128220..128801)
FT                   /transl_table=11
FT                   /product="YqfW"
FT                   /db_xref="GOA:P54480"
FT                   /db_xref="InterPro:IPR009206"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54480"
FT                   /protein_id="BAA12500.1"
FT                   /translation="MLRLGIDIDGTITAQDTFVPYLNRSFNLSISLNDMTDYDLTKLLN
FT                   ITQEEFWDWMNQNEAIIYKEALLAQHAKQSLDLLKEEHKLIYITARRTHLTDITYEWFD
FT                   RQNIHYDHIELVGGHHKVEAVKNHNIDLFFEDHHGNAMMIAKEAGIPVILFNSPYNQLP
FT                   IDSNIIRVNNWLEAVQWMNNNKHHLIRVNN"
FT   regulatory      complement(128807..128815)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      128923..128931
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        128934..129323
FT                   /transl_table=11
FT                   /product="YqfX"
FT                   /db_xref="GOA:P54481"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54481"
FT                   /protein_id="BAA12501.1"
FT                   /translation="MKVANDYEKRDNNSYYVDHGSEGTNITRDNDGFFEETAAEIAEPY
FT                   RAADRSNDQDNDRSGGNVNEGRGIGYIALALSIISLFVLPVLLGAAGIIVGYIARRRGA
FT                   QGLGAWAMGIGVVSLVLGIFIIPFF"
FT   CDS_pept        complement(129349..130482)
FT                   /transl_table=11
FT                   /product="YqfY"
FT                   /db_xref="GOA:P54482"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54482"
FT                   /protein_id="BAA12502.1"
FT                   /translation="MQVSEITHRTKTRPVKVGPLTIGGNNEVVIQSMTTTKTHDVEATV
FT                   AEINRLAEAGCQIVRVACPDERAANAIADIKKRISIPLVVDIHFDYKLALKAIEGGADK
FT                   IRINPGNIGRREKVEAVVKAAKDKGIPIRIGVNAGSLEKRILEKYGYPTADGMVESALH
FT                   HIKILEDLDFHDIIVSMKASDVNLAIEAYEKAAKAFDYPLHLGITESGTLFAGTVKSAA
FT                   GLGAILSKGIGNTMRISLSADPVEEVKVARELLKSFGLASNAATLISCPTCGRIEIDLI
FT                   SIANEVEEYISKIKAPIKVAVLGCAVNGPGEAREADIGIAGARGEGLLFRKGKIVRKVP
FT                   EETMVEELKKEIDILAEEHYAKLEAEKAKLKEETQKA"
FT   regulatory      complement(130486..130491)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(130605..130904)
FT                   /transl_table=11
FT                   /product="YqfZ"
FT                   /db_xref="GOA:P54483"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54483"
FT                   /protein_id="BAA12503.1"
FT                   /translation="MKRLTLVCSIVFILFILFYDLKIGTIPIQDLPVYEASAKTAVQEP
FT                   AYKTVKVKPGDTVMSIVGSAGSPDDIVKDFEALNPNVKANAIQAGTAYKFPVYP"
FT   regulatory      complement(130912..130916)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      131164..131171
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        131181..131609
FT                   /transl_table=11
FT                   /product="YqgA"
FT                   /db_xref="GOA:P54484"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54484"
FT                   /protein_id="BAA12504.1"
FT                   /translation="MKQGKFSVFLILLLMLTLVVAPKGKAEAASSGWQPVSGISGCKIR
FT                   VITDAYTYTKSATSIDAYAETNGKCGKLNYKSFGVSIVEGGDIGPQYSGYFSSRTPTKK
FT                   FYFSKLPKPTGTPWAVGLSVYKGKAKGAAFVYINPQKR"
FT   CDS_pept        complement(132035..132793)
FT                   /transl_table=11
FT                   /product="YqgB"
FT                   /db_xref="GOA:P54485"
FT                   /db_xref="InterPro:IPR009574"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54485"
FT                   /protein_id="BAA12505.1"
FT                   /translation="MNVFQLFIKSTYSPRDIAKTRFQGIGKAILYVFLLSVLFAIPTAY
FT                   YVSTGTVKSMNGFKTVLNKDFPDFTISNGKLQTDEKKATESQANGFVIVFDPTDSYGTE
FT                   QIEAKQNAIGILQNKFVLAIDGQAQEMSYSMMPSELQKKDVIAGLNQNKAMIVTVLSAL
FT                   IFLVTAAGKFIEVSFLALIGLIIKNSQKKHLSYHQLWKLSAYSITLSTVFFTIMRALEA
FT                   TVPSEFLLNWFVNFVILFLVLKEIPVQKSN"
FT   regulatory      complement(132799..132807)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      132889..132893
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        132903..133385
FT                   /transl_table=11
FT                   /product="YqgC"
FT                   /db_xref="GOA:P54486"
FT                   /db_xref="InterPro:IPR007403"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54486"
FT                   /protein_id="BAA12506.1"
FT                   /translation="MDMLYWLLIAAVFIIAFIGLVYPVIPSVVFIVAGFVLYGFLFSFS
FT                   PYSYMFWLVEAVFAAVLFAADYVSNLLGVKRFGGSKAAIWGSTIGLLIGPFVIPVAGII
FT                   LGPFIGAVCAELIVHQKDLKSAFKIGLGSLIGFLTGVIAKGIIQLLMIGYFLWTVL"
FT   regulatory      133550..133556
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        133564..134244
FT                   /transl_table=11
FT                   /product="YqgD"
FT                   /db_xref="GOA:P54375"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="PDB:2RCV"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54375"
FT                   /protein_id="BAA12507.1"
FT                   /translation="MAYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEG
FT                   NTALANKSVEELVADLDSVPENIRTAVRNNGGGHANHKLFWTLLSPNGGGEPTGALAEE
FT                   INSVFGSFDKFKEQFAAAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGL
FT                   DVWEHAYYLNYQNRRPDYISAFWNVVNWDEVARLYSDENNGTNKVLIMGPCFFMSSFYI
FT                   SRFE"
FT   regulatory      134263..134269
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        134278..135570
FT                   /transl_table=11
FT                   /product="YqgE"
FT                   /db_xref="GOA:P54487"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54487"
FT                   /protein_id="BAA12508.1"
FT                   /translation="MSKLKKVIGDVDVNKGLLFLLTIGGLYSLGIALSNTFVNVYLWKQ
FT                   SGKFIDLAIYNLSIVTMQPITFYLAGRLAKKIDRVFILRFGVIFLAAFYLSVLLAGETA
FT                   ASRLVLIGAVLGVGYGFYWLAFNVLTFEITEPDTRDFFNGFMGILSSSAGMIGPIVAGF
FT                   VISRLENNTGYTVIFSLSLSLFALAVVMSFFLKRRESKGRFMLSKVFGERHSNMNWRRI
FT                   TNAHFFQGLREGIFVFLISVFVFIETNSELALGTFGLVNSAVSFLAYYFASRLIKKKAR
FT                   KKSILLGGLILYGALFLILFHMSFSTLLTYGVFIAIGYPLLLVPYVSLTYDVIGRARHA
FT                   RKARIEYIVLREMFLNAGRIVSILCFLLIVALLKEDVGIPLSLAILGIGHPLIYYFVKD
FT                   IRFKEKEGENETMEEDGQKRVTEPTLLKGER"
FT   regulatory      135669..135678
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        135684..137834
FT                   /transl_table=11
FT                   /product="YqgF"
FT                   /db_xref="GOA:P54488"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54488"
FT                   /protein_id="BAA12509.1"
FT                   /translation="MRRNKPKKQNHKEKKKSLPIRLNILFLAAFVIFTWIIVELGIKQI
FT                   VQGDDYKNQANKQEQSEVSSAVPRGKIYDRNFNAIVTNKALNAITYTRSKSTTQEQRLK
FT                   IAKKLSDMIKVDTKKVTERDKKDYWILTRPKEAKKLISSKERQQVEDKKISDDDLYQLQ
FT                   LKRITDKQLNELTDKDMQILAIKRQMDSGYALTPQYIKNEDVSAKEMAVVSEHLDELPG
FT                   VDVTSDWEREYPYKNLLRSVLGSVSSSNEGLPSNLLDHYLSLGYSRNDRVGKSYLEYQY
FT                   ESLLQGQKAKVENITDSKGNVTGTKTVSEGKAGKDLVLTIDIDLQKSVEKIIEKKLKAA
FT                   KARPSTELLDRAFVVMMDPRNGEVLTMAGKQIKRENGAYKFDDYALGAMTSSYAMGSAV
FT                   KGATVLTGLQTGAINLNTVFKDEPLYIGQDKRGKKSWQNLGPVGIQTALEKSSNVFMFK
FT                   TAIAVGKGEYKPHQALPLDTSAFDTFRNYFSQFGLGVKTGIDLPNEMTGYKGTSRLSGF
FT                   LLDFAIGQYDTYTPLELAQYVSTIANGGYRMKPQLVKEVRDSNAKKGIGAVVDSVQPEV
FT                   LNKVDMKSSYIEEVQAGFRRVATKGTAAGQLASASYKPAAKTGTAQSFYDGPDKSKTGT
FT                   DTYNTTLVAYAPADNPEIAISVVVPWTYIDYNQRYSITNEIGREVMDKYFELKSKQDKE
FT                   GTQQKNKDKIEENAENTTSSDN"
FT   regulatory      137972..137977
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        137988..138890
FT                   /transl_table=11
FT                   /product="YqgG"
FT                   /db_xref="GOA:P46338"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46338"
FT                   /protein_id="BAA12510.1"
FT                   /translation="MKKNKLVLMLLMAAFMMIAAACGNAGESKKSNSDSAKGEEKASGS
FT                   LTISGSSAMQPLVLAAAEKFMEENPDADIQVQAGGSGTGLSQVSEGAVQIGNSDVFAEE
FT                   KEGIDAKALVDHQVAVVGMAAAVNPDAGVKDISKDELKKIFTGKIKNWKELGGKDQKIT
FT                   LVNRPDSSGTRATFVKYALDGAEPAEGITEDSSNTVKKIIADTPGAIGYLAFSYLTDDK
FT                   VTALSIDGVKPEAKNVATGEYPIWAYQHSYTKGEATGLAKEFLDYLKSEDIQKSIVTDQ
FT                   GYIPVTDMKVTRDANGKQS"
FT   regulatory      138945..138951
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        138959..139888
FT                   /transl_table=11
FT                   /product="YqgH"
FT                   /db_xref="GOA:P46339"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46339"
FT                   /protein_id="BAA12511.1"
FT                   /translation="MINNRENMSVSERLISSRQNRQLDEVRGRMIVTACALIMIAASVA
FT                   ITIFLGVKGLQSFLVNGVSPIEFLTSLNWNPTDSDPKYGVLPFIFGSFAVTILSALIAA
FT                   PLGIAGPIFMTEIAPNWGKKVLQPVIELLVGIPSVVYGFIGLTVLVPFIAQFKSSGTGH
FT                   SLLAGTIVLSVMILPTITSISADAMASLPKSLREGSYALGATRWQTIRKVLVPAAFPTL
FT                   MTAVVLGMARAFGEALAVQMVIGNTRVLPESPFDTAGTLTTIITLNMGHTTYGSVENNT
FT                   LWSMGLVLLVMSFLFILLIRYLSSRRKV"
FT   regulatory      139874..139879
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        139888..140772
FT                   /transl_table=11
FT                   /product="YqgI"
FT                   /db_xref="GOA:P46340"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46340"
FT                   /protein_id="BAA12512.1"
FT                   /translation="MNRKITDKLATGMFGLCAAIIAAILVGLFSYIIINGVSQLSFQFI
FT                   TTKSSAIAAGGGIRDQLFNSFYILFITMLITIPLGVGGGVFMAEYAPNNKVTDFIRTCI
FT                   EVLSSLPSIVIGMFGLLMFVNLTGWGYTIIGGALALTVFNLPVMVRVTEDAIRSVPKDL
FT                   KEASLALGVSRWHTVKTVLIPSAIPSIITGAILASGRVFGEAAALLFTAGLTTPRLNFT
FT                   EWNPFSETSPLNIFRPAETLAVHIWNVNTQGMIPDAEAIANGGSPVLVISVLVFNLAAR
FT                   WLGTMIYKKLTAN"
FT   regulatory      140777..140784
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        140793..141602
FT                   /transl_table=11
FT                   /product="YqgJ"
FT                   /db_xref="GOA:P46341"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46341"
FT                   /protein_id="BAA12513.1"
FT                   /translation="MSEQMVKEKPERAVIVPKQNHVLEVKDLSIYYGNKQAVHHVNMDI
FT                   EKNAVTALIGPSGCGKSTFLRNINRMNDLIPSARAEGEILYEGLNILGGNINVVSLRRE
FT                   IGMVFQKPNPFPKSIYANITHALKYAGERNKAVLDEIVEESLTKAALWDEVKDRLHSSA
FT                   LSLSGGQQQRLCIARTLAMKPAVLLLDEPASALDPISNAKIEELITGLKREYSIIIVTH
FT                   NMQQALRVSDRTAFFLNGELVEYGQTEQIFTSPKKQKTEDYINGKFG"
FT   regulatory      141601..141606
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        141613..142395
FT                   /transl_table=11
FT                   /product="YqgK"
FT                   /db_xref="GOA:P46342"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46342"
FT                   /protein_id="BAA12514.1"
FT                   /translation="MSIATEAVMKQEVYQVNGMNLWYGQHHALKNINLSIYENEVTAII
FT                   GPSGCGKSTFIKTLNLMIQMTPNVKLAGELNYNGSNILKDKVDIVDLRKNIGMVFQKGN
FT                   PFPQSIFDNVAYGPRVHGTKNKKKLQEIVEKSLKDVALWDEVKDRLHTSALSLSGGQQQ
FT                   RLCIARALATNPDILLMDEPTSALDPISTRKIEELILELKDKYTIVIVTHNMQQAARVS
FT                   DQTAFFYMGELVECDNTNKMFSNPKDQRTLDYISGKFG"
FT   regulatory      143410..143414
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        143418..143888
FT                   /transl_table=11
FT                   /product="YqgL"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54489"
FT                   /protein_id="BAA12515.1"
FT                   /translation="MDKHPFPYNIRHKLSFFRDTFDIIIQNAHTLTVSWEISEETMRLA
FT                   EAVLFEKTQDMIKELRIVIKRKDIEAVRTKRTTYDKGEWTIRQAAGDAVYRAEYRIVNS
FT                   MNVSLKLAGTDDIYLDENGIRHINSFQIEEAHTRWEAQFSAYTCYGRGEKER"
FT   regulatory      143868..143873
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        143885..144964
FT                   /transl_table=11
FT                   /product="YqgM"
FT                   /db_xref="GOA:P54490"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54490"
FT                   /protein_id="BAA12516.1"
FT                   /translation="MNILMLSPEHPDEPKSGLGVHLNRLISYLNPHINITVFTPSGQLF
FT                   SYAKFEDYIADANFTMVRHVLSHNKRFDLIHAHDDTTAPAAQYLKQRLGLPLAATIHGL
FT                   ESERKKVCREAPHPYRLMTERLLIESADALIVLSTFMKRSLDKAAHKKITVIPSPASME
FT                   EEKGKIPRSMNRRFLFSYGRFVPEKGLSQLLKVFAILKQRQPDLYLVLAGEGPSLSCYE
FT                   KLAAAYNLKDRIMFLPFLNRKDIRTLLSHCEMAVFPSSYEPFGLAAQESMEQGVLTVVS
FT                   QSGGFCDYAVHDKTAIIADFTLVQEAADLLDSFLKDREKARRIKEAGRQQVFKLHHPRL
FT                   IMSSYLQLYERIFNNSAIH"
FT   regulatory      145269..145274
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        145282..145845
FT                   /transl_table=11
FT                   /product="YqgN"
FT                   /db_xref="GOA:P54491"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="PDB:1YDM"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54491"
FT                   /protein_id="BAA12517.1"
FT                   /translation="MKSQLRKKTLEALSALSNEDILQKTERMYKYLFSLPEWQNAGTIA
FT                   VTISRGLEIPTRPVIEQAWEEGKQVCIPKCHPDTKKMQFRTYQTDDQLETVYAGLLEPV
FT                   IEKTKEVNPSQIDLMIVPGVCFDVNGFRVGFGGGYYDRYLSEYEGKTVSLLLECQLFAH
FT                   VPRLPHDIPVHKLITEDRIISCFS"
FT   regulatory      145900..145905
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        145912..146085
FT                   /transl_table=11
FT                   /product="YqgO"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54492"
FT                   /protein_id="BAA12518.1"
FT                   /translation="MKKLLIYAIFAVSAVMFYQNRYRLMNTVLSQPGIRRSFIHLFLRI
FT                   PFIRNKFIQQAF"
FT   regulatory      146163..146166
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        146175..147698
FT                   /transl_table=11
FT                   /product="YqgP"
FT                   /db_xref="GOA:P54493"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54493"
FT                   /protein_id="BAA12519.1"
FT                   /translation="MFLLEYTYWKIAAHLVNSGYGVIQAGESDEIWLEAPDKSSHDLVR
FT                   LYKHDLDFRQEMVRDIEEQAERVERVRHQLGRRRMKLLNVFFSTEAPVDDWEEIAKKTF
FT                   EKGTVSVEPAIVRGTMLRDDLQAVFPSFRTEDCSEEHASFENAQMARERFLSLVLKQEE
FT                   QRKTEAAVFQNGKPTFTYLFIALQILMFSLLEINGGSTNTETLVAFGAKENSLIAQGEW
FT                   WRLLTPIVLHIGIAHLAFNTLALWSVGTAVERMYGSGRFLLIYLAAGITGSIASFVFSP
FT                   YPSAGASGAIFGCLGALLYVALSNRKMFLRTIGTNIIVIIIINLGFGFAVSNIDNSGHI
FT                   GGLIGGFFAAAALGLPKAGAFGKRLLSAVFLIALAVGFSYYGLHSPSHQESALIQQASE
FT                   LYQEGKYEEVTELLNGEAAQKDASADLLKILAVSDIQIGEYDQAVSLLERAVKKEPKDH
FT                   ASYYNLALLYAEKNELAQAEKAIQTAVKLKPKEQRYKELQWQIENNKES"
FT   regulatory      147801..147804
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        147808..148023
FT                   /transl_table=11
FT                   /product="YqgQ"
FT                   /db_xref="InterPro:IPR009256"
FT                   /db_xref="InterPro:IPR023164"
FT                   /db_xref="PDB:2NN4"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54494"
FT                   /protein_id="BAA12520.1"
FT                   /translation="MNTFYDVQQLLKTFGHIVYFGDRELEIEFMLDELKELYMNHMIEK
FT                   EQWARAAAVLRKELEQTKNGRDFYKG"
FT   regulatory      148023..148029
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        148034..148999
FT                   /transl_table=11
FT                   /product="YqgR"
FT                   /db_xref="GOA:P54495"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54495"
FT                   /protein_id="BAA12521.1"
FT                   /translation="MDEIWFAGIDLGGTTIKLAFINQYGEIQHKWEVPTDKTGDTITVT
FT                   IAKTIDSKLDELQKPKHIIKYIGMGAPGPVDMAAGVVYETVNLGWKNYALKNHLETETG
FT                   IPAVIENDANIAALGEMWKGAGDGAKDVILVTLGTGVGGGIIANGEILHGINGAGGEIG
FT                   HICSIPEGGAPCNCGKTGCIETIASATGIVRIAKGKIANAKKTTRLKATEQLSARDVFE
FT                   AAGENDEIALEVVDYVAKHLGLVLGNLASSLNPSKIVLGGGVSRAGELLRSKVEKTFRK
FT                   CAFPRAAQAADISIAALGNDAGVIGGAWIAKNEWLKHQNC"
FT   regulatory      149104..149110
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        149115..151031
FT                   /transl_table=11
FT                   /product="YqgS"
FT                   /db_xref="GOA:P54496"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54496"
FT                   /protein_id="BAA12522.1"
FT                   /translation="MRKTFFPKISFTLIAILLMWLKTYAVYKTSFHIKIDNLTQEFILF
FT                   INPLSFLLLIFGLSLFLKGKNRNRYIIAMSCLVTFVLLANMVFYRFYNDFLTIPVLFQT
FT                   SNMGDLGSSIGTLLEPTDLLLAVDIAVLIWLHIRQKAFQSDIPSTKNERAAYFLFVASV
FT                   YFFNLGLSEAERPQLLTRSFDREMLVKNISLFNFHIYDGVLQSKQSAQRALADSNSLTE
FT                   IENYVTANAKDANKRLFGAAKGRNVILVSLESTQSFVINEKLNGEEITPFLNDFIKQSY
FT                   NFNNVYHQTGQGKTSDSEFNVDNSLYPLGRGAVFFTNAGNQYMAAPEILKNSGYYSAVL
FT                   HANNKSFWNRDLMYDSFGYDSFFDINSYDVTDENTVGWGLKDKEFFEQSSELMKNLPQP
FT                   FYSRLITLTNHFPFDLDEEDQLIDEYDSNSQTLNKYFPTVRYQDEALKRFIEKLKEDGL
FT                   YDNSVIVLYGDHYGISENHNEAMGQFLGKEITPFEEVQLQKVPLVIHIPGITDKKPQTI
FT                   ETVGGQIDIRPTLMNLLGIDTKDQIQFGNDLLSDEKLDFTVLRDGSFITDQVVYTDGAC
FT                   YDKETGKPLEETKQCEAFADKAKQELSLSDEIIYGDLLRFYDQKRLDNSSKRKEKQMLD
FT                   QAS"
FT   regulatory      151103..151110
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        151114..152244
FT                   /transl_table=11
FT                   /product="YqgT"
FT                   /db_xref="GOA:P54497"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR034274"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54497"
FT                   /protein_id="BAA12523.1"
FT                   /translation="MMAFITVKPEIKNNLANVAKELKIDEELLKSANRSAQKHQLYCPG
FT                   YVIEEHSGKELQTIQDIKRFLQPRQLKLSDSWIEQEKIYDDSAVEKEIKKIIDVFPFVS
FT                   CREIGRSVLGRPIWELKAGGEHAVKKVHMNASFHANEWITTSVLLKWFKEYCMSLCCNS
FT                   PFFGFSPIKLFNSTSLSLVPLVNPDGVDLVLNGSEVMGARRDELERLNEHRPNFNEWKA
FT                   NINGVDLNKQFPSLWEIEKYRKPTAPSYRDFPGISPLTEPESIAMYRLITENPPDRLLA
FT                   LHTQGEEIYWGYKGLEPEESAAVIKEFEELSGNIYKGVRDIDSYAGFRDWFIHHYFKEG
FT                   YTVELGKGQNPLPFQQFSHIYNATSGILWRALFFHE"
FT   regulatory      152298..152302
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        152306..153367
FT                   /transl_table=11
FT                   /product="YqgU"
FT                   /db_xref="GOA:P54498"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54498"
FT                   /protein_id="BAA12524.1"
FT                   /translation="MLMRSVCFILLAVLLFSLSACKPSHQQQKQASAAKDEKKDIIPLS
FT                   AEKADGAEGWLNNSTILYTASNPTKTELFPYRIFTGKAKKLYQTDGQIVDVQINAREQM
FT                   ILLQITHSQKTAVVLLNAEGETLYEKDYETYELEAAWNQYDPYQMMVTEFNENWDFHTY
FT                   QVNAKKDESFLSPVQVPFIHWTSKNTFDYVKEGRDDKTGPLYTFDTASKTEQKLEDNVL
FT                   FFDSFHQMSFTVKSASGGKGTYQFKTPQSTSPVTAKWPLQAKYTSLAPMEYDYDEAGSL
FT                   FYTFKQSGDAYKLAAINVASGETKDLVSLREMEPIQISPNGKYALYGFHFEQIILLKSH
FT                   ETKQLIIDQKEME"
FT   regulatory      153352..153358
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        153370..153654
FT                   /transl_table=11
FT                   /product="YqgV"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54499"
FT                   /protein_id="BAA12525.1"
FT                   /translation="MAIADVTIIPIGTETPSVSAYVADVQKILEGYQAEGKIKYQLTPM
FT                   NTLIEGELSDLFAVIQAIHEAPFQKDCTEWQRISVSMTGVTKKRRLRAK"
FT   CDS_pept        complement(153715..153888)
FT                   /transl_table=11
FT                   /product="YqgW"
FT                   /db_xref="GOA:P54500"
FT                   /db_xref="InterPro:IPR024490"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54500"
FT                   /protein_id="BAA12526.1"
FT                   /translation="MLLVVIFGLVALFALWGVLRSVRNKNILGFLLAGATLFVFGWFTV
FT                   MTVINSGYPTAH"
FT   regulatory      complement(153896..153903)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      154031..154037
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        154046..154681
FT                   /transl_table=11
FT                   /product="YqgX"
FT                   /db_xref="GOA:P54501"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54501"
FT                   /protein_id="BAA12527.1"
FT                   /translation="MKWRRMPVGPIQANAYFLISDDQCLIFDPGGEGHKINQYIKEKGL
FT                   TPLAILLTHAHFDHIGALDEVREKWDIPVYLHQNEKNWLADASLNGSGMLRGIEVTAKP
FT                   ADHLIEGDGELNIGPFHLETLFTPGHSPGSVSYYVKDADLVISGDVLFQGGIGRTDLIG
FT                   GNQETLLTSIHEKLLTLPEHTLVLSGHGPETDVLTEQDQNPFLNGFSL"
FT   CDS_pept        complement(154721..154966)
FT                   /transl_table=11
FT                   /product="YqgY"
FT                   /db_xref="GOA:P54502"
FT                   /db_xref="InterPro:IPR020254"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54502"
FT                   /protein_id="BAA12528.1"
FT                   /translation="MNRMFRVLGFWTGIFAVMFYLGDMKDASLLFFGQTILFVFLSYLN
FT                   LTERMYIYIFGAYLTIFFAGFTYYSIFIMVPGGGGH"
FT   regulatory      complement(154975..154979)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      155184..155189
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        155198..155578
FT                   /transl_table=11
FT                   /product="YqgZ"
FT                   /db_xref="GOA:P54503"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54503"
FT                   /protein_id="BAA12529.1"
FT                   /translation="MEQQLTFYSYPSCTSCRKTKHWLKAHQIEFNERHLFRETPTREEL
FT                   KYILSLTTEGIDEILATRSQTFKNLNLNIEEITVNEVLELLIEKPKLLRRPILVDNKKL
FT                   VIGYNPGELLKLSKKKTVHQSA"
FT   tRNA            155645..155715
FT                   /product="tRNA-Gln"
FT   regulatory      155784..155790
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        155802..156638
FT                   /transl_table=11
FT                   /product="YqhA"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR025751"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54504"
FT                   /protein_id="BAA12530.1"
FT                   /translation="MIALDQHLTEHKKDITQQWLEVCTSNGSWLYSAKDQQKLGQKLKD
FT                   QHELLVTIVAKSLRKEDVEDELNRWSLQCARDRAVHEVTVTQSFGQFNTFRHIMFEWIH
FT                   KFSEASSQDISIQEFYEWSRILNQNIDEIIEVFTEEYHQVTMIQLNAQKEMINELSAPI
FT                   MPITDGIGILPLVGEIDTHRARTILESVLEQCSALKLSYLFLDISGVPIVDTMVAYQIF
FT                   KVIDSTKLLGIETIISGIRPEIAQTVVKLGLDFSNVKTEQSLAKALANKGFKIKEC"
FT   CDS_pept        complement(156691..158019)
FT                   /transl_table=11
FT                   /product="YqhB"
FT                   /db_xref="GOA:P54505"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54505"
FT                   /protein_id="BAA12531.1"
FT                   /translation="MPSLEKAVVLEFINLLAVAILILLTGFFVAVEFSIVKVRRSKIDQ
FT                   LVAKGKKGAKAAKHVITHLDEYLSACQLGITVAALGLGWLGEPTVQTLLRPLFHKAGLN
FT                   ESLTHLLSLVIAFLVVTYLNVVIGELAPKSFAIQKAESITLLFAKPLIWFYKIMFPFIW
FT                   LLNHSARLITGVFGLKPASEHELAYTEEELRVLLAESYKSGEIRKSELKYMNNIFTFDK
FT                   RMAKEIMVPRNEMVSLSLDEDSISNLQETVKQTKYTRYPVVREDKDNVIGVINMKEVLF
FT                   SMLTKDFSIKKHQIEPFVQPVIHVIETIPIYKLLLKMQKERTHMAILIDEYGGTSGLVT
FT                   VEDIIEEIVGEIRDEFDADEVPHIRELGKDHYLLNAKLLISDVNSLLGTDLSEAEVDTL
FT                   GGWFLTQNIDAEPESAIEYDGYSFKVKDINSHHILFIEVKKAE"
FT   regulatory      complement(158021..158031)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      158149..158153
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        158162..159115
FT                   /transl_table=11
FT                   /product="YqhC"
FT                   /db_xref="GOA:P40948"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40948"
FT                   /protein_id="BAA12532.1"
FT                   /translation="MKAHTGKDWFWYQMGPQERSKARDLIHFSHWPQCEKWFENNHHVN
FT                   FLRVDTTETENEAVFGSIVYDQGLGEEKDHTVFHFYITRQYFFTINFDFSILREIKGKE
FT                   VVRQMERADNAIEGFLILLGELMNAYLIGVDEFEVKLRKLRWQIKDDNSKSILNRVHLL
FT                   RHELMIWKNLILSAKKIEMALKETFLPQNEGKKDYQRTQLKIDRGFTYISEFEGELNNL
FT                   LHSEEVITSHRGNEIVKALTIFTTLFTPITALGALWGMNFSVMPELNWKYGYLFSLLLI
FT                   VTSTVLIYLYLRKKGWTGDMLQERKKKKKPRKRRTL"
FT   regulatory      159509..159515
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        159527..160597
FT                   /transl_table=11
FT                   /product="ComGA"
FT                   /db_xref="GOA:P25953"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25953"
FT                   /protein_id="BAA12533.1"
FT                   /translation="MDSIEKVSKNLIEEAYLTKASDIHIVPRERDAIIHFRVDHALLKK
FT                   RDMKKEECVRLISHFKFLSAMDIGERRKPQNGSLTLKLKEGNVHLRMSTLPTINEESLV
FT                   IRVMPQYNIPSIDKLSLFPKTGATLLSFLKHSHGMLIFTGPTGSGKTTTLYSLVQYAKK
FT                   HFNRNIVTLEDPVETRDEDVLQVQVNEKAGVTYSAGLKAILRHDPDMIILGEIRDAETA
FT                   EIAVRAAMTGHLVLTSLHTRDAKGAIYRLLEFGINMNEIEQTVIAIAAQRLVDLACPFC
FT                   ENGCSSVYCRQSRNTRRASVYELLYGKNLQQCIQEAKGNHANYQYQTLRQIIRKGIALG
FT                   YLTTNNYDRWVYHEKD"
FT   regulatory      160634..160640
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        160650..161621
FT                   /transl_table=11
FT                   /product="ComGB"
FT                   /db_xref="GOA:P25954"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25954"
FT                   /protein_id="BAA12534.1"
FT                   /translation="MTAGGYTLLDGLRLMELQMNKRQAADLTDSVTCLREGAPFYQVLK
FT                   SLSFHKEAVGICYFAETHGELPASMIQSGELLERKIAQADQLKRVLRYPLFLIFTVAVM
FT                   FYMLQSIIIPQFSGIYQSMNMETSRSTDMLFAFFQHIDLVIILLVLFTAGIGIYYWLVF
FT                   KKKSPARQMLICIRIPLVGKLVKLFNSYFFSLQLSSLLKSGLSIYDSLNAFKHQTFLPF
FT                   YRCEAEQLIERLKAGESIESAICGSLFYETDLSKVISHGQLSGRLDRELFTYSQFILQR
FT                   LEHKAQKWTGILQPMIYGFVAAMILLVYLSMLVPMYQMMNQM"
FT   regulatory      161621..161628
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        161635..161931
FT                   /transl_table=11
FT                   /product="ComGC"
FT                   /db_xref="GOA:P25955"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR016940"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25955"
FT                   /protein_id="BAA12535.1"
FT                   /translation="MNEKGFTLVEMLIVLFIISILLLITIPNVTKHNQTIQKKGCEGLQ
FT                   NMVKAQMTAFELDHEGQTPSLADLQSEGYVKKDAVCPNGKRIIITGGEVKVEH"
FT   regulatory      161908..161911
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        161921..162352
FT                   /transl_table=11
FT                   /product="ComGD"
FT                   /db_xref="GOA:P25956"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR016785"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25956"
FT                   /protein_id="BAA12536.1"
FT                   /translation="MNIKLNEEKGFTLLESLLVLSLASILLVAVFTTLPPAYDNTAVRQ
FT                   AASQLKNDIMLTQQTAISRQQRTKILFHKKEYQLVIGDTVIERPYATGLSIELLTLKDR
FT                   LEFNEKGHPNAGGKIRVKGHAVYDITVYLGSGRVNVERK"
FT   regulatory      162327..162333
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        162336..162683
FT                   /transl_table=11
FT                   /product="ComGE"
FT                   /db_xref="GOA:P25957"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25957"
FT                   /protein_id="BAA12537.1"
FT                   /translation="MWRENKGFSTIETMSALSLWLFVLLTVVPLWDKLMADEKMAESRE
FT                   IGYQMMNESISKYVMSGEGAASKTITKNNHIYAMKWEEEGEYQNVCIKAAAYKEKSFCL
FT                   SILQTEWLHAS"
FT   regulatory      163081..163085
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        163093..163467
FT                   /transl_table=11
FT                   /product="ComGG"
FT                   /db_xref="GOA:P25959"
FT                   /db_xref="InterPro:IPR020372"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25959"
FT                   /protein_id="BAA12538.1"
FT                   /translation="MYRTRGFIYPAVLFVSALVLLIVNFVAAQYISRCMFEKETKELYI
FT                   GENLLQNGVLLSIRHVLEERKGQEGTQQFLYGRVSYYIHDTSIKEQKEINLRVSTDSGT
FT                   ERTAQIVFDQKQKKLLRWTE"
FT   regulatory      164346..164352
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        164358..165119
FT                   /transl_table=11
FT                   /product="YqhD"
FT                   /db_xref="GOA:P40949"
FT                   /db_xref="InterPro:IPR023833"
FT                   /db_xref="InterPro:IPR023848"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40949"
FT                   /protein_id="BAA12539.1"
FT                   /translation="MFRLFHNQQKAKTKLKVLLIFQLSVIFSLTAAICLQFSDDTSAAF
FT                   HDIETFDVSLQTCKDFQHTDKNCHYDKRWDQSDLHISDQTDTKGTVCSPFALFAVLENT
FT                   GEKLKKSKWKWELHKLENARKPLKDGNVIEKGFVSNQIGDSLYKIETKKKMKPGIYAFK
FT                   VYKPAGYPANGSTFEWSEPMRLAKCDEKPTVPKKETKSDVKKENETTQKDIPEKTMKEE
FT                   TSQEAVTKEKETQSDQKESGEEDEKSNEADQ"
FT   regulatory      165085..165093
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        165103..165675
FT                   /transl_table=11
FT                   /product="YqhE"
FT                   /db_xref="GOA:P54506"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54506"
FT                   /protein_id="BAA12540.1"
FT                   /translation="MKLISNILYVIIFTLIIVLTLVVISTRSSGGEPAVFGYTLKSVLS
FT                   GSMEPEFNTGSLILVKEITDVKELQKGDVITFMQDANTAVTHRIVDITKQGDHLLFKTK
FT                   GDNNAAADSAPVSDENVRAQYTGFQLPYAGYMLHFASQPIGTAVLLIVPGVMLLVYAFV
FT                   TISSAIREIERKTKALETDTKDSTMST"
FT   regulatory      165724..165732
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        165739..166524
FT                   /transl_table=11
FT                   /product="YqhF"
FT                   /db_xref="GOA:P54507"
FT                   /db_xref="InterPro:IPR022121"
FT                   /db_xref="InterPro:IPR023833"
FT                   /db_xref="PDB:5OF1"
FT                   /db_xref="PDB:5OF2"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54507"
FT                   /protein_id="BAA12541.1"
FT                   /translation="MGMKKKLSLGVASAALGLALVGGGTWAAFNDIKSKDATFASGTLD
FT                   LSAKENSASVNLSNLKPGDKLTKDFQFENNGSLAIKEVLMALNYGDFKANGGSNTSPED
FT                   FLSQFEVTLLTVGKEGGNGYPKNIILDDANLKDLYLMSAKNDAAAAEKIKKQIDPKFLN
FT                   ASGKVNVATIDGKTAPEYDGVPKTPTDFDQVQMEIQFKDDKTKDEKGLMVQNKYQGNSI
FT                   KLQFSFEATQWNGLTIKKDHTDKDGYVKENEKAHSEDKN"
FT   CDS_pept        complement(166617..166952)
FT                   /transl_table=11
FT                   /product="SinR"
FT                   /db_xref="GOA:P06533"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010981"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036281"
FT                   /db_xref="PDB:1B0N"
FT                   /db_xref="PDB:2YAL"
FT                   /db_xref="PDB:3QQ6"
FT                   /db_xref="PDB:3ZKC"
FT                   /db_xref="PDB:5TN0"
FT                   /db_xref="PDB:5TN2"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06533"
FT                   /protein_id="BAA12542.1"
FT                   /translation="MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQ
FT                   FLEKVSAVLDVSVHTLLDEKHETEYDGQLDSEWEKLVRDAMTSGVSKKQFREFLDYQKW
FT                   RKSQKEE"
FT   regulatory      complement(166957..166968)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(166986..167159)
FT                   /transl_table=11
FT                   /product="SinI"
FT                   /db_xref="GOA:P23308"
FT                   /db_xref="InterPro:IPR010981"
FT                   /db_xref="InterPro:IPR036281"
FT                   /db_xref="PDB:1B0N"
FT                   /db_xref="PDB:5TMX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23308"
FT                   /protein_id="BAA12543.1"
FT                   /translation="MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHP
FT                   GPAARSHTVNPF"
FT   regulatory      complement(167169..167174)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(167342..168136)
FT                   /transl_table=11
FT                   /product="YqhG"
FT                   /db_xref="InterPro:IPR024562"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54508"
FT                   /protein_id="BAA12544.1"
FT                   /translation="MRQQEVHDFLLRFFQANSCQIVDQGLGYMTVQLTVEMDKQIMNRP
FT                   FYWHWREKTGGDPNPMKITFITDKENAPKDLDGEFIYFGAPRLFQIFKAVKQNGRFTRM
FT                   YEKIESAGAKVPLQPWLGINVTISYQSDMKKDKLLSLGLHLVSGTIIEDFQSKLTQFSL
FT                   TSQICDYCFTISPMIKPESGLKRMENYISKSAMQEPSDWAEQAVNRWKNDMTLLDKFYE
FT                   HIEEKPEEYHLEKQALKTLYQPKISVEIENGGLFYLQNNISS"
FT   regulatory      complement(168145..168151)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(168157..169830)
FT                   /transl_table=11
FT                   /product="YqhH"
FT                   /db_xref="GOA:P54509"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54509"
FT                   /protein_id="BAA12545.1"
FT                   /translation="MNTEMIYDAKWPEEFAERLKNDGPWANWELYKLSAEIQKTLAIPE
FT                   FEGLRAPLYLPSFTPLPHQLEVAQKVVEKMNGKAILADEVGLGKTVEAGLILKEYMIRG
FT                   LAKKILILVPASLVSQWVKELQEKFLIPAVEQKKSYVWEQCDIVVSSIDTAKRSPHREI
FT                   VLSIPYDLVIIDEAHKLKNSKTKNYEFVRNLVKKYCLLLTATPIQNRIEEIFNLVSLLK
FT                   PGHLGSQNHFQEEFAKKKSSLEAHEHLKDLVNKVMIRNRRHDTGLNWKQRHVETVPIQF
FT                   SPSEQALYDEISRLKDSINKPASMFSIMTLQRECCSSREAVYMTLKKMLDQKEKQAPAI
FT                   DEDTISVLIDRINQVTQNSKALQVVDLIKKIDDKVIIFTEYRATQIYLQWFLQQNGISS
FT                   VPFRGGFKRGKKDWMKDLFRGKIQVLIATEAGGEGINLQFCNHMINYDLPWNPMRLEQR
FT                   IGRIHRLGQERDVHIYNMATKHTVEEHILKLLYEKIHLFEKVVGELDDILTKIQVNNFE
FT                   EHLHDILYHSATEEEMKIKMDNLTSFLSYKKQLPAEKRGS"
FT   regulatory      complement(169840..169850)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      170261..170265
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        170272..171360
FT                   /transl_table=11
FT                   /product="YqhI"
FT                   /db_xref="GOA:P54378"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="PDB:1YX2"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54378"
FT                   /protein_id="BAA12546.1"
FT                   /translation="MLKRTPLFDLYKEYGGKTIDFGGWELPVQFSSIKKEHEAVRTAAG
FT                   LFDVSHMGEVEVSGNDSLSFLQRLMTNDVSALTPGRAQYTAMCYPDGGTVDDLLIYQKG
FT                   ENRYLLVINASNIDKDLAWMKEHAAGDVQIDNQSDQIALLAVQGPKAEAILKNLTDADV
FT                   SALKPFAFIDEADISGRKALISRTGYTGEDGYEIYCRSDDAMHIWKKIIDAGDAYGLIP
FT                   CGLGARDTLRFEANVPLYGQELTRDITPIEAGIGFAVKHKKESDFFGKSVLSEQKENGA
FT                   KRKLVGLEMIEKGIPRHGYEVFQNGKSVGKVTTGTQSPTLGKNVGLALIDSETSEIGTV
FT                   VDVEIRKKLVKAKVVKTPFYKR"
FT   regulatory      171374..171382
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        171390..172736
FT                   /transl_table=11
FT                   /product="YqhJ"
FT                   /db_xref="GOA:P54376"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023010"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54376"
FT                   /protein_id="BAA12547.1"
FT                   /translation="MKHRYLPATEKDKQEMLATIGVSSIDDLFADIPENVKYKKEHQIK
FT                   KAKSETELTRELTKLASKNRDTVQYASFLGAGVYDHYQPVIVDHVISRSEFYTAYTPYQ
FT                   PEISQGELQAIFEFQTMICELTGMDIANSSMYDGGTALAEAAMLASGHTKKKKIVVSKT
FT                   VHPESREVLKTYAKGQYIDVVEVPAADGVTDLDALRQTVCENTAAVIVQYPNFFGRIEP
FT                   LKDIEPIAHQGKSMFIVSANPLALGLLTPPGKFQSDIVVGDAHRFGIPSAYGGPHCGFF
FT                   AVTKKLMRKVPGRLVGQTEDENGKRGFVLTLQAREQHIRRDKATSNICSNQALNALAAS
FT                   VAMTALGKNGVKDIARQNLLKANYAKQEAKKAGLTVMFDGPMFNEFVIKLDEPVRAVNK
FT                   RLLAKGMIGGYDLGLTYPELDCHMLIAVTELRTKEEIDALIQELGDRHE"
FT   regulatory      172718..172725
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        172729..174195
FT                   /transl_table=11
FT                   /product="YqhK"
FT                   /db_xref="GOA:P54377"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023012"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54377"
FT                   /protein_id="BAA12548.1"
FT                   /translation="MSNQDQALIFELSREGRIGYSLPELDVPEIELGDLLSDTYIRDED
FT                   AALPEVSELDIMRHYTALSKRNHGVDSGFYPLGSCTMKYNPKINEKIARIPGFAAIHPL
FT                   QDEDTVQGALELLYDLSKHLEEITGMDEVTLQPAAGAHGEWTGLMMIRAYHEARGDFKR
FT                   TKVIVPDSAHGTNPASATVAGFETVTVKSNEKGLVDLEDLKRAVNEETAALMLTNPNTL
FT                   GLFEEQITEMAEIVHQAGGKLYYDGANLNAVLSKARPGDMGFDVVHLNLHKTFTGPHGG
FT                   GGPGSGPVGVKQDLIPYLPKPVLVKKEGRFTFDYDRPHAIGRVKPYYGNFGINVRAYTY
FT                   IRSMGPDGLKAVTENAVLNANYMMRKLAPYYDLPFDRHCKHEFVLSGKRQKKLGVRTLD
FT                   IAKRLLDFGYHPPTIYFPLNVEECIMIEPTETESKETLDAFIDAMIQIAKEAEENPELV
FT                   QEAPHTTIVKRMDETKAARHPVLRYEAEER"
FT   CDS_pept        complement(174230..174610)
FT                   /transl_table=11
FT                   /product="YqhL"
FT                   /db_xref="GOA:P54510"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54510"
FT                   /protein_id="BAA12549.1"
FT                   /translation="MSNMIVLIIFPAFIIYMIASYVYQQRIMKTLTEEEFRAGYRKAQL
FT                   IDVREPNEFEGGHILGARNIPLSQLKQRKNEIRTDKPVYLYCQNSVRSGRAAQTLRKNG
FT                   CTEIYNLKGGFKKWGGKIKAKK"
FT   regulatory      complement(174621..174627)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      175039..175042
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        175047..175637
FT                   /transl_table=11
FT                   /product="YqhM"
FT                   /db_xref="GOA:P54511"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR024898"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54511"
FT                   /protein_id="BAA12550.1"
FT                   /translation="MLHDQELTYSVIVSEEHPEMPATVTEAYRVISEGILQGFRNLGLD
FT                   AYFAIPRTEKEKESLKNPRSSVCFDAPSWYELVVEGRKVAGSAQTRQKGVILQHGSILL
FT                   DLDEDKLFDLFLYPSERVRERMQRNFKNKAVAINELIEKRVTMDEARKAFKEGFETGLN
FT                   IHLEPYELSQEELDFVHHLAETKYASDEWNYKR"
FT   regulatory      175726..175730
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        175737..176165
FT                   /transl_table=11
FT                   /product="YqhN"
FT                   /db_xref="GOA:P54512"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR022897"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="PDB:1ON1"
FT                   /db_xref="PDB:1ON2"
FT                   /db_xref="PDB:2EV0"
FT                   /db_xref="PDB:2EV5"
FT                   /db_xref="PDB:2EV6"
FT                   /db_xref="PDB:2F5C"
FT                   /db_xref="PDB:2F5D"
FT                   /db_xref="PDB:2F5E"
FT                   /db_xref="PDB:2F5F"
FT                   /db_xref="PDB:2HYF"
FT                   /db_xref="PDB:2HYG"
FT                   /db_xref="PDB:3R60"
FT                   /db_xref="PDB:3R61"
FT                   /db_xref="PDB:4HV5"
FT                   /db_xref="PDB:4HV6"
FT                   /db_xref="PDB:4HX4"
FT                   /db_xref="PDB:4HX7"
FT                   /db_xref="PDB:4HX8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54512"
FT                   /protein_id="BAA12551.1"
FT                   /translation="MTTPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQK
FT                   LDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLDQFLRIIGVDEEKIYNDVEGIEHH
FT                   LSWNSIDRIGDLVQYFEEDDARKKDLKSIQKKTEHHNQ"
FT   regulatory      176279..176283
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        176291..177166
FT                   /transl_table=11
FT                   /product="YqhO"
FT                   /db_xref="GOA:P54513"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54513"
FT                   /protein_id="BAA12552.1"
FT                   /translation="MYIDGVFSGGGVKGIALAGAYEVLEEKGFRFKRVAGTSAGAIIAA
FT                   FIASGYTSKEIHALIEEVDGEKLLDQRYSFLPLKMLQWVSIYWRLGLYKGDTIEKWIAD
FT                   LLRAKGIRVFGDLQKGSLRLIASDLTNGTMIVLPDDLARYGLNPDMFPVARAVRMSCSI
FT                   PYFFEPIKLKTDTGTATVVDGGVLSNFPIWLFSKERKRPVIGVTLAPRERERPKKNIRN
FT                   AFELFGALFETMKDAHDARHIASRYEQNIIFLPVDDVMATDFHLTQQKKLALIELGKRR
FT                   TELFLKQWTY"
FT   CDS_pept        complement(177163..177558)
FT                   /transl_table=11
FT                   /product="YqhP"
FT                   /db_xref="GOA:P54514"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54514"
FT                   /protein_id="BAA12553.1"
FT                   /translation="MNHRVQPIIAVLIALGAFGFLYVLVTNPGEMAKMAVTVIVAGIII
FT                   YFIVKYVMNRNAGSEGAAFKKAAKQSRRRMKEQKAKHRAGHKGRVSHLRSVPSASKPKP
FT                   MILKKKSQTQLTVIEGKKNKKKNRALF"
FT   regulatory      complement(177566..177572)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(177598..178554)
FT                   /transl_table=11
FT                   /product="YqhQ"
FT                   /db_xref="GOA:P54515"
FT                   /db_xref="InterPro:IPR010787"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54515"
FT                   /protein_id="BAA12554.1"
FT                   /translation="MSKHKVPPAYGGQAVVEGVMFGGKHHYVTAIRRTDGSIDFFKLPR
FT                   KHNPKLNIVKKIPFLRGIAAIIEASANGTKHLNFSSERYGLDPSEDETLEQEEKKSSGL
FT                   SMYLSLAVIGVLSFLFSKFVFTLVPVFLAELTRPIFSLNTAQIAIESLFKLILLLGYIY
FT                   FLSMTPLIKRVFQYHGAEHKVINCYEQNLPITVENVQNQSRLHYRCGSSFILFTIIVGM
FT                   FVYLLVPTDPLWLRVIDRVALIPVVLGISFEVLQLTNKVRDIRGLKLLGYPGLWLQLLT
FT                   TKEPKDEQVEVAIESFNELLRLEALSEQNQKPSHNVI"
FT   regulatory      complement(178558..178567)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      178772..178778
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        178781..179317
FT                   /transl_table=11
FT                   /product="YqhR"
FT                   /db_xref="GOA:P54516"
FT                   /db_xref="InterPro:IPR024563"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54516"
FT                   /protein_id="BAA12555.1"
FT                   /translation="MMTSEKDTEQNEELNEKQKPPVSMAGRVAATGFCGGVLWSFVAYI
FT                   AYLFHFSEISPNMILQPFVLGEWKKHGLGTVISIILIGVISIGAAFLYFLLLKRLKTMW
FT                   PGILYGLVLWLLVFFVFNPIFPDVRTVTELTSDTIITTICIYLLYGLFVGYSISFEYNE
FT                   LNSEKLARALGMHRE"
FT   regulatory      179390..179396
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        179404..179850
FT                   /transl_table=11
FT                   /product="YqhS"
FT                   /db_xref="GOA:P54517"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="PDB:1GQO"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54517"
FT                   /protein_id="BAA12556.1"
FT                   /translation="MPHFLILNGPNVNRLGSREPEVFGRQTLTDIETDLFQFAEALHIQ
FT                   LTFFQSNHEGDLIDAIHEAEEQYSGIVLNPGALSHYSYAIRDAVSSISLPVVEVHLSNL
FT                   YAREEFRHQSVIAPVAKGQIVGLGAEGYKLAVRYLLSQQGGESR"
FT   regulatory      179836..179839
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        179847..180908
FT                   /transl_table=11
FT                   /product="YqhT"
FT                   /db_xref="GOA:P54518"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54518"
FT                   /protein_id="BAA12557.1"
FT                   /translation="MKLEKLRNLFGQLGIDGMLITSNTNVRYMTGFTGSAGLAVISGDK
FT                   AAFITDFRYTEQAKVQVKGFEIIEHGGSLIQTTADTVESFGIKRLGFEQNSMTYGTYAS
FT                   YSAVISDAELVPVAESVEKLRLIKSSEEIKILEEAAKIADDAFRHILTFMKPGISEIAV
FT                   ANELEFYMRSQGADSSSFDMIVASGLRSSLPHGVASDKLIESGDLVTLDFGAYYKGYCS
FT                   DITRTVAVGQPSDQLKEIYQVVFDAQALGVAHIKPGMTGKEADALTRDHIAAKGYGDYF
FT                   GHSTGHGLGMEVHESPGLSVRSSAILEPGMVVTVEPGIYIPETGGVRIEDDIVITENGN
FT                   RTITHSPKELIIL"
FT   regulatory      180918..180923
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        180933..181490
FT                   /transl_table=11
FT                   /product="YqhU"
FT                   /db_xref="GOA:P49778"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49778"
FT                   /protein_id="BAA12558.1"
FT                   /translation="MISVNDFRTGLTIDVDGGIWRVVDFQHVKPGKGAAFVRSKLRNLR
FT                   TGAIQEKTFRAGEKVAKAQIETKTMQYLYANGDQHVFMDTSSYEQLELSATQIEEELKY
FT                   LLENMSVHIMMYQDETLGIELPNTVELKVVETEPGIKGDTASGGTKPAKTETGLVVNVP
FT                   FFVNEGDTLVVNTSDGSYVSRA"
FT   regulatory      181625..181628
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        181635..181916
FT                   /transl_table=11
FT                   /product="YqhV"
FT                   /db_xref="GOA:P49779"
FT                   /db_xref="InterPro:IPR020390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49779"
FT                   /protein_id="BAA12559.1"
FT                   /translation="MKFLLGNINSTVLTMAGLRVLSSMIELTAAIVMLVTNDVRKAVVV
FT                   NSILAIVGPLIFIITMTVGIYQIAGQLSYAKLILIFTGVVLILAGVHK"
FT   regulatory      181985..181993
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        181992..182915
FT                   /transl_table=11
FT                   /product="SpoIIIAA"
FT                   /db_xref="GOA:Q01367"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014217"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01367"
FT                   /protein_id="BAA12560.1"
FT                   /translation="MNEIAEVLPESMKNALSEIPEQQWLEIEEVRIRINRPVELIRRGQ
FT                   PVYLSYAGTAEDAHLILSRLSNYSMYTLEEELKKGYVTIRGGHRVGLAGRVITENGGVK
FT                   GLRDIASFNIRIARQKLGIAEPLLPYLYQNSWLNTLIIGPPQTGKTTLLRDLARLSSTG
FT                   KKNMLPVKTGIVDERSEIAGCLRGIPQHQFGQRIDVLDACPKAEGLMMMIRSMSPEVMI
FT                   VDEIGRMEDTDALLEALHAGVSVIVSAHGWSISDLMKRPSLKRLWEERAFDRYLELSRA
FT                   KGPGTVSQIYDKDGNVLSRTTGVKTC"
FT   regulatory      182895..182904
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        182909..183424
FT                   /transl_table=11
FT                   /product="SpoIIIAB"
FT                   /db_xref="GOA:Q01368"
FT                   /db_xref="InterPro:IPR014198"
FT                   /db_xref="PDB:6BS9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01368"
FT                   /protein_id="BAA12561.1"
FT                   /translation="MLKLLGAVFIVVATTWTGFEMAKIYTERPRQIRQLRAALQSLEAE
FT                   IMYGHTPLHTASQQIAKQLAQPVSTLFSAFSDQLDKGSDSAKTAWEQSLKKVWDTLSLK
FT                   KSEYEVLKQFGETLGIHDRISQQKHIKLALTHLEASEADAEQAQAKNEKMIKSLGFLAG
FT                   LLLILLLM"
FT   regulatory      183430..183434
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        183447..183653
FT                   /transl_table=11
FT                   /product="SpoIIIAC"
FT                   /db_xref="GOA:P49780"
FT                   /db_xref="InterPro:IPR009570"
FT                   /db_xref="InterPro:IPR025664"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49780"
FT                   /protein_id="BAA12562.1"
FT                   /translation="MGVDVNVIFQIAGVGIVVAFLHTILDQMGKKEYAQWVTLLGFIYI
FT                   LFMVATIVDDLFKKIKAVFLFQG"
FT   regulatory      183652..183656
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        183660..184061
FT                   /transl_table=11
FT                   /product="SpoIIIAD"
FT                   /db_xref="GOA:P49781"
FT                   /db_xref="InterPro:IPR014211"
FT                   /db_xref="InterPro:IPR025664"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49781"
FT                   /protein_id="BAA12563.1"
FT                   /translation="MQIDIVQIVGLGLIATFLSLIVKEQKPTFAFLIVVFAGCAIFLYL
FT                   VDQIYDIIRMIEKIAINANVNMVYVETILKIIGIAYIAEFGAQLTKDAGQGAIASKIEL
FT                   AGKILILVMAVPILTVIIETILGLIPSMS"
FT   regulatory      184065..184072
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        184080..185297
FT                   /transl_table=11
FT                   /product="SpoIIIAE"
FT                   /db_xref="GOA:P49782"
FT                   /db_xref="InterPro:IPR014194"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49782"
FT                   /protein_id="BAA12564.1"
FT                   /translation="MKRFQWVLLLAVLIIAGRAEIVQAAGNAGQTEDHAETAEQLAERT
FT                   AASLETDKIGEFWNDIMTEYGGLLPESQKGSLMEFINGDKSFSPQEWLKALFSYLFHEV
FT                   LANGKLLGTLILLTIFCVILQLLQNAFQQSTVSKVAYSIVYMVLIILALNSFHVAINYA
FT                   TEAIQTMTSFILALIPLLLALLASSGGAVSAAFFHPVILFLMNTSGLLIQNIVMPLIFL
FT                   SAILSIVSTMTEQYKVTQLANLLRNIAIGALAVFLTIFLGVISVQGASAAVTDGITLRT
FT                   AKFITGNFIPVLGRMFTDATDTVISASLLLKNTVGILGVAILICIAAFPAIKVLSLAFI
FT                   YKLAAAILQPLGGGPVITCLDVISKSGHLYFCSSRHCVSHVFFKPYCHNHSRKPHDDDE
FT                   MKEAGK"
FT   regulatory      185280..185286
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        185294..185914
FT                   /transl_table=11
FT                   /product="SpoIIIAF"
FT                   /db_xref="GOA:P49783"
FT                   /db_xref="InterPro:IPR014245"
FT                   /db_xref="PDB:6DCS"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49783"
FT                   /protein_id="BAA12565.1"
FT                   /translation="MSFLTEWLTTIVLFILFAIVIDMLLPSSSMQKYAKMVVSLLLIVV
FT                   MLTPIFKLFKTDPEVIFEYLTKNGQSESADIKNQINSKKIEIQASQRAYILEEMAVQLK
FT                   KKAEERFSHDEYKVGRIKLTAGEKVDSEEDIKTISVYMAPSSEKTVQTVAPVHIDTDHA
FT                   YVTKEAAEQKEAKQIQTQLADIWEIGSEKITVHMEGGESVGNE"
FT   regulatory      185891..185897
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        185907..186596
FT                   /transl_table=11
FT                   /product="SpoIIIAG"
FT                   /db_xref="GOA:P49784"
FT                   /db_xref="InterPro:IPR014195"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49784"
FT                   /protein_id="BAA12566.1"
FT                   /translation="MNKNGLWNVLKKQSLPGQTKDGEKPKLTKYHYFLFVFVLGVSFML
FT                   VSQLFSSPEKTENAKTITAVSSQHSADSKEKTAEVFKASKSDKPKDSIDDYEKEYENQL
FT                   KEILETIIGVDDVSVVVNVDATSLKVYEKNKSNKNTTTEETDKEGGKRSVTDQSSEEEI
FT                   VMIKNGDKETPVVVQTKKPDIRGVLVVAQGVDNVQIKQTIIEAVTRVLDVPSHRVAVAP
FT                   KKIKEDS"
FT   regulatory      186581..186588
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        186597..187253
FT                   /transl_table=11
FT                   /product="SpoIIIAH"
FT                   /db_xref="GOA:P49785"
FT                   /db_xref="InterPro:IPR024232"
FT                   /db_xref="InterPro:IPR038503"
FT                   /db_xref="PDB:3TUF"
FT                   /db_xref="PDB:3UZ0"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49785"
FT                   /protein_id="BAA12567.1"
FT                   /translation="MLKKQTVWLLTMLSLVVVLSVYYIMSPESKNAVQMQSEKSASDSG
FT                   EVATEKAPAKQDTKEKSGTETEKGKEDGTKGTKDSSADKETSAEASEKGTVVTETADDD
FT                   LFTTYRLDLEDARSKEREELNAIVSSDDATAKEKSEAYDKMTALSEVEGTGKQLETLIK
FT                   TQGYEDALVNAEGDKINITVKSDKHSKSKATAIIDLVAKEIKTMKDVAVTFEPSK"
FT   regulatory      187395..187399
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        187409..187888
FT                   /transl_table=11
FT                   /product="YqhW"
FT                   /db_xref="GOA:P49786"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49786"
FT                   /protein_id="BAA12568.1"
FT                   /translation="MLNIKEIHELIKAIDESTIDEFVYENEGVSLKLKKHEAGTVQVMQ
FT                   QAPAAPVQAQAPQAVQPQAQQAAAPAQEAPKQDENLHKITSPMVGTFYASSSPEAGPYV
FT                   TAGSKVNENTVVCIVEAMKLFNEIEAEVKGEIVEVLVENGQLVEYGQPLFLVKAE"
FT   regulatory      187887..187892
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        187900..189252
FT                   /transl_table=11
FT                   /product="YqhX"
FT                   /db_xref="GOA:P49787"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49787"
FT                   /protein_id="BAA12569.1"
FT                   /translation="MIKKLLIANRGEIAVRIIRACRELGIETVAVYSEADKDALHVQMA
FT                   DEAFCIGPKASKDSYLNVTNIVSVAKLTGTDAIHPGYGFLAENADFAELCEEVNVTFVG
FT                   PSPDAISKMGTKDVARETMKQAGVPIVPGSQGIIENVEEAVSLANEIGYPVIIKATAGG
FT                   GGKGIRVARTEEELINGIKITQQEAATAFRNPGVYIEKYIEDFRHVEIQVLADNYGNTI
FT                   HLGERDCSIQRRLQKLLEESPSPALDSEIREQMGDAAVKAAKAVGYTGAGTVEFIYDYN
FT                   EQRYYFMEMNTRIQVEHPVTEMVTGTDLIKEQIKVASGMELSLKQEDVEFEGWAIECRI
FT                   NAENPSKNFMPSPGEIKMYLPPGGLGVRVDSAAYPGYSIPPYYDSMIAKVITYGKTRDE
FT                   AIARMKRALSEFVIEGIETTIPFHLKLLEHETFVSGEFNTKFLETYDVMGS"
FT   regulatory      189260..189267
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        189273..189680
FT                   /transl_table=11
FT                   /product="YqhY"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54519"
FT                   /protein_id="BAA12570.1"
FT                   /translation="MKDNSLLKMDHEDTHLGKVEIAPEVIEVIAGIAASEVDGVPEMRG
FT                   NFPTGVVERFGKVNHGKGVKVDLADDGITIDVYCVVTFGVSIPKVAASVQENIRQTLLN
FT                   MTSLSINEINIHIVGIQFDTKAQEVQIDEEM"
FT   regulatory      189930..189936
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        189944..190339
FT                   /transl_table=11
FT                   /product="YqhZ"
FT                   /db_xref="GOA:P54520"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54520"
FT                   /protein_id="BAA12571.1"
FT                   /translation="MKRRTAREKALQALFQIDVSDIAVNEAIEHALDEEKTDPFFEQLV
FT                   HGVLEHQDQLDEMISKHLVNWKLDRIANVDRAILRLAAYEMAYAEDIPVNVSMNEAIEL
FT                   AKRFGDDKATKFVNGVLSNIKSDIGQS"
FT   regulatory      190338..190343
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        190351..191202
FT                   /transl_table=11
FT                   /product="YqiA"
FT                   /db_xref="GOA:P54382"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54382"
FT                   /protein_id="BAA12572.1"
FT                   /translation="MTATIIDGKETAREKREQLAKEVEELKKQGVTPGLAVILIGDDPA
FT                   SHSYVRGKKKAAETMGMNFKLDQFDSSLTEAELLSIIDQYNQDPEFHGILVQLPLPDHI
FT                   SEKAVIERISPDKDVDGFHPLNVGKMLLGEDTFLPCTPHGIVELLKKTNIDLSGKEVVV
FT                   VGRSNIVGKPVGQLLLNENATVTYCHSRTENITEHTKKADILVVAVGRANFISADQIKE
FT                   GAVVIDVGVNRLENGKLCGDVEFEGAKEKASFITPVPGGVGPMTITMLAHNTVKSAKRT
FT                   LS"
FT   regulatory      191326..191330
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        191340..192686
FT                   /transl_table=11
FT                   /product="YqiB"
FT                   /db_xref="GOA:P54521"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54521"
FT                   /protein_id="BAA12573.1"
FT                   /translation="MGEAAYVTVSALTKYIKRKFDVDPHLENIWIKGELSNVKIHTRGH
FT                   IYFTLKERKGRMQSVMFARQSERLPFKPENGMKVLVRGGISVYEPSGNYQLYAKEMQPD
FT                   GVGALYLAYEELKKKLAGEGLFDDRYKKQIPAFPATIGVVTSPTGAAVRDVITTLKRRY
FT                   PLVKVIVLPALVQGENASRSIVTRIEEANEKEICDVLIVGRGGGSIEELWAFNEEIVAR
FT                   AIFASNIPIISAVGHETDFTISDFVADIRAATPTGAAEIAVPHTTDLIERTKTAEVRMT
FT                   RAMQQHLGQEKGRIQTLQSSYAFRFPKRLYAQKEQQFDLAYQQFQAQLTALLDRKSRQL
FT                   ERETYRLEALHPHEQLKQARTRYQEQTNQLRKNMNIQMKQLHSQFQTVLGKLNALSPLQ
FT                   VMERGYSLAYKEDKLIKSVSQIEEQDRLEIKLKDGVLTCEVLEKRGEEK"
FT   regulatory      192761..192766
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        192772..192936
FT                   /transl_table=11
FT                   /product="YqiC"
FT                   /db_xref="GOA:P54522"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54522"
FT                   /protein_id="BAA12574.1"
FT                   /translation="MPLEQAINYFQEGMALSKMCHEKLQKVEKQMDFILKEDGELAPFS
FT                   VQEEDEGDK"
FT   regulatory      192911..192916
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        192926..193744
FT                   /transl_table=11
FT                   /product="YqiD"
FT                   /db_xref="GOA:P54383"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54383"
FT                   /protein_id="BAA12575.1"
FT                   /translation="MTNKLTSFLADRKKTIENQLSVYTEKLDMPDSLKKSMLYSLQAGG
FT                   KRLRPLIVLAVLNAYGKSEKDGIPVGCAVEMIHTYSLIHDDLPCMDDDDLRRGKPTNHK
FT                   VFGEATAVLAGDGLLTESFKLITSHVSDEVSAEKRLRLVNELISAAGTEGMVGGQVADM
FT                   EAGNRQVTLEELESIHERKTSKLLGFCVIAGAILADAPEEDIETLRTFSSHIGIGFQIR
FT                   DDILDLEGSEEKIGKRVGSDTTNDKSTYPSLLSLEGAKHKLDVHIKEAND"
FT   regulatory      193973..193986
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        193991..195892
FT                   /transl_table=11
FT                   /product="YqiE"
FT                   /db_xref="GOA:P54523"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54523"
FT                   /protein_id="BAA12576.1"
FT                   /translation="MDLLSIQDPSFLKNMSIDELEKLSDEIRQFLITSLSASGGHIGPN
FT                   LGVVELTVALHKEFNSPKDKFLWDVGHQSYVHKLLTGRGKEFATLRQYKGLCGFPKRSE
FT                   SEHDVWETGHSSTSLSGAMGMAAARDIKGTDEYIIPIIGDGALTGGMALEALNHIGDEK
FT                   KDMIVILNDNEMSIAPNVGAIHSMLGRLRTAGKYQWVKDELEYLFKKIPAVGGKLAATA
FT                   ERVKDSLKYMLVSGMFFEELGFTYLGPVDGHSYHELIENLQYAKKTKGPVLLHVITKKG
FT                   KGYKPAETDTIGTWHGTGPYKINTGDFVKPKAAAPSWSGLVSGTVQRMAREDGRIVAIT
FT                   PAMPVGSKLEGFAKEFPDRMFDVGIAEQHAATMAAAMAMQGMKPFLAIYSTFLQRAYDQ
FT                   VVHDICRQNANVFIGIDRAGLVGADGETHQGVFDIAFMRHIPNMVLMMPKDENEGQHMV
FT                   HTALSYDEGPIAMRFPRGNGLGVKMDEQLKTIPIGTWEVLRPGNDAVILTFGTTIEMAI
FT                   EAAEELQKEGLSVRVVNARFIKPIDEKMMKSILKEGLPILTIEEAVLEGGFGSSILEFA
FT                   HDQGEYHTPIDRMGIPDRFIEHGSVTALLEEIGLTKQQVANRIRLLMPPKTHKGIGS"
FT   regulatory      195875..195880
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        195889..196698
FT                   /transl_table=11
FT                   /product="YqiF"
FT                   /db_xref="GOA:P19672"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19672"
FT                   /protein_id="BAA12577.1"
FT                   /translation="MTSKKERLDVLLVERGLAETREKAKRAIMAGIVYSNENRLDKPGE
FT                   KIDRDLPLTVKGNPLRYVSRGGLKLEKALKEFPVSVKDKIMIDIGSSTGGFTDCALQNG
FT                   AKQSYAVDVGYNQLAWKLRQDERVVVMERTNFRYATPADFTKGMPEFATIDVSFISLRL
FT                   ILPVLRTLLVPGSDCMALVKPQFEAGRESVGKKGIVRDPKVHADVLKRMISFSAAEGYI
FT                   CKGLSFSPITGGDGNIEFLLQFALAGRGTGRPGTAGRRDHARCRRST"
FT   regulatory      196821..196827
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        196833..197282
FT                   /transl_table=11
FT                   /product="AhrC"
FT                   /db_xref="GOA:P17893"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:1F9N"
FT                   /db_xref="PDB:2P5K"
FT                   /db_xref="PDB:2P5L"
FT                   /db_xref="PDB:2P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17893"
FT                   /protein_id="BAA12578.1"
FT                   /translation="MNKGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDI
FT                   KELHLVKVPTNNGSYKYSLPADQRFNPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQ
FT                   AIGALMDNLDWDEMMGTICGDDTILIICRTPEDTEGVKNRLLELL"
FT   regulatory      197302..197309
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        197319..199049
FT                   /transl_table=11
FT                   /product="RecN"
FT                   /db_xref="GOA:P17894"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17894"
FT                   /protein_id="BAA12579.1"
FT                   /translation="MLAELSIKNFAIIEELTVSFERGLTVLTGETGAGKSIIIDAISLL
FT                   VGGRGSSEFVRYGEAKAELEGLFLLESGHPVLGVCAEQGIDVSDEMIVMRRDISTSGKS
FT                   VCRVNGKLVTIASLREIGRLLLDIHGQHDNQLLMEDENHLQLLDKFAGAEVESALKTYQ
FT                   EGYQRYVKLLKKLKQLSESEQEMAHCLDLIQFQLEEIESAKLELNEDEQLQEERQQISN
FT                   FEKIYESLQNAYNALRSEQGGLDWVGMASAQLEDISDINEPLKKMSESVSNSYYLLEDA
FT                   TFQMRNMLDELEFDPERLNYIETRLNEIKQLKRKYGATVEDILEYASKIEEEIDQIENR
FT                   DSHLQSLKKELDSVGKDVAVEAANVSQIRKTWAKKLADEIHRELKSLYMEKSTFDTEFK
FT                   VRTASRNEEAPLVNGQPVQLTEQGIDLVKFLISTNTGEPLKSLSKVASGGELSRVMLAI
FT                   KSIFSSQQDVTSIIFDEVDTGVSGRVAQAIAEKIHKVSIGSQVLCITHLPQVAAMADTH
FT                   LYIAKELKDGRTTTRVKPLSKQEKVAEIERSIAGVEVTDLTKRHAKELLKQADQVKTTG
FT                   "
FT   regulatory      199206..199215
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        199224..200501
FT                   /transl_table=11
FT                   /product="SpoIVB"
FT                   /db_xref="GOA:P17896"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008763"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR014219"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17896"
FT                   /protein_id="BAA12580.1"
FT                   /translation="MPDNIRKAVGLILLVSLLSVGLCKPLKEYLLIPTQMRVFETQTQA
FT                   IETSLSVNAQTSESSEAFTVKKDPHEIKVTGKKSGESELVYDLAGFPIKKTKVHVLPDL
FT                   KVIPGGQSIGVKLHSVGVLVGFHQINTSEGKKSPGETAGIEAGDIIIEMNGQKIEKMND
FT                   VAPFIQKAGKTGESLDLLIKRDKQKIKTKLIPEKDEGEGKYRIGLYIRDSAAGIGTMTF
FT                   YEPKTKKYGALGHVISDMDTKKPIVVENGEIVKSTVTSIEKGTGGNPGEKLARFSSERK
FT                   TIGDINRNSPFGIFGTLHQPIQNNISDQALPVAFSTEVKKGPAEILTVIDDDKVEKFDI
FT                   EIVSTTPQKFPATKGMVLKITDPRLLKETGGIVQGMSGSPIIQNGKVIGAVTHVFVNDP
FT                   TSGYGVHIEWMLSEAGIDIYGKEKAS"
FT   regulatory      200765..200769
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        200777..201580
FT                   /transl_table=11
FT                   /product="Spo0A"
FT                   /db_xref="GOA:P06534"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012052"
FT                   /db_xref="InterPro:IPR014879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="PDB:1LQ1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06534"
FT                   /protein_id="BAA12581.1"
FT                   /translation="MEKIKVCVADDNRELVSLLSEYIEGQEDMEVIGVAYNGQECLSLF
FT                   KEKDPDVLVLDIIMPHLDGLAVLERLRESDLKKQPNVIMLTAFGQEDVTKKAVDLGASY
FT                   FILKPFDMENLVGHIRQVSGNASSVTHRAPSSQSSIIRSSQPEPKKKNLDASITSIIHE
FT                   IGVPAHIKGYLYLREAISMVYNDIELLGSITKVLYPDIAKKFNTTASRVERAIRHAIEV
FT                   AWSRGNIDSISSLFGYTVSMTKAKPTNSEFIAMVADKLRLEHKAS"
FT   CDS_pept        complement(202096..203214)
FT                   /transl_table=11
FT                   /product="YqiG"
FT                   /db_xref="GOA:P54524"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54524"
FT                   /protein_id="BAA12582.1"
FT                   /translation="MNPKYKPLFEPFTFKSGVTINNRIAVAPMTHYASNEDGTISEAEL
FT                   DYIIPRSKEMGMVITACANVTPDGKAFPGQPAIHDDSNIPGLKKLAQAIQAQGAKAVVQ
FT                   IHHGGIECPSELVPQQDVVGPSDVFDNGKQIARALTEEEVENIVKAFGEATRRAIEAGF
FT                   DGVEIHGANGYLIQQFYSPKTNQRTDRWGGSDEKRLAFPLAIVDEVKKAASEHAKGAFL
FT                   VGYRLSPEEPETPGLTMTETYTLVDALGDKELDYLHISLMDVNSKARRGADPTRTRMDL
FT                   LNERVGNKVPLIAVGSIHSADDALAVIENGIPLVAMGREILVDPNWTVKVKEGREKQIE
FT                   TVIKGTDKEKYHLPEPLWQAIVNTQGWVPYKD"
FT   regulatory      complement(203217..203230)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      203732..203742
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        203746..204039
FT                   /transl_table=11
FT                   /product="YqiH"
FT                   /db_xref="GOA:P40770"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40770"
FT                   /protein_id="BAA12583.1"
FT                   /translation="MKQTVLLLFTALFLSGCSVASADDSVPRFTEEGKYIGSADPHTIA
FT                   VSLNGEETMIQVPKDKRDECESLPDQTHVLVKYTKKDNGTLQLEDIQLRKTS"
FT   regulatory      204042..204046
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        204054..204242
FT                   /transl_table=11
FT                   /product="YqiI"
FT                   /db_xref="GOA:P54525"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54525"
FT                   /protein_id="BAA12584.1"
FT                   /translation="MRMLWRSLALCGLALTLAPCAQAAEPIEGKTVYIDAGHAVKTVER
FT                   SETGSLKRILICLSQSM"
FT   regulatory      204310..204314
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        204320..204688
FT                   /transl_table=11
FT                   /product="YqiJ"
FT                   /db_xref="GOA:P54525"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54525"
FT                   /protein_id="BAA12585.1"
FT                   /translation="MAKASANQADLFVSIHVNSGVASASGTETYFQSDYEGENSRRLAS
FT                   DIQSQLVSSLQTRDRGVKESDFYVITYSQMPSVLADLGLSRTALTRTSWEVKNTSKRPQ
FT                   MRLSMALILIMISRLIQP"
FT   regulatory      204740..204746
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        204751..205470
FT                   /transl_table=11
FT                   /product="YqiK"
FT                   /db_xref="GOA:P54527"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54527"
FT                   /protein_id="BAA12586.1"
FT                   /translation="MTKIFPHRGASGQFPENTMLAFEKGIEAGADGIELDVQLTKDGRI
FT                   VVIHDERLNRTTSLKGFVKDTAYDEVKTANAAAGHDQAYSDIKVPLLEDVLSWAVKKDF
FT                   LINIELKNSVIRYEGMEEKVLEAVKRFNVEDRVILSTFNHDSLALCARLAPHIERAVLT
FT                   SDVLYQADRYIASIPASGYHPKINSPGVTDEVLKKMRNGLIKVRPYTVNRPEDMKRLIE
FT                   AGADRMFTDFPERLRHC"
FT   regulatory      205597..205603
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        205608..206789
FT                   /transl_table=11
FT                   /product="YqiL"
FT                   /db_xref="GOA:P45855"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="PDB:5LP7"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45855"
FT                   /protein_id="BAA12587.1"
FT                   /translation="MRKTVIVSAARTPFGKFGGVLKEVKAAELGGIVMKEALQQAGVSG
FT                   DDVEGNVMGMVVQAGSGQIPSRQAARLAGMPWSVPSETLNKVCASGLRAVTLCDQMIRA
FT                   QDADILVAGGMESMSNIPYAVPAGRWGARMGDGELRDLMVYDGLTCAFDEVHMAVHGNT
FT                   AAKEYAISRREQDEWALRSHARAAKAADEGKFQDEIVPVNWIGRKGKPNVVDKDEAIRR
FT                   DTSLDQLAKLAPIYASDGSITAGNAPGVNDGAGAFVLMSEEKAAELGKRPLATILGFST
FT                   TGMPAHELAAAPGFAINKLLKKNGLTVQDIDLFEVNEAFASVVLTCEKIVGFDLEKVNV
FT                   NGGAIALGHPIGASGARILMTLVYELKRRGGGLGVAAICSGAAQGDAVLVQVH"
FT   regulatory      206929..206933
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        206939..207673
FT                   /transl_table=11
FT                   /product="YqiM"
FT                   /db_xref="GOA:P45856"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45856"
FT                   /protein_id="BAA12588.1"
FT                   /translation="MKRLKKQLARDAEKGKRTETEVKSVINRISISQTLEEAEHADIVI
FT                   EAIAENMAAKTEMFKTLDRICPPHTILASNTSSLPITEIAAVTNRPQRVIGMHFMNPVP
FT                   VMKLVEVIRGLATSEETALDVMALAEKMGKTAVEVNDFPGFVSNRVLLPMINEAIYCVY
FT                   EGVRTEAIDEVMKLGMNHPMGPLALADFIGLDTCLSIMEVLHSGLGDSKYRPCPLLRKY
FT                   VKAGWLGKKSGRGFYDYEEKTS"
FT   regulatory      207689..207694
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        207701..208837
FT                   /transl_table=11
FT                   /product="YqiN"
FT                   /db_xref="GOA:P45857"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="PDB:5LNX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45857"
FT                   /protein_id="BAA12589.1"
FT                   /translation="MHVTQEQVMMRKMVRDFARKEIAPAAEIMEKTDEFPFQLIKKMGK
FT                   HGLMGIPVPEQYGGAGADVVSYILAIHEISRISAAVGVILSVHTSVGTNPILYFGNEEQ
FT                   KMKYIPNLASGDHLGAFALTEPHSGSDAGSLRTTAIKKNGKYLLNGSKIFITNGGAADI
FT                   YITFALTAPDQGRHGISAFIVEKNTPGFTVGKKERKLGLYGSNTTELIFDNAEVPEANL
FT                   LGKEGDGFHIAMANLNVGRIGIAAQALGIAEAALEHAVDYAKQRVQFGRPIAANQGISF
FT                   KLADMATRAEAARHLVYHAADLHNRGLNCGKEASMAKQFASDAAVKALDAVQIYGGYGY
FT                   MKDYPVERLLRDAKVTQIYEGTNEIQRLIISKYLLGGT"
FT   regulatory      208854..208866
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        208871..209989
FT                   /transl_table=11
FT                   /product="YqiO"
FT                   /db_xref="GOA:P45858"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45858"
FT                   /protein_id="BAA12590.1"
FT                   /translation="MEEKQHYSPGLDGVIAAETHISYLDTQSSQILIRGYDLIELSETK
FT                   SYLELVHLLLEGRLPEESEMETLERKINSASSLPADHLRLLELLPEDTHPMDGLRTGLS
FT                   ALAGYDRQIDDRSPSANKERAYQLLGKMPALTAASYRIINKKEPILPLQTLSYSANFLY
FT                   MMTGKLPSSLEEQIFDRSLVLYSEHEMPNSTFAARVIASTHSDLYGALTGAVASLKGNL
FT                   HGGANEAVMYLLLEAKTTSDFEQLLQTKLKRKEKIMGFGHRVYMKKMDPRALMMKEALQ
FT                   QLCDKAGDHRLYEMCEAGERLMEKEKGLYPNLDYYAAPVYWMLGIPIPLYTPIFFSART
FT                   SGLCAHVIEQHANNRLFRPRVSYMGPRYQTKS"
FT   regulatory      209988..209998
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        210004..211422
FT                   /transl_table=11
FT                   /product="YqiP"
FT                   /db_xref="GOA:P45859"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR012705"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="PDB:5MUX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45859"
FT                   /protein_id="BAA12591.1"
FT                   /translation="MPKTDRVIEEITDYVLEKEITSAEAYTTAGHVLLDTLGCGILALR
FT                   YPECTKLLGPIVPGTTVPNGSKVPGTSYVLDPVRAAFNIGCMIRWLDYNDTWLAAEWGH
FT                   PSDNLGGILAAADYVSRVRLSEGKEPLTVRDVLEMMIKAHEIQGVLALENSLNRVGLDH
FT                   VLFVKVATTAVAAKLLGGGREEIKNALSNAWIDNAALRTYRHSPNTGSRKSWPAGDATS
FT                   RGVHLALMSLKGEMGYPTALSAPGWGFQDVLFNKKEIKLARPLDAYVMENVLFKVSYPA
FT                   EFHAQTAAESAVILHPQVKNRIDEIDRVVIRTHESAIRIIDKKGPLHNPADRDHCLQYI
FT                   TAIGLLFGDITAQHYEAETANDPRIDKLRDKMEVTENKTYTEDYLKPDKRSISNAVQVH
FT                   FKDGTSTEMVECEFPLGHRFRREEAVPKLLEKFSDNLKTHFPDKQHKHIYERCTSYETL
FT                   QTMRVNEFVDMFCM"
FT   regulatory      211422..211429
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        211440..212345
FT                   /transl_table=11
FT                   /product="YqiQ"
FT                   /db_xref="GOA:P54528"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54528"
FT                   /protein_id="BAA12592.1"
FT                   /translation="MSWIVNKQSSQEELAGRFRKLMSAPDILQIPGAHDGMAALLAKEA
FT                   GFSAIYLSGAAYTASRGLPDLGIITSAEIAERAKDLVRAADLPLLVDIDTGFGGVLNAA
FT                   RTAREMLEARVAAVQMEDQQLPKKCGHLNGKQLVPIKEMAQKIKAIKQAAPSLIVVART
FT                   DARAQEGLDAAIKRSEAYIEAGADAIFPEALQAENEFRQFAERIPVPLLANMTEFGKTP
FT                   YYRADEFEDMGFHMVIYPVTSLRAAAKACERMFGLMKEHGSQKEGLHDMQTRKELYDTI
FT                   SYYDYEALDKTIAKTVLPDE"
FT   regulatory      212762..212769
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        212776..214854
FT                   /transl_table=11
FT                   /product="YqiR"
FT                   /db_xref="GOA:P54529"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54529"
FT                   /protein_id="BAA12593.1"
FT                   /translation="MQKVLIVGAGKRGTALLHILIKTAIIDIIAVVDKDPEAPGLKEAE
FT                   QYGIAVSSDWKPYIQQKPDIVIHTTGDQAVFDELLQRKHEDTIVMPGKMAYIVFQLMEE
FT                   KQHLIQMLKEQTYKYDRIFNSTHDGMIFIDINEEIILFNHMAEKMVGKKREEVIGRPIK
FT                   EVIPSTKMPRILKTRVPEYNQKQLLGDHLQIVTTRLPIIDEGGRLLGALCVFKDITDAV
FT                   ELAEEVTNLKQVRTMLEAIIQSSDEAISVVDENGIGLLINKAYTKMTGLSEKEVIGKPA
FT                   NTDISEGESMHLKVLETRRPVRGVRMKVGPNEKEVIVNVAPVIVDGILKGSVGVIHDVS
FT                   EIKMLTAELNRARQIIRTLEAKYTFDDIIGKSEQMLVALEQAKLGAKTPATILLRGESG
FT                   TGKELFAHAIHNESDRKYNKFIRVNCAALSENLLESELFGYEDGAFSGAKRGGKKGLFE
FT                   EANNGSIFLDEIGELTQNMQAKLLRVLQEKEIVRVGGTKAIPVNVRVIAATNVNIEKAM
FT                   ADGTFREDLYYRINRYPISIPPLRQRLEDIEALSVRLIQKINRDYGRNVKGLSQQALRA
FT                   LSAYHWPGNVRELENVLGRAMIFLNPHMEWIEKDHLPVFELEQKENDTDQGTGFDFPDI
FT                   EGEKLSVAVEKFEAHLIQQTLEKHHFNRTKTAKALGVSIRNLYYKMDKYGLANEGMQ"
FT   regulatory      214965..214973
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        214979..215878
FT                   /transl_table=11
FT                   /product="YqiS"
FT                   /db_xref="GOA:P54530"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR014079"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54530"
FT                   /protein_id="BAA12594.1"
FT                   /translation="MKLKDLIGKASIHKNKTIAVAHAEDEEVIRAVKLAAEHLSARFLL
FT                   TGDSKKLNELTSSMQGHQVEIVHANTPEESAKLAVRAVHHKTADVLMKGNVPTSVLLKA
FT                   VLNRQEGLRSASVLSHVAVFDIPDFDRLMFVTDSAMNIAPSLEELRQILQNAVHVAHAV
FT                   GNNMPKAAALAAVETVNPKMEATVNAAALAQMYKRGQIKGCIVDGPLALDNAVSQIAAA
FT                   QKKISGDVAGNPDILLVPTIEAGNILYKSLIYFAKASVAAVITGAKAPIALTSRADSAE
FT                   NKLYSIALAICASEEYTH"
FT   regulatory      215877..215882
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        215890..216984
FT                   /transl_table=11
FT                   /product="YqiT"
FT                   /db_xref="GOA:P54531"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR016211"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54531"
FT                   /protein_id="BAA12595.1"
FT                   /translation="MELFKYMEKYDYEQLVFCQDEQSGLKAIIAIHDTTLGPALGGTRM
FT                   WTYENEEAAIEDALRLARGMTYKNAAAGLNLGGGKTVIIGDPRKDKNEEMFRAFGRYIQ
FT                   GLNGRYITAEDVGTTVEDMDIIHDETDYVTGISPAFGSSGNPSPVTAYGVYRGMKAAAK
FT                   AAFGTDSLEGKTIAVQGVGNVAYNLCRHLHEEGANLIVTDINKQSVQRAVEDFGARAVD
FT                   PDDIYSQDCDIYAPCALGATINDDTIKQLKAKVIAGAANNQLKETRHGDQIHEMGIVYA
FT                   PDYVINAGGVINVADELYGYNAERALKKVEGIYGNIERVLEISQRDGIPAYLAADRLAE
FT                   ERIERMRRSRSQFLQNGHSVLSRR"
FT   regulatory      216996..217001
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        217003..218094
FT                   /transl_table=11
FT                   /product="YqiU"
FT                   /db_xref="GOA:P54532"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR011245"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54532"
FT                   /protein_id="BAA12596.1"
FT                   /translation="MKVLHDEKRILTINPGSTSTEIGVFHNERSIFEKTLRHNIEELQR
FT                   FDRIIDQYEFRKNHILETLHEQGINISKFDAVCARGGLLRPIEGGTYVVNDEMIEDLKS
FT                   GYAGQHASNLGGIIAREIADGLNIPSYIVDPVVVDEMSVLAKVSGMPEIERKSIFHALN
FT                   QKAVARKAAASLGKRYENMKMIITHMGGGITIGVHDRGRVVDVNNGLHGEGPFSPERAG
FT                   TVPAGDLVDLCFSGEYTKEEIMKKLVGTGGLLGYLGTNDAVKVEQMIQGGDEKARFIYD
FT                   AMAYQVAKEIGAASAALKGEVEAIVLTGGLAYGKSFVSAIRSYIDWISDVLVYPGENEL
FT                   QSLAQGALRVLQGEEQSKQYRIE"
FT   regulatory      218101..218108
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        218115..219488
FT                   /transl_table=11
FT                   /product="YqiV"
FT                   /db_xref="GOA:P54533"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54533"
FT                   /protein_id="BAA12597.1"
FT                   /translation="MATEYDVVILGGGTGGYVAAIRAAQLGLKTAVVEKEKLGGTCLHK
FT                   GCIPSKALLRSAEVYRTAREADQFGVETAGVSLNFEKVQQRKQAVVDKLAAGVNHLMKK
FT                   GKIDVYTGYGRILGPSIFSPLPGTISVERGNGEENDMLIPKQVIIATGSRPRMLPGLEV
FT                   DGKSVLTSDEALQMEELPQSIIIVGGGVIGIEWASMLHDFGVKVTVIEYADRILPTEDL
FT                   EISKEMESLLKKKGIQFITGAKVLPDTMTKTSDDISIQAEKDGETVTYSAEKMLVSIGR
FT                   QANIEGIGLENTDIVTENGMISVNESCQTKESHIYAIGDVIGGLQLAHVASHEGIIAVE
FT                   HFAGLNPHPLDPTLVPKCIYSSPEAASVGLTEDEAKANGHNVKIGKFPFMAIGKALVYG
FT                   ESDGFVKIVADRDTDDILGVHMIGPHVTDMISEAGLAKVLDATPWEVGQTISPASNAF"
FT   regulatory      219547..219554
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        219562..220554
FT                   /transl_table=11
FT                   /product="BfmBAA"
FT                   /db_xref="GOA:P37940"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37940"
FT                   /protein_id="BAA12598.1"
FT                   /translation="MSTNRHQALGLTDQEAVDMYRTMLLARKIDERMWLLNRSGKIPFV
FT                   ISCQGQEAAQVGAAFALDREMDYVLPYYRDMGVVLAFGMTAKDLMMSGFAKAADPNSGG
FT                   RQMPGHFGQKKNRIVTGSSPVTTQVPHAVGIALAGRMEKKDIAAFVTFGEGSSNQGDFH
FT                   EGANFAAVHKLPVIFMCENNKYAISVPYDKQVACENISDRAIGYGMPGVTVNGNDPLEV
FT                   YQAVKEARERARRGEGPTLIETISYRLTPHSSDDDDSSYRGREEVEEAKKSDPLLTYQA
FT                   YLKETGLLSDEIEQTMLDEIMAIVNEATDEAENAPYAAPESALDYVYAK"
FT   regulatory      220555..220559
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        220568..221551
FT                   /transl_table=11
FT                   /product="BfmBAB"
FT                   /db_xref="GOA:P37941"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37941"
FT                   /protein_id="BAA12599.1"
FT                   /translation="MSVMSYIDAINLAMKEEMERDSRVFVLGEDVGRKGGVFKATAGLY
FT                   EQFGEERVMDTPLAESAIAGVGIGAAMYGMRPIAEMQFADFIMPAVNQIISEAAKIRYR
FT                   SNNDWSCPIVVRAPYGGGVHGALYHSQSVEAIFANQPGLKIVMPSTPYDAKGLLKAAVR
FT                   DEDPVLFFEHKRAYRLIKGEVPADDYVLPIGKADVKREGDDITVITYGLCVHFALQAAE
FT                   RLEKDGISAHVVDLRTVYPLDKEAIIEAASKTGKVLLVTEDTKEGSIMSEVAAIISEHC
FT                   LFDLDAPIKRLAGPDIPAMPYAPTMEKYFMVNPDKVEAAMRELAEF"
FT   regulatory      221558..221565
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        221574..222848
FT                   /transl_table=11
FT                   /product="BfmBB"
FT                   /db_xref="GOA:P37942"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37942"
FT                   /protein_id="BAA12600.1"
FT                   /translation="MAIEQMTMPQLGESVTEGTISKWLVAPGDKVNKYDPIAEVMTDKV
FT                   NAEVPSSFTGTITELVGEEGQTLQVGEMICKIETEGANPAEQKQEQPAASEAAENPVAK
FT                   SAGAADQPNKKRYSPAVLRLAGEHGIDLDQVTGTGAGGRITRKDIQRLIETGGVQEQNP
FT                   EELKTAAPAPKSASKPEPKEETSYPASAAGDKEIPVTGVRKAIASNMKRSKTEIPHAWT
FT                   MMEVDVTNMVAYRNSIKDSFKKTEGFNLTFFAFFVKAVAQALKEFPQMNSMWAGDKIIQ
FT                   KKDINISIAVATEDSLFVPVIKNADEKTIKGIAKDITGLAKKVRDGKLTADDMQGGTFT
FT                   VNNTGSFGSVQSMGIINYPQAAILQVESIVKRPVVMDNGMIAVRDMVNLCLSLDHRVLD
FT                   GLVCGRFLGRVKQILESIDEKTSVY"
FT   CDS_pept        complement(<223012..223749)
FT                   /transl_table=11
FT                   /product="BmrR"
FT                   /db_xref="GOA:P39075"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="PDB:1BOW"
FT                   /db_xref="PDB:1EXI"
FT                   /db_xref="PDB:1EXJ"
FT                   /db_xref="PDB:1R8E"
FT                   /db_xref="PDB:2BOW"
FT                   /db_xref="PDB:3D6Y"
FT                   /db_xref="PDB:3D6Z"
FT                   /db_xref="PDB:3D70"
FT                   /db_xref="PDB:3D71"
FT                   /db_xref="PDB:3IAO"
FT                   /db_xref="PDB:3Q1M"
FT                   /db_xref="PDB:3Q2Y"
FT                   /db_xref="PDB:3Q3D"
FT                   /db_xref="PDB:3Q5P"
FT                   /db_xref="PDB:3Q5R"
FT                   /db_xref="PDB:3Q5S"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39075"
FT                   /protein_id="BAA23495.1"
FT                   /translation="MKESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYY
FT                   TDSQLIHLDLIKSLKYIGTPLEEMKKAQGLRDGRTVCFLYRAGEANQGEIRLFISPGAN
FT                   HFIGEKADETADGISRRLGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESA
FT                   DGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIA
FT                   YNFSPEHYFLNLQKLIKYIADRQL"
FT   regulatory      complement(223753..223764)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(223822..224991)
FT                   /transl_table=11
FT                   /product="Bmr"
FT                   /db_xref="GOA:P33449"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P33449"
FT                   /protein_id="BAA12601.1"
FT                   /translation="MEKKNITLTILLTNLFIAFLGIGLVIPVTPTIMNELHLSGTAVGY
FT                   MVACFAITQLIVSPIAGRWVDRFGRKIMIVIGLLFFSVSEFLFGIGKTVEMLFISRMLG
FT                   GISAPFIMPGVTAFIADITTIKTRPKALGYMSAAISTGFIIGPGIGGFLAEVHSRLPFF
FT                   FAAAFALLAAILSILTLREPERNPENQEIKGQKTGFKRIFAPMYFIAFLIILISSFGLA
FT                   SFESLFALFVDHKFGFTASDIAIMITGGAIVGAITQVVLFDRFTRWFGEIHLIRYSLIL
FT                   STSLVFLLTTVHSYVAILLVTVTVFVGFDLMRPAVTTYLSKIAGNEQGFAGGMNSMFTS
FT                   IGNVFGPIIGGMLFDIDVNYPFYFATVTLAIGIALTIAWKAPAHLKAST"
FT   regulatory      complement(224999..225005)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(225092..225985)
FT                   /transl_table=11
FT                   /product="BmrU"
FT                   /db_xref="GOA:P39074"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39074"
FT                   /protein_id="BAA12602.1"
FT                   /translation="MSHRKALLIHNGNAANKNIEKALGAVVPVLSHHLDEVIIKQTKKK
FT                   DHAYHFCRSIDDSVDTVFILGGDGTIHQCINAISALERKPAVGILPGGTSNDFSRVLGI
FT                   PQNLAKAAEALMAGKKTSVDVCQMNDRYFLNFWGIGLIAETSNQINETEKALLGKISYF
FT                   TSALRTVSSAASFPMTLKIDGEEIKEEAVMLLVMNGQYIGTNRIPLPDASIEDGLLDVL
FT                   ICRNTNLTALRELMSMEQGSIDRFTGELSYVQASRIEIETDTAKKADMDGEVYTHTPAV
FT                   IQVLPQHIDMLVPANE"
FT   regulatory      complement(225995..226002)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      226132..226138
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        226148..226585
FT                   /transl_table=11
FT                   /product="YqiW"
FT                   /db_xref="InterPro:IPR009474"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54534"
FT                   /protein_id="BAA12603.1"
FT                   /translation="MNMDFNLFMNDIVRQARQEITAAGYTELKTAEEVDEALTKKGTTL
FT                   VMVNSVCGCAGGIARPAAYHSVHYDKRPDQLVTVFAGQDKEATARARDYFEGYPPSSPS
FT                   FAILKDGKIMKMVERHEIEGHEPMAVVAKLQEAFEEYCEEV"
FT   regulatory      226840..226844
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        226854..227621
FT                   /transl_table=11
FT                   /product="YqiX"
FT                   /db_xref="GOA:P54535"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54535"
FT                   /protein_id="BAA12604.1"
FT                   /translation="MKKWLLLLVAACITFALTACGSSNSGSESGKKKLIMGTSADYKPF
FT                   EYKEGDNIVGFDVELAKALAKKAGYEIEVQDMDFNSLITALKSKQVDLVLSGMTPTPER
FT                   KKQVDFSDVYYTANHMIVSKKDSGIQSLKDLKGKTVGVQLGSIQEEKGKELSPEYGFKT
FT                   EDRNRISDLVQEIKSDRFDAAIIEDIVAEGYFKSNDDLQGFVIPDAKAEEAGSAIAFRK
FT                   DSELTDKFNKALKEMEDNGELEKLKKKWFTGEK"
FT   regulatory      227686..227692
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        227702..228361
FT                   /transl_table=11
FT                   /product="YqiY"
FT                   /db_xref="GOA:P54536"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54536"
FT                   /protein_id="BAA12605.1"
FT                   /translation="MNLDFSATIPQIPFILEGLAITLKIVVVSAIIGLILGIVLSLCKI
FT                   STFRPFIWIADFYTSVFRGTPLVLQLMIVYFGLPQLLGFQIDQFWAAVVALSLNSAAYV
FT                   SEIIRAGINAIDKGQKEAAVALGVPYGKMMKDLLLPQAFKNISPAIVNELITLTKESAI
FT                   VTVIGLGDVMRRAYQAGAATYNYLEPLIIAGLIYYVLVLILTFIGKAVERKLKSND"
FT   regulatory      228337..228343
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        228354..229076
FT                   /transl_table=11
FT                   /product="YqiZ"
FT                   /db_xref="GOA:P54537"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54537"
FT                   /protein_id="BAA12606.1"
FT                   /translation="MIKVEKLSKSFGKHEVLKNISTTIAEGEVVAVIGPSGSGKSTFLR
FT                   CLNLLEKPNGGTITIKDTEITKPKTNTLKVRENIGMVFQHFHLFPHKTVLENIMYAPVN
FT                   VKKESKQAAQEKAEDLLRKVGLFEKRNDYPNRLSGGQKQRVAIARALAMNPDIMLFDEP
FT                   TSALDPEMVKEVLQVMKELVETGMTMVIVTHEMGFAKEVADRVLFMDQGMIVEDGNPKE
FT                   FFMSPKSKRAQDFLEKIL"
FT   regulatory      229137..229140
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        229147..230115
FT                   /transl_table=11
FT                   /product="YqjA"
FT                   /db_xref="GOA:P54538"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="InterPro:IPR021062"
FT                   /db_xref="InterPro:IPR038323"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54538"
FT                   /protein_id="BAA12607.1"
FT                   /translation="MFKIGYRTIKTALGTALAIYISQLLHLQNFASAGIITILCIQITQ
FT                   KRSLQASWARFWACCLAIAFSYLFFELIGYHPFVIGALLLIFIPITVLLKINEGIVTSS
FT                   VIILHLYMSGGITPTFIWNEVQLITVGIGVALLMNLYMPSLDRKLIAYRKKIEDNFAVI
FT                   FAEIERYLLTGEQDWSGKEIPETHQLITEAKNLAYRDVQNHILRYENLHYHYFKMREKQ
FT                   FEIIERLLPKVTSISITVDQGKMIAEFIHDLREAIHPGNTAYKFLKRLADMRKEFEEMP
FT                   LPATREEFEARAALFHLLGEMEQYLVIKSYFKGIKAQKSLG"
FT   regulatory      230154..230161
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        230167..230697
FT                   /transl_table=11
FT                   /product="YqjB"
FT                   /db_xref="GOA:P54539"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54539"
FT                   /protein_id="BAA12608.1"
FT                   /translation="MRFFLCSIFMMISPIWPLGENPLPGDPYVIVNKRTNELAVILDNK
FT                   VEGVYSVATGKTDDLTPEGEFSVTVKAENPYYRKKNIEGGSPDNPLGARWIGFDAKGTD
FT                   GRIYGIHGTNREESVGKFVSNGCIRMHNDEVVHLFQTIPVGTRVLITDDNRSFEEIAIE
FT                   HKALIKKQDIPIE"
FT   regulatory      230884..230891
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        230899..231321
FT                   /transl_table=11
FT                   /product="YqjC"
FT                   /db_xref="GOA:P54540"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54540"
FT                   /protein_id="BAA12609.1"
FT                   /translation="MNRLDHIGIAVFPIKDARSFYENVLGLAFLHQETVEEQKVNVAFF
FT                   QAGSVKLGLIEPLTADSPVHLFLEKKGQGLHHIAFLCNCLSEQLQALSDQHVQLIDRFP
FT                   RQGANGKKIAFISPRETNGVLVELCEPKGDQHNEHE"
FT   regulatory      231307..231312
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        231318..232838
FT                   /transl_table=11
FT                   /product="YqjD"
FT                   /db_xref="GOA:P54541"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54541"
FT                   /protein_id="BAA12610.1"
FT                   /translation="MSTWIIFTRNRKQAEEGGGREKLAQQRQKGKLTARERIIFLLDQD
FT                   SFIELHPFMESQVLTREQRMLGDGVVTGYGTIDGRSVYVFAQDFTVYGGALGETHARKI
FT                   CALMDLAAKNKAPIIGLNDSGGARIQEGVLSLDGYGHIFYRNVLYSGVIPQISVILGPC
FT                   AGGAVYSPALTDFIFMAEQTGRMFITGPKVIEKVTGEQVDAESLGGAGIHNAVSGNAHF
FT                   SGHTEKEVLTGVRKLLSYLPLNGRTTEPKPEKEASRPLLNRLVPADTTKPYDVRKVIRE
FT                   LADPQSFFEIQPFFAKNIVIGFARLGEKAIGIVASQPKHLAGSLTIDAADKAARFIRFC
FT                   DAFDIPLLTVEDVPGFLPGIQQEHNGIIRHGAKLLFAYAEATVPKVTLIIRKAYGGAYV
FT                   AMNSKAIGADLVFAWPNAEIAVMGPEGAASILYEKEIKASADPQKTKREKTAEYKKQNA
FT                   GPYKAAACGMVDDIILPEESRGRLIQAFHMLTHKTEERPKKKHGNIPL"
FT   regulatory      232842..232846
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        232856..233971
FT                   /transl_table=11
FT                   /product="YqjE"
FT                   /db_xref="GOA:P54542"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR010162"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54542"
FT                   /protein_id="BAA12611.1"
FT                   /translation="MVNEKRLLEEFLELVQIDSETKHEAEICKVLKRKFSDLGVDVKED
FT                   DTMDITGHGAGNLICTLKGTKQTDTIYFTSHMDTVVPGNGVKPVVENGYVKTDGTTILG
FT                   ADDKAGLAAMFEAIKVLKEENIEHGTIEFIITVGEESGLIGAKALDRPMITASYGYALD
FT                   SDGKVGNIIVAAPTQAKVRAAIFGKTAHAGVEPEKGISAITIASKAISKMPLGRIDEET
FT                   TANIGRFEGGTQTNIVCDEVHILAEARSLVPEKMEAQVQKMKAAFEEAAADMGGRAEVE
FT                   IEVMYPGFKYQDGDQVVEIAKKAAAKIGRPSELQTSGGGSDANVIAGHGIPTVNLAVGY
FT                   EQIHTKNEKMPIEELVKTAEMVVAIIEEAAK"
FT   CDS_pept        complement(234110..234739)
FT                   /transl_table=11
FT                   /product="YqjF"
FT                   /db_xref="InterPro:IPR018644"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54543"
FT                   /protein_id="BAA12612.1"
FT                   /translation="MTERFQQKNISVPDGIWIMKQTWNDVLFAHWPVDVSILRALVPSV
FT                   LELDTYNGQAWISMLPFMLTNLRARYLPVIPGARAFPELNLRTYVTYKGKPGIYFFSLD
FT                   ADHRLAVLGARTFFHLPYFYADMKSEKNGDAIDYVSKRKNDKEAAFHAAYRPISAPFTA
FT                   EKDSLDYWLTDDTGSTPLIAISSITKTSIIIRGCCKTPKQKFQSIR"
FT   regulatory      complement(234748..234754)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(234919..235746)
FT                   /transl_table=11
FT                   /product="YqjG"
FT                   /db_xref="GOA:P54544"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54544"
FT                   /protein_id="BAA12613.1"
FT                   /translation="MLKTYQKLLAMGIFLIVLCSGNAAFAATNQVGGLSNVGFFHDYLI
FT                   EPFSALLKGVAGLFHGEYGLSIILVTIIVRIVVLPLFVNQFKKQRIFQEKMAVIKPQVD
FT                   SIQVKLKKTKDPEKQKELQMEMMKLYQEHNINPLAMGCLPMLIQSPIMIGLYYAIRSTP
FT                   EIASHSFLWFSLGQSDILMSLSAGIMYFVQAYIAQKLSAKYSAVPQNPAAQQSAKLMVF
FT                   IFPVMMTIFSLNVPAALPLYWFTSGLFLTVQNIVLQMTHHKSKKTAALTESVK"
FT   regulatory      complement(235756..235763)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      236123..236129
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        236138..237382
FT                   /transl_table=11
FT                   /product="YqjH"
FT                   /db_xref="GOA:P54545"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54545"
FT                   /protein_id="BAA12614.1"
FT                   /translation="MPGKSRIIFHIDMNSFYASVEMAYDPALRGKPVAVAGNVKERKGI
FT                   VVTCSYEARARGVKTTMPVWQAKRHCPELIVLPPNFDRYRNSSRAMFTILREYTDLVEP
FT                   VSIDEGYMDMTDTPYSSRALETAKEIQSRLQKELLLPSSIGIAPNKFLAKMASDMKKPL
FT                   GITILRKRQVPDILWPLPVGEMHGVGKKTAEKLKGLGIHTIGELAAADEHSLKRLLGIN
FT                   GPRLKNKANGIHHAPVDPERIYEFKSVGNSSTLSHDSSDEEELLGVFRKLAASVSDRLQ
FT                   RKEVMASKLFIMIRYADWRTITRSTTLRNPIDQKNDILKEAEHLFFKHWKKNPVRLLGI
FT                   TGTDLVEKEQAYKQLDLFSFNEDAKDEPIQQMMEKLNKKYGTKLIRKGATLKKEESKTK
FT                   GTSFNKDFFQDEKKS"
FT   regulatory      237665..237672
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        237682..238902
FT                   /transl_table=11
FT                   /product="YqjI"
FT                   /db_xref="GOA:P80859"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80859"
FT                   /protein_id="BAA12615.1"
FT                   /translation="METPRKILLMVKAGTATDATIQSLLPHLEKDDILIDGGNTYYKDT
FT                   QRRNKELAESGIHFIGTGVSGGEEGALKGPSIMPGGQKEAHELVKPILEAISAKVDGEP
FT                   CTTYIGPDGAGHYVKMVHNGIEYGDMQLISESYFILKQVLGLSADELHEVFAEWNKGEL
FT                   DSYLIEITADIFTKKDEETGKPLVDVILDKAGQKGTGKWTSQSALDLGVPLPIITESVF
FT                   ARFISAMKEERVKASGLLSGPEVKPVTENKEELIEAVRKALFMSKICSYAQGFAQMKAA
FT                   SEEYNWDLKYGEIAMIFRGGCIIRAAFLQKIKEAYDREPELDNLLLDSYFKNIVESYQG
FT                   ALRQVISLAVAQGVPVPSFSSALAYYDSYRTAVLPANLIQAQRDYFGAHTYERTDKEGI
FT                   FHTEWMK"
FT   CDS_pept        complement(239025..240494)
FT                   /transl_table=11
FT                   /product="YqjJ"
FT                   /db_xref="GOA:P54547"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54547"
FT                   /protein_id="BAA12616.1"
FT                   /translation="MKTNQQPKAVIVIFGATGDLAKRKLYPSIHRLYQNGQIGEEFAVV
FT                   GVGRRPWSNEDLRQTVKTSISSSADKHIDDFTSHFYYHPFDVTNPGSYQELNVLLNQLE
FT                   DTYQIPNNRMFYLAMAPEFFGTIAKTLKSEGVTATTGWSRLVIEKPFGHDLPSAQALNK
FT                   EIREAFTEDQIYRIDHYLGKQMVQNIEVIRFANAIFEPLWTNRYISNIQITSSESLGVE
FT                   DRARYYEKSGALRDMVQNHIMQMVALLAMEPPIKLNTEEIRSEKVKVLRALRPIAKDEV
FT                   DEYFVRGQYHAGEIDGVPVPAYTDEDNVAPDSNTETFVAGKLLIDNFRWAGVPFYIRTG
FT                   KRMREKSTKIVVQFKDIPMNLYYGNENNMNPNLLVIHIQPDEGITLYLNAKKLGGAAHA
FT                   QPIKLDYCSNCNDELNTPEAYEKLIHDCLLGDATNFAHWDEVALSWSFVDSISETWAAN
FT                   KTLSPNYESGSMGPKESDDLLVKDGLHWWNI"
FT   regulatory      complement(240502..240511)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      240707..240712
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        240721..241644
FT                   /transl_table=11
FT                   /product="YqjK"
FT                   /db_xref="GOA:P54548"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="PDB:1Y44"
FT                   /db_xref="PDB:2FK6"
FT                   /db_xref="PDB:4GCW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54548"
FT                   /protein_id="BAA12617.1"
FT                   /translation="MELLFLGTGAGIPAKARNVTSVALKLLEERRSVWLFDCGEATQHQ
FT                   ILHTTIKPRKIEKIFITHMHGDHVYGLPGLLGSRSFQGGEDELTVYGPKGIKAFIETSL
FT                   AVTKTHLTYPLAIQEIEEGIVFEDDQFIVTAVSVIHGVEAFGYRVQEKDVPGSLKADVL
FT                   KEMNIPPGPVYQKIKKGETVTLEDGRIINGNDFLEPPKKGRSVVFSGDTRVSDKLKELA
FT                   RDCDVLVHEATFAKEDRKLAYDYYHSTTEQAAVTAKEARAKQLILTHISARYQGDASLE
FT                   LQKEAVDVFPNSVAAYDFLEVNVPRG"
FT   CDS_pept        complement(241920..242681)
FT                   /transl_table=11
FT                   /product="YqjL"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54549"
FT                   /protein_id="BAA12618.1"
FT                   /translation="MKSAWMEKTYTIDGCAFHTQHRKGSSGVTIVFEAGYGTSSETWKP
FT                   LMADIDDEFGIFTYDRAGIGKSGQSRAKRTADQQVKELESLLKAADVKPPYLAVSHSYG
FT                   AVITGLWACKNKHDIIGMVLLDPALGDCASFTFIPEEMHKSHTRKMMLEGTHAEFSKSL
FT                   QELKKRQVHLGNMPLLVLSSGERTEKFAAEQEWQNLHSSILSLSNQSGWIQAKNSSHNI
FT                   HHDEPHIVHLAIYDVWCAACQQAAPLYQAVN"
FT   regulatory      complement(242687..242695)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(242791..243807)
FT                   /transl_table=11
FT                   /product="YqjM"
FT                   /db_xref="GOA:P54550"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023663"
FT                   /db_xref="PDB:1Z41"
FT                   /db_xref="PDB:1Z42"
FT                   /db_xref="PDB:1Z44"
FT                   /db_xref="PDB:1Z48"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54550"
FT                   /protein_id="BAA12619.1"
FT                   /translation="MARKLFTPITIKDMTLKNRIVMSPMCMYSSHEKDGKLTPFHMAHY
FT                   ISRAIGQVGLIIVEASAVNPQGRITDQDLGIWSDEHIEGFAKLTEQVKEQGSKIGIQLA
FT                   HAGRKAELEGDIFAPSAIAFDEQSATPVEMSAEKVKETVQEFKQAAARAKEAGFDVIEI
FT                   HAAHGYLIHEFLSPLSNHRTDEYGGSPENRYRFLREIIDEVKQVWDGPLFVRVSASDYT
FT                   DKGLDIADHIGFAKWMKEQGVDLIDCSSGALVHADINVFPGYQVSFAEKIREQADMATG
FT                   AVGMITDGSMAEEILQNGRADLIFIGRELLRDPFFARTAAKQLNTEIPAPVQYERGW"
FT   regulatory      complement(243816..243820)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      243963..243968
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        243979..245622
FT                   /transl_table=11
FT                   /product="YqjN"
FT                   /db_xref="GOA:P54551"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR012166"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54551"
FT                   /protein_id="BAA12620.1"
FT                   /translation="MNWQTKDELLALLTSLVQYESITGSKGEVALAEYLYFILKDKPYF
FT                   QKHPDDVTPHPMDDGRSFLTALVKKKNVKKTVLLLSHFDVVDIEDYGEFKHMACKPAEL
FT                   LSSFLEKKELLPERVRRDAESGDWLFGRGTMDMKAGLCIQLSMLERAMNGHFEGNLLLI
FT                   TVPDEEVNSRGMIEAVPALKEMEKKHDITLTACLNAEPMFEKFPGDQQQYFYTGSIGKV
FT                   LAGFFCKGIETHVGEPFSGLNANLMVSEINRLLELNADYCEKVDGEVTPPPVNLMQKDL
FT                   KEAYSVQTPHTAVTLFNVLSMKRSASELHQMLLKTAEQAAEEIMSNVRKKTQDFQQFEP
FT                   FQPIERDVTVLTFDELVSRAKKRAGISETERALNYAFANRGELGDRDFSTKIVSELASL
FT                   CKEDAPLIVLFYSPPLYPAVSSKDDQLIRNTADQIKHYAAERYGIALREVQYFPGLSDL
FT                   SYLQLEKQEVDAYTSNMPLFNRGYSLPSGKNQALYVPVLNVGPAGKDPHKWTERLYMPY
FT                   SFEVLPDLLSFTISALLKQSESAGQLLREK"
FT   CDS_pept        complement(245663..246499)
FT                   /transl_table=11
FT                   /product="YqjO"
FT                   /db_xref="GOA:P54552"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54552"
FT                   /protein_id="BAA12621.1"
FT                   /translation="MKKIGFVGAGSMAEAMINGILQSGITKPEHIYITNRSNDERLIEL
FT                   KETYSVRPCRDKNEFFTHTDIIILAFKPKDAAESIDSIRPYIKDQLVISVLAGLTIETI
FT                   QHYFGRKLAVIRVMPNTSAAIRKSATGFSVSTEASKNDIIAAKALLETIGDATLVEERH
FT                   LDAVTAIAGSGPAYVYRYIEAMEKAAQKVGLDKETAKALILQTMAGATDMLLQSGKQPE
FT                   KLRKEITSPGGTTEAGLRALQDSRFEEAIIHCIEETAKRSAEIKEQFAGAALERHS"
FT   regulatory      complement(246506..246514)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      246891..246896
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        246904..247863
FT                   /transl_table=11
FT                   /product="YqjP"
FT                   /db_xref="GOA:P54553"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54553"
FT                   /protein_id="BAA12622.1"
FT                   /translation="MTTEDVIAIRVPTPFAVGDVIVYLVKGDALTLIDAGPNTKEAARA
FT                   LQEQLAAVNVKLSDIEQVVLTHHHADHAGLLDVFSDEIEVIGHTFNEPYISQNQAFMDW
FT                   QKRFFQKLLPELGVPFDTGKAEKLIRSAYAFSCTRSLTKSIREGMGIDGLEGWSVLEMP
FT                   GHAESHIVLFHEKSGRMLGGDLLLANSSSNPILEAPKAGDVRSKPLVDYQRSLRRLSQL
FT                   DPTIVFPGHGEPITSVQALIEKRFDKQRNRTEDVRRMLDEKPMTAFQVCQQLFPAVYEK
FT                   ELFLTMSETAGHLDVLEAEEAITSYWEGNTVYFKTMKR"
FT   regulatory      247854..247863
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        247869..248648
FT                   /transl_table=11
FT                   /product="YqjQ"
FT                   /db_xref="GOA:P54554"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54554"
FT                   /protein_id="BAA12623.1"
FT                   /translation="MKHIAGKRIWITGASGGLGERIAYLCAAEGAHVLLSARREDRLIE
FT                   IKRKITEEWSGQCEIFPLDVGRLEDIARVRDQIGSIDVLINNAGFGIFETVLDSTLDDM
FT                   KAMFDVNVFGLIACTKAVLPQMLEQKKGHIINIASQAGKIATPKSSLYSATKHAVLGYS
FT                   NALRMELSGTGIYVTTVNPGPIQTDFFSIADKGGDYAKNVGRWMLDPDDVAAQITAAIF
FT                   TKKREINLPRLMNAGTKLYQLFPALVEKLAGRALMKK"
FT   regulatory      248706..248713
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        248724..250070
FT                   /transl_table=11
FT                   /product="YqjR"
FT                   /db_xref="GOA:P54555"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR011780"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54555"
FT                   /protein_id="BAA12624.1"
FT                   /translation="MSVHSEVLHALLKDPFIQKLIDAEPVFWANSGKKEGPLPRADEWA
FT                   TEIAEAEKRMQRFAPYIAEVFPETKGAKGIIESPLFEVQHMKGKLEAAYQQPFPGRWLL
FT                   KCDHELPISGSIKARGGIYEVLKYAENLALQEGMLQETDDYRILQEERFTGFFSRYSIA
FT                   VGSTGNLGLSIGIIGAALGFRVTVHMSADAKQWKKDLLRQKGVTVMEYETDYSEAVNEG
FT                   RRQAEQDPFCYFIDDEHSRQLFLGYAVAASRLKTQLDCMNIKPSLETPLFVYLPCGVGG
FT                   GPGGVAFGLKLLYGDDVHVFFAEPTHSPCMLLGLYSGLHEKISVQDIGLDNQTAADGLA
FT                   VGRPSGFVGKLIEPLLSGCYTVEDNTLYTLLHMLAVSEDKYLEPSALAGMFGPVQLFST
FT                   EEGRRYAQKYKMEHAVHVVWGTGGSMVPKDEMAAYNRIGADLLKKRNGK"
FT   regulatory      250212..250216
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        250220..251101
FT                   /transl_table=11
FT                   /product="YqjS"
FT                   /db_xref="GOA:P54556"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54556"
FT                   /protein_id="BAA12625.1"
FT                   /translation="MSIAVSEEEAKAVEGLNDYLSVEEVETIYIPLVRLLHLHVKSAAE
FT                   RNKHVNVFLKHPHSAKIPFIIGIAGSVAVGKSTTARILQKLLSRLPDRPKVSLITTDGF
FT                   LFPTAELKKKNMMSRKGFPESYDVKALLEFLNDLKSGKDSVKAPVYSHLTYDREEGVFE
FT                   VVEQADIVIIEGINVLQSPTLEDDRENPRIFVSDFFDFSIYVDAEESRIFTWYLERFRL
FT                   LRETAFQNPDSYFHKFKDLSDQEADEMAASIWESVNRPNLYENILPTKFRSDLILRKGD
FT                   GHKVEEVLVRRV"
FT   regulatory      251089..251097
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        251105..251491
FT                   /transl_table=11
FT                   /product="YqjT"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54557"
FT                   /protein_id="BAA12626.1"
FT                   /translation="MHHIELYVSDLEASRRFWGWFLKELGYKEYQKWSSGISWKKDRFY
FT                   LVIVQAKEPFLEPEYHRCRVGLNHLAFHAESKLQVDQMTEKLTAKGYRVLYRDRHPFAG
FT                   GDGHYAVFCEDPDRIKVELVAPSC"
FT   CDS_pept        complement(251488..251850)
FT                   /transl_table=11
FT                   /product="YqjU"
FT                   /db_xref="GOA:P54558"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54558"
FT                   /protein_id="BAA12627.1"
FT                   /translation="MYRPVWRWPADLYFFCPERHYPARPAIFSVRLSANENGDHKTPFP
FT                   SGKAALNKKRKRMNLSRKHEVKNMNIGDVMFQLFVFIIFAAVVFAAVTGFKYAKNRKAQ
FT                   LDRIEKKLNSLSEDHD"
FT   CDS_pept        complement(251697..252929)
FT                   /transl_table=11
FT                   /product="YqjV"
FT                   /db_xref="GOA:P54559"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54559"
FT                   /protein_id="BAA12628.1"
FT                   /translation="MKKWKDIHPISWTIIIGTIFGRMATSMSIPFLAIYLTAVQGASAS
FT                   YAGLVIAASSSVGILASFYGGYISDKFGRKNMMLVSIFGWMLVFAGFAAASNLWVFFVV
FT                   NALNGLCKSLFEPASKALLSDMTEEKTRLLVFNLRYAAINIGVVFGPVLGLYFGSSQST
FT                   TPFLVPAVIYGLYGIVLALQFKKHPSLSAPAQSRNMSVREAFMVTQKDYLFTIALVGIT
FT                   LCTFGYSQFSSTFPQYMAQNPLIGNGTKLYGLMLTLNAIVVLATQFPIVHFAKRFSPLC
FT                   SLMLGNVMVSISMAIFTVSHGVPSIVMIVITFTIGEVLLFSMMDLYVDQIAKPGLKGTY
FT                   FGAIGFPQLGNVIGPWVGGICIDLFGAGRPIYIFSVLSGITLLGLPFLAFAYRQMKMET
FT                   TKHRSRLEKPL"
FT   regulatory      complement(251854..251858)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(252940..252946)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      253840..253846
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        253850..255088
FT                   /transl_table=11
FT                   /product="YqjW"
FT                   /db_xref="GOA:P54560"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54560"
FT                   /protein_id="BAA12629.1"
FT                   /translation="MMKEKVIFLVDMQSFYASVEKAENPHLKNRPVIVSGDPEKRGGVV
FT                   LAACPLAKQKGVVNASRLWEAQEKCPEAVVLRPRMQRYIDVSLQITAILEEYTDLVEPY
FT                   SIDEQFMDITGSQKLFGTPMEIAKSIQGRIMREIGVYARVGIGPNKALAKIACDNFAKK
FT                   NKNGIFTLTKENMKTEMWPLPVGSMFGVGSRMKHHLNRMGISTIGGLAAFPLDLLKKKW
FT                   GINGHVLWMTANGIDYSPVSTSSLDGQKAIGHGMTLPRDYEHFDKEIKVVLLELSEEVC
FT                   RRSRNAGVMGQTVSVSCRGADFDWPTGFNRQVKLAEPTNSTQDVYEAVRRLFLTFWDGK
FT                   PVRRLGVNLSQLSSDDIWQLNLFQDYAKKMSLGYVMDGIKNRFGDTAIIRAASLTAAGQ
FT                   AFERAAKIGGHYK"
FT   regulatory      255072..255076
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        255085..255423
FT                   /transl_table=11
FT                   /product="YqjX"
FT                   /db_xref="InterPro:IPR014962"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54561"
FT                   /protein_id="BAA12630.1"
FT                   /translation="MNDHLKRGNLLWEGSRMFLPEHKQSLLERKRLKQKLQKPILDPDK
FT                   LEEMNQTLCAAMEFAQDITVSCFQDGEIVCCTGKICRYEEFEKAVWIKGDEDQLYKLKL
FT                   DQVLDIVL"
FT   regulatory      255590..255594
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        255609..256079
FT                   /transl_table=11
FT                   /product="YqjY"
FT                   /db_xref="GOA:P54562"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="PDB:1MK4"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54562"
FT                   /protein_id="BAA12631.1"
FT                   /translation="MDIRTITSSDYEMVTSVLNEWWGGRQLKEKLPRLFFEHFQDTSFI
FT                   TSEHNSMTGFLIGFQSQSDPETAYIHFSGVHPDFRKMQIGKQLYDVFIETVKQRGCTRV
FT                   KCVTSPVNKVSIAYHTKLGFDIEKGTKTVNGISVFANYDGPGQDRVLFVKNI"
FT   regulatory      256079..256084
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        256089..256433
FT                   /transl_table=11
FT                   /product="YqjZ"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="PDB:2GO8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54563"
FT                   /protein_id="BAA12632.1"
FT                   /translation="MMDFLSKTPEPPYYAVIFSSVKSENDTGYGETAERMVSLAADQPG
FT                   FLGVESVREADGRGITVSYWDSMDAINHWRHHTEHQAAKEKGRSVWYESYAVRVAKVDR
FT                   QRLFQENTND"
FT   regulatory      256414..256418
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        256426..257457
FT                   /transl_table=11
FT                   /product="YqkA"
FT                   /db_xref="GOA:P54564"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54564"
FT                   /protein_id="BAA12633.1"
FT                   /translation="MIEFLQHKEATIAREILAVQIPAYIKETEIIGFDGIPALQEKVKD
FT                   IQASHERFAGYRKNGKLIGVISYEKNMHYLTICRLVVHPDGFRKGIGRALLQFVIDHNE
FT                   DAEKIEVVTAENNTPAVSLYTQAGFQKAETVKAAQGLLLSVFHLYPKRKVEIILYNEKW
FT                   AECFDEEKERLKLVFGPEIIAIHHIGSTSIPNMAAKPIIDMLIEVRSIEAVSQFDEQMK
FT                   ANGYTPKGENGIAGRRYFQKGGNKRTHHVHMYEQGNPAIERHLLFRDYLRAHPNIAKEY
FT                   AVLKKQLAAQHPDSINQYIQGKDEWIKTAEENAKRWKKGRNNANGSIVCYNSENDENGG
FT                   FTL"
FT   regulatory      257436..257445
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        257454..257777
FT                   /transl_table=11
FT                   /product="YqkB"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54565"
FT                   /protein_id="BAA12634.1"
FT                   /translation="MNIHVTDAAKQALQQAFDANPGKKAQLRYDAEGCGCAVSGVPTIW
FT                   LAEELTGQCEQLETNGIPLYIQSSQKVFFDDQMTIDYNEKAKTLALKSPAEMLSPRMSI
FT                   LVK"
FT   regulatory      257776..257780
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        257790..258029
FT                   /transl_table=11
FT                   /product="YqkC"
FT                   /db_xref="InterPro:IPR020157"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54566"
FT                   /protein_id="BAA12635.1"
FT                   /translation="MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVW
FT                   LLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL"
FT   CDS_pept        complement(258069..258986)
FT                   /transl_table=11
FT                   /product="YqkD"
FT                   /db_xref="GOA:P54567"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54567"
FT                   /protein_id="BAA12636.1"
FT                   /translation="MKKILLAIGALVTAVIAIGIVFSHMILFIKKKTDEDIIKRETDNG
FT                   HDVFESFEQMEKTAFVIPSAYGYDIKGYHVAPHDTPNTIIICHGVTMNVLNSLKYMHLF
FT                   LDLGWNVLIYDHRRHGQSGGKTTSYGFYEKDDLNKVVSLLKNKTNHRGLIGIHGESMGA
FT                   VTALLYAGAHCSDGADFYIADCPFACFDEQLAYRLRAEYRLPSWPLLPIADFFLKLRGG
FT                   YRAREVSPLAVIDKIEKPVLFIHSKDDDYIPVSSTERLYEKKRGPKALYIAENGEHAMS
FT                   YTKNRHTYRKTVQEFLDNMNDSTE"
FT   regulatory      complement(258993..259003)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      259135..259139
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        259148..259372
FT                   /transl_table=11
FT                   /product="YqkE"
FT                   /db_xref="InterPro:IPR024980"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54568"
FT                   /protein_id="BAA12637.1"
FT                   /translation="MKKQKSIDKHQLKDGLQSDIKAKLMEMKSQLKEEDEKRQKREKAE
FT                   QIRKKKEIEKNKSFEELLNESQMDWHQYK"
FT   CDS_pept        complement(259404..260324)
FT                   /transl_table=11
FT                   /product="YqkF"
FT                   /db_xref="GOA:P54569"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54569"
FT                   /protein_id="BAA12638.1"
FT                   /translation="MRKRKLGTSDLDISEVGLGCMSLGTEKNKALSILDEAIELGINYL
FT                   DTADLYDRGRNEEIVGDAIQNRRHDIILATKAGNRWDDGSEGWYWDPSKAYIKEAVKKS
FT                   LTRLKTDYIDLYQLHGGTIEDNIDETIEAFEELKQEGVIRYYGISSIRPNVIKEYVKKS
FT                   NIVSIMMQFSLFDRRPEEWLPLLEEHQISVVARGPVAKGLLTEKPLDQASESMKQNGYL
FT                   SYSFEELTNARKAMEEVAPDLSMTEKSLQYLLAQPAVASVITGASKIEQLRENIQAANA
FT                   RRLTEEEIKALQSHTKQDIYKAHRS"
FT   regulatory      complement(260330..260338)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      260572..260579
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        260584..261141
FT                   /transl_table=11
FT                   /product="YqkG"
FT                   /db_xref="GOA:P54570"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54570"
FT                   /protein_id="BAA12639.1"
FT                   /translation="MKSLEEKTIAKEQIFSGKVIDLYVEDVELPNGKASKREIVKHPGA
FT                   VAVLAVTDEGKIIMVKQFRKPLERTIVEIPAGKLEKGEEPEYTALRELEEETGYTAKKL
FT                   TKITAFYTSPGFADEIVHVFLAEELSVLEEKRELDEDEFVEVMEVTLEDALKLVESREV
FT                   YDAKTAYAIQYLQLKEALQAQK"
FT   regulatory      261410..261413
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        261418..262302
FT                   /transl_table=11
FT                   /product="YqkH"
FT                   /db_xref="GOA:P38423"
FT                   /db_xref="InterPro:IPR005287"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38423"
FT                   /protein_id="BAA12640.1"
FT                   /translation="MMKPAADPIHVLVFMPTLADMKQFSNWLSARLKNIHLSSQRIYET
FT                   GLNLQKKVQDMGGLFIPAHIFTPHKSLYGKGVKSSLTEVFDPSMIDAVELGLSCDTDMA
FT                   SHVSQLNPYPFLTNSDAHSLGKIGREYNELYVQSADFTEFALALKGQDDRKIIANYGLD
FT                   PLLGKYYQTACEACGEPAVSGETACANCGKARFTKGVSDRLRELSDQLEVRVPRPRYVH
FT                   QIPLQFVPGVGPKTLDKLKKAFGTEMAVLHEAAEEDLARVVPPKTAALIVKARSGKLEL
FT                   KAGGGGTYGKIKP"
FT   CDS_pept        complement(262311..262661)
FT                   /transl_table=11
FT                   /product="AnsR"
FT                   /db_xref="GOA:Q07683"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07683"
FT                   /protein_id="BAA12641.1"
FT                   /translation="MNLDRLTELRKKKNWSLQYTADLLGIAKSTYAGYESGYRRPSLEA
FT                   LAMLADLFDTTCDELLGREKQKQTAPQAIELATWSSLDFTISVDGQPLSEDEIIQLITF
FT                   IRTKRKVQEELS"
FT   regulatory      complement(262671..262677)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      262828..262836
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        262843..263832
FT                   /transl_table=11
FT                   /product="AnsA"
FT                   /db_xref="GOA:P26900"
FT                   /db_xref="InterPro:IPR006033"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="InterPro:IPR041725"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26900"
FT                   /protein_id="BAA12642.1"
FT                   /translation="MKKLLMLTTGGTIASVEGENGLAPGVKADELLSYVSKLDNDYTME
FT                   TQSLMNIDSTNMQPEYWVEIAEAVKENYDAYDGFVITHGTDTMAYTSAALSYMLQHAKK
FT                   PIVITGSQIPITFQKTDAKKNITDAIRFACEGVGGVYVVFDGRVIQGTRAIKLRTKSYD
FT                   AFESINYPYIAFINEDGIEYNKQVTEPENDTFTVDTSLCTDVCLLKLHPGLKPEMFDAL
FT                   KSMYKGIVIESYGSGGVPFEGRDILSKVNELIESGIVVVITTQCLEEGEDMSIYEVGRR
FT                   VNQDLIIRSRNMNTEAIVPKLMWALGQSSDLPVVKRIMETPIADDVVL"
FT   regulatory      263858..263868
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        263877..265304
FT                   /transl_table=11
FT                   /product="AnsB"
FT                   /db_xref="GOA:P26899"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26899"
FT                   /protein_id="BAA12643.1"
FT                   /translation="MLNGQKEYRVEKDFLGEKQIEADVYYGIQTLRASENFPITGYKIH
FT                   EEMINALAIVKKAAALANMDVKRLYEGIGQAIVQAADEILEGKWHDQFIVDPIQGGAGT
FT                   SMNMNANEVIGNRALEIMGHKKGDYIHLSPNTHVNMSQSQNDVFPTAIHISTLKLLEKL
FT                   LKTMEDMHSVFKQKAQEFHSVIKMGRTHLQDAVPIRLGQEFEAYSRVLERDIKRIKQSR
FT                   QHLYEVNMGATAVGTGLNADPEYIKQVVKHLADISGLPLVGADHLVDATQNTDAYTEVS
FT                   ASLKVCMMNMSKIANDLRLMASGPRAGLAEISLPARQPGSSIMPGKVNPVMAELINQIA
FT                   FQVIGNDNTICLASEAGQLELNVMEPVLVFNLLQSISIMNNGFRSFTDNCLKGIEANEK
FT                   RMKQYVEKSAGVITAVNPHLGYEAAARIAREAIMTGQSVRDLCLQHDVLTEEELDIILN
FT                   PYEMTKPGIAGKELLEK"
FT   regulatory      265431..265437
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        265445..266851
FT                   /transl_table=11
FT                   /product="YqkI"
FT                   /db_xref="GOA:P54571"
FT                   /db_xref="InterPro:IPR004770"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54571"
FT                   /protein_id="BAA12644.1"
FT                   /translation="MKDVRLPTLFEIIIVLGVFLALVLSFTVFLDLPIQLALFVSWFIA
FT                   MLLGIRLGYSYKDLQNAIVHGISNGLEAVLILVSVGALIGTWIAGGVVPTLIYYGLEFI
FT                   HPSIFLLATLIICSIMSVATGTSWGTVGTAGIAMIAIGEGLGIPLPLVAGAILSGAYFG
FT                   DKLSPLSDSTVLASSLSKVDVLAHVRAMLYLSIPAYVITAILFTVVGFMYGGKNIDLDK
FT                   VEFLKSSLQNTFDIHIWMLIPAVLVIVLLAMKKPSMPVIVIGALLGAIWAVVFQGMDIA
FT                   HAIATAYNGFSIKTDVEFLNGLLNRGGIVGMLDSLVVIIFGLGFGGLLEKLGVLKVIVS
FT                   TFEKKLTSAGNVTLSTLIVAFLANIFGCAMYVSLILTPKIMEDSYDRLHLDRRVLSRNS
FT                   EVGGTLTSGMVPWSDNGIYMAGILGVSTFSYLPFMWLSFVAIGLAIIYGYTGKFIWYTK
FT                   NNTVKAEKLG"
FT   regulatory      266856..266860
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        266869..268188
FT                   /transl_table=11
FT                   /product="YqkJ"
FT                   /db_xref="GOA:P54572"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54572"
FT                   /protein_id="BAA12645.1"
FT                   /translation="MIAKHMIRTLMIETPSVPGNLGRVATAIGLLGGDIGEVETVKVGP
FT                   NYTMRNITVQVENEEQLQEVIAAVQALGEGIRLHTVSDEVLSAHEGGKIQMKSKMPIRS
FT                   LAELGRVYTPGVADVCRLIEKEPEKASIYTTISNSVAIVTDGTAILGLGNIGSVAGMPV
FT                   MEGKAALFDQLAGISGIPILLDTSDPEEIIKTVKHISPGFSGILLEDIGSPHCFEIEDR
FT                   LKEELNIPVMHDDQHGTAVVTLAAAISACRSAGVDLKEAKVGQIGLGAAGVAICRMFMA
FT                   YGVNAVYGTDKSESAMNRLEQYGGQAVSSIEELMETCDIVIATTGVPGLIKPAFVRSGQ
FT                   VILALSNPKPEIEPEAALQAGAAYAADGRSVNNVLGFPGIFRGALNAKSTEINHDMLVA
FT                   AAEAIAACTKQGDVVPQPLDSKVHHAVAAAVEHAALTAVK"
FT   regulatory      268273..268285
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        268288..268503
FT                   /transl_table=11
FT                   /product="YqkK"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54573"
FT                   /protein_id="BAA12646.1"
FT                   /translation="MAKSQAKKKRGHRLRNGGRDVLLSRGSTPSFSTHGRMTKSKKEIL
FT                   NKRKHKNPYDHTAVDDKDFFVPQKAA"
FT   regulatory      268592..268596
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        268604..269248
FT                   /transl_table=11
FT                   /product="SpoIIM"
FT                   /db_xref="GOA:P37873"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="InterPro:IPR014196"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37873"
FT                   /protein_id="BAA12647.1"
FT                   /translation="MRKISYKDMFLRHVKDHLSLYIFVSVLFFMGVIFGAIIVNSMTIS
FT                   QKEDLYYYLSQFFGQLSDGKQASSADMFGQSIFHNAKYLGLMWILGISVIGMPIIFIMI
FT                   FLKGIVVGFTVGFLVNQMGVSGFFLSFVSVLPQNVLLIPAYLIMGTCAIAFSLKLIRQL
FT                   FVKRSLHDAPIQWFGRYAFVLLVILFLALISSLFEAYLSPVLMEKLTSRLF"
FT   regulatory      269348..269353
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        269361..269810
FT                   /transl_table=11
FT                   /product="YqkL"
FT                   /db_xref="GOA:P54574"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54574"
FT                   /protein_id="BAA12648.1"
FT                   /translation="MENRIDRIKKQLHSSSYKLTPQREATVRVLLENEEDHLSAEDVYL
FT                   LVKEKSPEIGLATVYRTLELLTELKVVDKINFGDGVSRYDLRKEGAAHFHHHLVCMEFG
FT                   AVDEIEGDLLEDVEEIIERDWKFKIKDHRLTFHGICHRCNGKETE"
FT   regulatory      270155..270158
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        270169..271059
FT                   /transl_table=11
FT                   /product="YqkM"
FT                   /db_xref="GOA:P46352"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46352"
FT                   /protein_id="BAA12649.1"
FT                   /translation="MKDQIKDFIHYVMVERGLSQNTIVSYERDLKSYSLYLTETLHVTD
FT                   WNHVTRIHIIQYLKHLKDSGKSGKTSARHLASIRSFHQFLLREKVTDKDPSVHIETQKT
FT                   ERALPKVLALNEVERLLDTPKLTSPFGYRDKAMLELLYATGIRVSEMIELKTADVHLSM
FT                   GFIRCFGKGRKERIVPIGEAAASAIEEYMTKARGKLLKNNVSDALFLNHHGKQISRQGF
FT                   WKNLKKIALEAGIKKELTPHTLRHSFATHLLEDGADLRAVQEMLGHADISTTQIYTHVT
FT                   KTRLKDVYKQFHPRA"
FT   regulatory      271204..271211
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        271220..272404
FT                   /transl_table=11
FT                   /product="YqkN"
FT                   /db_xref="GOA:P46353"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46353"
FT                   /protein_id="BAA12650.1"
FT                   /translation="MPAYKYNRVFLIVMDSVGIGEAPDAADFNDEGAHTLGHIAEHMNG
FT                   LHMPNMAKLGLGLIEDIKGVEKTEHPLAYYGKLQEASNGKDTMTGHWEIMGLYIDKPFK
FT                   VFPEGFPDELLQELEKRSGRKIIGNKPASGTAILDELGQEHMETGALIVYTSADSVLQI
FT                   AAHEEVVPLEELYRICETARELTLDPKYMVGRIIARPFVGEPGQFKRTPNRHDYALKPF
FT                   DRTVMNELKDCGLDVISIGKISDIYDGEGITSSRRTVSNMDGMDKVIDTLGEDFTGLSF
FT                   ANLVDFDALFGHRRDPEGYGRALEEFDARLPEVFGKMREDDLLIITADHGNDPIHHGTD
FT                   HTREYVPILAYSKKHKKAQMLPLADTFADIGATIADNFQTNKPKYGKSFLSLLQ"
FT   regulatory      272403..272408
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        272417..273232
FT                   /transl_table=11
FT                   /product="YqkO"
FT                   /db_xref="GOA:P46354"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011270"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46354"
FT                   /protein_id="BAA12651.1"
FT                   /translation="MKDRIERAAAFIKQNLPESPKIGLILGSGLGILADEIENPVKLKY
FT                   EDIPEFPVSTVEGHAGQLVLGTLEGVSVIAMQGRFHFYEGYSMEKVTFPVRVMKALGVE
FT                   ALIVTNAAGGVNTEFRAGDLMIITDHINFMGTNPLIGPNEADFGARFPDMSSAYDKDLS
FT                   SLAEKIAKDLNIPIQKGVYTAVTGPSYETPAEVRFLRTMGSDAVGMSTVPEVIVANHAG
FT                   MRVLGISCISNAAAGILDQPLSHDEVMEVTEKVKAGFLKLVKAIVAQYE"
FT   regulatory      273368..273377
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        273387..274556
FT                   /transl_table=11
FT                   /product="DacF"
FT                   /db_xref="GOA:P38422"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38422"
FT                   /protein_id="BAA12652.1"
FT                   /translation="MKRLLSTLLIGIMLLTFAPSAFAKQDGKRTSELAHEAKSAVLIER
FT                   DTGKVLYNKNSNERLAPASMTKIMTMLLIMEALDKGKIKMSDKVRTSEHAASMGGSQIF
FT                   LEPGEEMTVKEMLKGIAIASGNDASVAMAEFISGSEEEFVKKMNKKAKELGLKNTSFKN
FT                   PTGLTEEGHYSSAYDMAIMAKELLKYESITKFTGTYEDYLRENTDKKFWLVNTNRLIKF
FT                   YPGVDGVKTGYTGEAKYCLTASAKKGNMRAIAVVFGASTPKERNAQVTKMLDFAFSQYE
FT                   THPLYKRNQTVAKVKVKKGKQKFIELTTSEPISILTKKGEDMNDVKKEIKMKDNISAPI
FT                   QKGQELGTLVLKKDGEVLAESPVAAKEDMKKAGFITFLKRTMGDWTKFK"
FT   regulatory      274638..274644
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        274652..275005
FT                   /transl_table=11
FT                   /product="SpoIIAA"
FT                   /db_xref="GOA:P10727"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR014237"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="PDB:1AUZ"
FT                   /db_xref="PDB:1BUZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10727"
FT                   /protein_id="BAA12653.1"
FT                   /translation="MSLGIDMNVKESVLCIRLTGELDHHTAETLKQKVTQSLEKDDIRH
FT                   IVLNLEDLSFMDSSGLGVILGRYKQIKQIGGEMVVCAISPAVKRLFDMSGLFKIIRFEQ
FT                   SEQQALLTLGVAS"
FT   regulatory      274993..274997
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        275002..275442
FT                   /transl_table=11
FT                   /product="spoIIAB"
FT                   /db_xref="GOA:P10728"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010194"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10728"
FT                   /protein_id="BAA12654.1"
FT                   /translation="MKNEMHLEFSALSQNESFARVTVASFIAQLDPTMDELTEIKTVVS
FT                   EAVTNAIIHGYEENCEGKVYISVTLEDHVVYMTIRDEGLGITDLEEARQPLFTTKPELE
FT                   RSGMGFTIMENFMDDVSIDSSPEMGTTIRLTKHLSKSKALCN"
FT   regulatory      275441..275446
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        275454..276221
FT                   /transl_table=11
FT                   /product="SpoIIAC"
FT                   /db_xref="GOA:P07860"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014236"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07860"
FT                   /protein_id="BAA12655.1"
FT                   /translation="MDVEVKKNGKNAQLKDHEVKELIKQSQNGDQQARDLLIEKNMRLV
FT                   WSVVQRFLNRGYEPDDLFQIGCIGLLKSVDKFDLTYDVRFSTYAVPMIIGEIQRFIRDD
FT                   GTVKVSRSLKELGNKIRRAKDELSKTLGRVPTVQEIADHLEIEAEDVVLAQEAVRAPSS
FT                   IHETVYENDGDPITLLDQIADNSEEKWFDKIALKEAISDLEEREKLIVYLRYYKDQTQS
FT                   EVAERLGISQVQVSRLEKKILKQIKVQMDHTDG"
FT   regulatory      276335..276340
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        276343..276945
FT                   /transl_table=11
FT                   /product="SpoVAA"
FT                   /db_xref="GOA:P40866"
FT                   /db_xref="InterPro:IPR021997"
FT                   /db_xref="InterPro:IPR038548"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40866"
FT                   /protein_id="BAA12656.1"
FT                   /translation="MMERRIFIRLRHRVLAHPGDIITVGDAAQIEGQLQLKKKLSAMPL
FT                   YQVSEKDKNIVILDIIQVLRAIHLQDPTIDVQTVGGAETIVEIQYRKRNLSTVLFIGVW
FT                   LLLFIGSCLAIMNFHEDVSMRDVHIALYEIITGERNDYPYLLQIPYSIGLGLGMIVFFN
FT                   HIFKKRLNEEPARWRLRCLTISLISINMWPCMRIKKP"
FT   regulatory      276944..276949
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        276955..277380
FT                   /transl_table=11
FT                   /product="SpoVAB"
FT                   /db_xref="GOA:P40867"
FT                   /db_xref="InterPro:IPR020144"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40867"
FT                   /protein_id="BAA12657.1"
FT                   /translation="MIVSVLFIIFVGLGGGITVGAGFVAFLTVMGIIPRLMQLTKTMRF
FT                   VQAYEAAVILGAVCGGWETLHMNHLYLTKWIAVPVGLLAGLFVGMLAAALTEVLNVLPI
FT                   LAKRIGLRSKIIILLMAIVIGKIAGSLFHWLYFIDHS"
FT   regulatory      277379..277386
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        277392..277844
FT                   /transl_table=11
FT                   /product="SpoVAC"
FT                   /db_xref="GOA:P40868"
FT                   /db_xref="InterPro:IPR005562"
FT                   /db_xref="InterPro:IPR014203"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40868"
FT                   /protein_id="BAA12658.1"
FT                   /translation="MTNIKENYKSKVKTYQPKPPYVWNCVKAFLVGGLICAIGQGLQNF
FT                   YIHFFDFNEKTAGNPTAATLILISALLTGFGIYDRIGQFAGAGSAVPVTGFANSMASAA
FT                   LEYKSEGLVLGVATNMFKLAGNVIVFGVVAAYIVGMIRFAFEKLMS"
FT   regulatory      277843..277848
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        277857..278873
FT                   /transl_table=11
FT                   /product="SpoVAD"
FT                   /db_xref="GOA:P40869"
FT                   /db_xref="InterPro:IPR010894"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR038369"
FT                   /db_xref="PDB:3LM6"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40869"
FT                   /protein_id="BAA12659.1"
FT                   /translation="MKLTGKQTWVFEHPIFVNSAGTAAGPKEKDGPLGSLFDKTYDEMH
FT                   CNQKSWEMAERQLMEDAVNVALQKNNLTKDDIDLLLAGDLLNQNVTANYVARHLKIPFL
FT                   CMFGACSTSMETVAVASALVDGGFAKRALAATSSHNATAERQFRYPTEYGGQKPDTATS
FT                   TVTGSGAVVISQTPGDIQITSATVGKVSDLGITDPFDMGSAMAPAAADTIKQHFKDLNR
FT                   TADDYDLILTGDLSGVGSPIVKDILKEDGYPVGTKHDDCGLLIYTPDQQVFAGGSGCAC
FT                   SAVVTYSHIFKQLREGKLNRVFVVATGALLSPTMIQQKETIPTIAHGVVFERAGGAS"
FT   regulatory      278858..278865
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        278875..279846
FT                   /transl_table=11
FT                   /product="SpoVAE"
FT                   /db_xref="GOA:P40870"
FT                   /db_xref="InterPro:IPR025914"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40870"
FT                   /protein_id="BAA12660.1"
FT                   /translation="MDYLLAFVCGGAICIVGQLLLDIFKLTPAHVMTSFVVIGAILDGF
FT                   GIYDKFIEFAGGGAIVPIVSFGHSLLHGAMHQAHIHGFIGIGMGIFELTSAGISAAILF
FT                   AFIVAVIFKAERISADMTTKRKVILVTDGDVYAAKTIEYAASKVGGRCISQSKGNPSTR
FT                   SGAELVKLIASAPYDPVFVMFDDSGLQGEGPGEAALTYVATHPSIEVLGVIAVASKTHQ
FT                   AEWTRVDVSIDRNGEITEYGVDKVGEREFDDHRMSGDTVYCLDKLDLPLTIGIGDIGKM
FT                   GRKDDISKGSPITMKAVEFILERSGYHAGPQGRENSGLSESS"
FT   regulatory      279780..279788
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        279797..281275
FT                   /transl_table=11
FT                   /product="SpoVAF"
FT                   /db_xref="GOA:P31845"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31845"
FT                   /protein_id="BAA12661.1"
FT                   /translation="MPDHKEEKIRVYRNPAKNEEYFKNRVGMGTSYDVGVRKLTILDKE
FT                   IQLYYLNGLCDTAYIIHLMRELVAINNRKEDPDELVDIVENRLLNAQVEKVKTLDETTD
FT                   QVLSGLVAVIVEGAGFAFIIDVRSYPGRNPEEPDTEKVVRGARDGFVENIVVNTALLRR
FT                   RIRDERLRVKMTKVGERSKTDLSICYIEDIADPDLVEIVEKEIASIDVDGLTMADKTVE
FT                   EFIVNQSYNPFPLVRYTERPDVAANHVLEGHVIIIVDTSPSVIITPTTLFHHVQHAEEY
FT                   RQAPSVGTFLRWVRFFGILASTLFLPIWFLFVLQPDLLPDNMKFIGLNKDTHIPIILQI
FT                   FLADLGIEFLRMAAIHTPTALSTAMGLIAAVLIGQIAIEVGLFSPEVILYVSLAAIGTF
FT                   TTPSYELSLATNEPSCPHDTRCFISYKRARHRIYSANYAMASIKSLQTPYLWPLIPFNG
FT                   KALWQVLVRTAKPGAKVRPSIVHPKNRLRQPTNS"
FT   regulatory      281364..281372
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        281375..282700
FT                   /transl_table=11
FT                   /product="LysA"
FT                   /db_xref="GOA:P23630"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23630"
FT                   /protein_id="BAA12662.1"
FT                   /translation="MTLFLHGTSRQNQHGHLEIGGVDALYLAEKYGTPLYVYDVALIRE
FT                   RAKSFKQAFISAGLKAQVAYASKAFSSVAMIQLAEEEGLSLDVVSGGELYTAVAAGFPA
FT                   ERIHFHGNNKSREELRMALEHRIGCIVVDNFYEIALLEDLCKETGHSIDVLLRITPGVE
FT                   AHTHDYITTGQEDSKFGFDLHNGQTERAIEQVLQSEHIQLLGVHCHIGSQIFDTAGFVL
FT                   AAEKIFKKLDEWRDSYSFVSKVLNLGGGFGIRYTEDDEPLHATEYVEKIIEAVKENASR
FT                   YGFDIPEIWIEPGRSLVGDAGTTLYTVGSQKEVPGVRQYVAVDGGMNDNIRPALYQAKY
FT                   EAAAANRIGEAHDKTVSIAGKCCESGDMLIWDIDLPEVKEGDLLAVFCTGAYGYSMANN
FT                   YNRIPRPAVVFVENGEAHLVVKRETYEDIVKLDLPFKTGVKQ"
XX
SQ   Sequence 282700 BP; 86631 A; 54296 C; 65686 G; 76087 T; 0 other;
     gtcgacctgc aggtcaacgg atcgatcgta gcgatttcta gtgaggattc ttatgaaact        60
     attgttaaga tcattaagac agagagctat acaaggtacc cagtcctaaa tggagataaa       120
     gattcaatca ttggttttat caatgctaaa gaatttttgt cagcttatat tgacacagac       180
     cagaagataa aagaggattt caagttagaa aatcatatca accctgttat ccatgttatt       240
     gaatccgttc caattcatga tgtattggta aaaatgcaaa aagagcgaac acatatcgct       300
     attcttgtgg atgaatatgg cggcacttca ggtttagtca ctgctgaaga tattcttgaa       360
     gaaattgtcg gggaaatcag agatgaattt gataaagatg aagtgcctaa tattagaaaa       420
     gtaaatgata atcactatat cttagattcg aaagtgctca ttgaagatgt aaatgattta       480
     ttgggaacga cgttagcaag tgacgaagtg gatacaatag gcggctggtt tatgactcaa       540
     caaatagacg ctgcagttgg gtccgttata gaagccgatg ggtatatttt taaagtgcac       600
     gaaacagttg gccggcatat taattattta gaaattgtcc ggaaaaaaga ataacatctg       660
     gataaaacac atgagatttt gactaataag atgcttaaag cctgagatga aattttcatc       720
     caggcttttt taaacaatga tcttgcagtt taagtaggta atcattatcg aagttcaaac       780
     gtttctcagc aaacaaggag gcttggatat ctatagctct tttaccatta ccttctcacc       840
     attaaagtcg agttcaccat taaattgaaa accaaacctt tgataaaggc gtatagcatg       900
     aatattattt tcaaatatac ttaaataaat tctcttgcat ttatataact cagcaaggtg       960
     ctgaatgagg gctttaagca ttttcttccc taatcctttt ccctgatagc gttcgtcaat      1020
     aaaaaatcgg tcaagccaga ctcgtccgtt tttattatct tcatcatact cgggaaacaa      1080
     tccatacatt gcaaaaccga ctagatctcc ttcatagtaa agcccgacag gtttataata      1140
     gtgacattct tttgcatctt ctaaacatac ttttgtagat tcaatatatg ataattgatt      1200
     ctggctgaca tgtagatcaa gaattgcagc acgattatca tcagttactg cttttatgtt      1260
     tatactcata ctacattctc cttttttctt atcccggtat cctgatattg ctaaaactca      1320
     gcttatacta tattcacgtc aagcaacatg tagcctatca aattaagtac cttttcttat      1380
     tgtgcctaac caggggcatt ccctgcatcc aaatgactta actttataga aaatgaatta      1440
     attcaaagct gcagcatcat tctttttttc tttccaaacc attgtaagac caaggccgac      1500
     aatcataacg aaacctgcaa aaaggaaagg ataatgaatg ttaagatcaa atagtatacc      1560
     gcctagagca ggtccaaata tatttcccag gctggtgtat gtggagttca tgcctgctac      1620
     gaaaccctgc tggttaccgg ccatattgga taaatgagcg gttaaggccg gacgtagcaa      1680
     atcgaacgcc agaaaaataa aacaagttac aagcaaaaca gttaaaaatc ctgacataac      1740
     agtagacacg aaagccaaga tcgcaccggt tattaagcac agctgaatca ttcttttctc      1800
     tccaagtttg ttgaccaatt tcccgaatag taaaacttga ataactaccg caacaatgga      1860
     actaatcgta ataatggctg caatatcttt tggtgtgaag ccaaatttat gatcagaaaa      1920
     caagctgaat accgtttcat aagctgataa accaaaagcc attacaaaga cgataataaa      1980
     tgcaatgaaa tagacaggat gaatggatct cttcaagtct ttaatgaaat ttgattcctt      2040
     tgtatgagat gagagttgat ggcgttcttc tatcgacaat gactctttta gtataaaaac      2100
     ggaagtgaca gctgctatta acgcgatggc ggaggcgaag aaaaacggca tgcggatacc      2160
     aaagccggca ataaatcctc ccgcaccagg tccaataata aagccggtgc taattgcagc      2220
     agaaacatac cccatagcct ttgacctttc ctttagggtt gtaatatcag ctacatatgc      2280
     tgttaccgcg ggcatgataa aagccgcact tacaccaccc aatatcctcg agaaataaaa      2340
     tattgaaaca tgggtcccta atccgaaaat caactcagat aaactgaata taagcaaccc      2400
     gagaataatc attttttttc tcccgaaacg gtcaacccac ctacctgcaa aaggtgaagt      2460
     aattaactga gaaatggcaa aagccgcaac aagataaccc attgtgctgc cggataaatg      2520
     catgattttc ataaaagaag gcataactgg aatgattaaa ccgataccaa gaaatgctac      2580
     gaagatgttg cttaatagta taatgaatat cgttttttgc tcatttattg attttttcat      2640
     ctgaattccc cttttactca attgaaccct ttttacctat ccttttcgct tgaagctttt      2700
     ttcaagtaca atcaaatcat aaggtatatg gttaccgtat agtcaaggag gtttttatga      2760
     gcgaagatgt taagaagtat ttcacaacag gggagttttc gaagctctgc cgtgtaaaaa      2820
     aacaaacttt atttcattat gatgagattg gtcttttctc gccggaaata aaaaaagaaa      2880
     atgggtatag atattattcc tatcatcaat ttgagacttt tcaagtcatc agtctattta      2940
     aagagcttgg ggttccatta aaagaaataa agtgtctaat aaaaggaaaa acaccagaca      3000
     agatcctgca tgttctaaaa gaaaagtcta ttgagattga taaaaaaata aatgagctta      3060
     agcagttgca aacgatctta caaacaaaag tgacgcttac agaacaagca cttgagactg      3120
     atttttcctc aatttctttt gaatatttaa atgaagaaac attcatgtta agccgaaaaa      3180
     cattaaactt accagaacga aaatatgtgg cagccatttc agaactcatt catgaagttc      3240
     agcaatatga attagatgaa ggatatccga taggcggaat ctttgcacgg gaacaaatct      3300
     tagaaaaaga cttctacaat tacagttact tttatataaa agtaaaagat ggggcagaga      3360
     acataaatta tcatgtacgg ccaaaaggcc tgtatgcagt tggatatgaa ataggcggaa      3420
     atactgaaga ggcgtaccgg agaatcattg agttcattga aagaaatgga atgcaaatag      3480
     gggaaaatgc atatgaggaa tatatgctgg atgagatggt agttgacggg tatgaaaata      3540
     catatgcaaa aatcctcctt caagttaaag aggtgtaaaa ttacgagatt ttcatatgga      3600
     aaattgtttc tgttgtgtgc ccaaaaagaa tataaactgg tttactaaaa gcgagcccac      3660
     atacaggaga cggtacaaac ggcactggga accgcaagtc tatcggcgtt gaaatatgct      3720
     ataacgattc aggaggggat aaattctatg ctgctgaaaa actggccatc aaggcgcatc      3780
     caaagagata aatctaaaag agctgggata ggggggacaa acaacagaat tccgtatact      3840
     ctgttgttgt gctatgtaaa tgttcaaaag ccatttagga tcgtcgacct ttgataatcc      3900
     atcatataaa ggtgtcattc gatgtcttgt taacaaaggc tagtgaaatt caacatctag      3960
     aaaacgatta caaggtcggt gataaattat tcatccatga atcaaacggt gatcgaacat      4020
     tcatttttgt gtttaatatg agttttcttg atttagcaca ctcccttaat aaatgcatag      4080
     gatactatca caaaaattta taattgcggg gatcaaaaaa tgtactataa ccctttttcg      4140
     cctcaatgtt attattatgt gactgtgccg atgtataatg atggaagatc tgtttattgg      4200
     actattccaa atgagatgga gaaagtacac agaggtgccg atttgcgctc ttcatatgaa      4260
     gatagaaacc ttcttttgaa ggattatgga ccaaaaccat ttgttgtaaa tatcaataga      4320
     gccacaaaac aaaacaatac gttccgtact gctttatgga caggaaagca ttttcaagtt      4380
     actttgatga gtcttggtat tggagaagac attggtttgg aaatccatcc taacgttgac      4440
     cagttcttac ggattgagca ggggcgtggg atcgtcaaaa tgggaaagag caaagatcat      4500
     ttgaactttc aaagaaatgt ctatgatgat tctgccattg ttgtccctgc cggcacttgg      4560
     cacaacgtaa ttaatacagg aaatacgcca ttaaaacttt actccattta tgctcctcct      4620
     aaccatccat ttggtacagt tcatgaaacc aaagcagatg cagtggctgc ggaagattag      4680
     cacagatatt ctggagaatt ctagaataat taaagtcaca tccagcatga aacatgggga      4740
     accagtacca tgctaatgaa accccattta atatccaagc agcgtgtctt gtgctaattt      4800
     taagtaattg ataaataaag ccgatttaaa attaaatcgg cttattgctt tattcgagtt      4860
     ccttttagca gaattggcat tatcgaatgt aagtattttt tcaatccgcg gatatcgaaa      4920
     tgaatctatc agctcaaaga aagtaacttt cacacttgac tatataccta tgggggtata      4980
     ttattgtttt gtgaataaac aaagagttaa taaggtggtg taaatagtat caattattta      5040
     gttattgcat tcctgcttat ttttgtgatt atcattgcaa cgtatagacg ttattatcct      5100
     ataaccggaa tctcttgtat ccataaagat aaattagagg ctatggacat cacaatatta      5160
     gatattcgtc attataacga tgtagccaat ttttcggata atattatttt aaacatccca      5220
     tatgcgtatc taaaacgttt ttatttagag attccacgtg ataaaataca cataatagct      5280
     cgtgaccggg tggaattaaa tttaggagtg cgttttctaa agcgcaaagg tatccatgta      5340
     aacagttatg aactggcaac atgtaaatgt aaaaataaat gaaagaaagg atttcattga      5400
     tatatggagt atgatcaaaa gattaaaaac cgcttacgac ggattgaagg acaaattaaa      5460
     ggtgtattga ctatgatgga acaaggaaaa gattgtagag aggttgtgac ccaattagca      5520
     gcttcccgta atgcgatcga tcgagcgatg ggtttaattg tgagcacaaa ccttgaacat      5580
     tgtgttcgtg aaagtttaga aaaaggcgaa gacacacaaa atttagtaaa agaagcagtc      5640
     gacttattgg taaagagccg ataaaaattc atcaacctaa ggttgacgaa tttttatatg      5700
     cgttatatta taccccctat ggtatttaaa gagttgaata aaagcagatc tttcgaaaaa      5760
     attttttgac tttaatatac ccgcaggtaa ttagttagga gaataaacat gacagaacaa      5820
     acaaaacgca caacaattgt tttatttagc ggggattatg ataaagcaat ggcagcctat      5880
     attattgcaa atggtgcagc tgcctacgat catgaagtga cgatcttcca tactttttgg      5940
     ggatttaacg ctttacgtaa agaagagctg attccagtga aaaaaggatt tcttgaaaaa      6000
     atgtttggaa agatgatgcc tcgtggtgct gataagatgg gtttatctaa aatgaacttt      6060
     gcaggtatgg gccctaaaat gattaaaaat gtgatgaaaa agcataatgt acttacttta      6120
     cctcagttga ttgagatggc tcaagaacag ggggtaaagc tcgtagcttg tacgatgaca      6180
     atggatcttc ttggtttaca ggaaaaagaa ctattagatg atattgacta tgctggtgta      6240
     gcagcttatt tggcagatgc tgaggaaggc agtgtcaact tatttatcta atgttactca      6300
     tttactcatt gctaagcgga atgagaagtt taaaggcaag taaaaatatt gaagaaacaa      6360
     ggatttaaaa acatcacaaa tataaaaggg ggtatgaata catggtgtta acttacagtg      6420
     agaaactttt tgtatatttg tataccccca cccctatata agaaaaggag gaaaaaatga      6480
     tgaaagcaac tattgtacta gacgctaaag gtttggcgtg tccaatgcct atcgtaaaaa      6540
     cgaagaagag aatgaaggat ttaaaagctg gtgaagtatt ggaaattcat gcgacagata      6600
     aaggttctac agcagatctg gaagcatggg caaaaagtac aggccatgaa tatctgggta      6660
     ctgaagcaga gggagaaata cttcgtcatt ttcttcgaaa aggaggagag cattcatcag      6720
     aaaatgcatc ttcaattcct gagatttcat tagaagcttt caaacagaaa gtagatagtg      6780
     acgagtctct taacatttta gatgttcgag agatagagga atatgaaaaa gctcatatcc      6840
     caggagttgt gcatatccct cttggtgaag tggaaaagcg cgctaacgaa ttaaacgaaa      6900
     atgatgaaat ttatattatc tgccattcgg gaagaaggag tgaaatggcg gcccgcacca      6960
     tgaaaaaaca aggttttaaa aaggttatta atgttgtccc gggtatgcgg gattggacag      7020
     gtaaaaccga ataaataaaa agcatgatga acagatgagt acaagagtag cgattattgc      7080
     ggcaaatagc ggtctgtttg atgcttataa agtctgtaat attgcgacaa ggaaaagagc      7140
     atgtcgcaga aggttgtagg aacgcaaatg tgccttctat tcttaactga ttgaaatggg      7200
     agttgcatga tttggttgtc aaataacgat ggacgttatg ggtttaacaa aagatgattt      7260
     tatggaagga atcgaagtag gcggggctgt tacctttttt ggttttacga aagatgctga      7320
     tgtatcctta acgttttagt cccgctaaaa gatttgatat aggaggtatt gaaacatgac      7380
     cgtaaaggca atgaccccaa aagaagtgac aaaaaaatct ttaacaaaga acctttattt      7440
     attttggatg tgcgtaatga aaatgatttt agtgattgga agatagaagg gcatgacttt      7500
     gaccatttga atgttcctta ttttgatctt ttagatggcg tagaagatat cttggagaaa      7560
     attccttctg ataaagaagt gctggtcgtt tgcgcaaaag aaggttcatc cgtcatggta      7620
     tccgaaatgc tttctgaagc aggtcattct gtatcctacc ttaagggtgg aatgaaagca      7680
     tggagcgaac atttagagcc ggtaaaagtc ggggatttaa aagatggcgg tgagatgtat      7740
     cagtttgttc gaatcggtaa aggctgcttg tcatacatgg tcatttccaa tggtgaagca      7800
     gcaattattg atgcgacacg tatggtgaat ttctttatag attttgcgaa ggggaagggt      7860
     gcaacgatta ctcacgtatt tgatacacat cttcacgcgg accatatttc aggcggcaga      7920
     gtcattgctg aaaaaacaaa agcaacctac tggttaccgc ctaaagatgc tgaagaagtg      7980
     gaattcgatt atcagccgtt ggaagaagga aatgacatta ttattggaaa tacaacgatt      8040
     aaaattcaac cgatttattc tccggggcac acgattggct ccacttcttt cattgtcgat      8100
     gaccagtatc ttctttcagg tgatatcttg tttattgatt caatcggcag accagactta      8160
     gccggtatgg cagaagattg ggtaggagat ttaagaaaaa cgctttatag ccgttacaaa      8220
     gcgttatcaa aggatttaat tgtattaccg gcacacttta tgatcattga cgagctaaat      8280
     gagaatggaa gtgttggtaa acaactaagt acattattta gcgagaacca tggtttgaac      8340
     attgcggatg aaacagaatt tagacaccta gtaacagatc atttgcctcc gcaaccaaat      8400
     gcataccaag agattcgaga aacaaacatg gggaaaatca gcccagatga agaaaaacag      8460
     cgtgaaatgg agattggccc aaaccgctgt gcaatacggt aacacaagtt tctgctaaaa      8520
     agaggagaga agaacatgaa atcagataaa gtattagacg caaaaggctt ggcatgccca      8580
     atgccaattg tcagaacaaa aaaagcgatg aatgaactgg aatcaggtca aatattagaa      8640
     gtgcatgcaa cagataaggg agccaaaaat gatcttacag cctggtctaa atcaggcgga      8700
     catgaccttt tagagcaaac ggacgagggc gatatattga aattttggat tcaaaaaggc      8760
     taatgaatgt gaaagggtat cgaatagaaa gatacccttt tcctatgaaa ggaggcaaat      8820
     aaaatggata ttgcctttat cacaactctt ttcattatag ggtttattgg tgcctttatt      8880
     tccggaatga ttggtattgg cggagcagtt attaattatc caatgctatt gtacattcct      8940
     tctttagtgg gagtgatgtc attaactgcc catgaagttt cagggatagg ggctattcaa      9000
     gttttttttg cgacactcgg cggtgtttgg gcttatcgta agagtggtct tataaataaa      9060
     acattaatta tttacatggg aagcagcatc cttttaggga gtgtattggg gagttacttt      9120
     tctcattata tatctgaaaa aggaattaac tttatatacg gaattctggc tattatagca      9180
     gttattttaa tgtttatacc taaaaaagga cagaaaggac aagaacatag cgaagataag      9240
     gaagtgatat ttaataaatg gttggcttct tccttagcgt ttatcattgg tggcgtatca      9300
     ggtattttag gagctggcgg cgcctttatc ctagtcccca ttatgttatc gattttaaat      9360
     attcctgtta gagtcacagt cgcttcatct cttgcgatta catttctttc atccattggc      9420
     gcaacagttg gaaaagtaat cacgggccag gttctttttg taccagctct ggttcttatg      9480
     attactagtt taatagcttc tcctattggc gcatcagttg ggcaaaaagt aaatacaaaa      9540
     ttcctgcaat gggttttagc gcaattaata ggtgcgacag ctattaaaat ttggttagag      9600
     ctcctttgat atgagccagc gggtaaaatg aaagattaaa agattcatca ctcgttggtt      9660
     tcttattaat gttatgacac ttggccgcgt tcaataaatg tttcaagtgt ttgatgaaat      9720
     tcattttgat aatggtgact tggacaagtc ttgactatag taccatgaaa tgcatttgac      9780
     ttagtggtgt ccagtgttgt tttgcattaa gacagcatac ataaaataaa agagaccata      9840
     acttaatctt tgatcacctt ttttaaaaca ttttaatcct gattggttta aggggtatgg      9900
     tatgtgatgg gtataatgag tcaatataaa ttatgtctat tttgtcccca aaataaatag      9960
     agggactcga actaaaaaag aggatgccaa actatatagg tatctttgtt tgctttagag     10020
     ttattatatt tgaatatgac atgccacgta acaacacgtt attgcacata taattaagaa     10080
     gcaactacta aggcagattc ttctctcttt taacaccata tccaatcagc ctcaaatgta     10140
     atataatgtt gccaaaccat attggttgtg gcaccgagga ggaaatgata ggtggtttat     10200
     ttcgtagcat ttttttgttt tgctattaca cttcataata ttgaggaagc tatttggtta     10260
     cctgagtggt cacaacaatc ttcaaagttt caaaagccag taacttcaaa tgaatttcat     10320
     tttgctgtca ttgttataac tatgttggct tatttatctg catttggttt tttatatatg     10380
     ccagaatcag atattgcaaa atggattttc attggctttc taggttctat ggttatcaac     10440
     gctatttttc cacatcttat cgcaactgtt gtaatggaaa agtatgcacc tggacctctt     10500
     acgggcttat tgcttaacat tccagtaaac tcattagtta tttatcaaat gtttttaaag     10560
     aatttgattg tatggaagga gttaataata tctacgttgg ttgtaggaat tattttatta     10620
     gcacttattc cattattatt taaagttggt gataaagtat ctccttaatg agtttaaatt     10680
     ggtaaggatt gagggaaaag gtagaaattt tctaaataat ggattattct gtatatcgga     10740
     tttctacaaa acaatgtctt aagtcatcat tgattttggt gcccaattag ttgccctgaa     10800
     ttcatgaaaa aggattaaat aggtgtaaat aaagttgcta ttttaaaatt agaatcaatt     10860
     cattatcgta aaaaataata actaattggc aaagaaagga taatcagtct aatgaaaaca     10920
     ttagttatcg ttatacatcc taatttggaa acgtctgttg tcaacaaaac ctggatgaat     10980
     cgtttaaagc aagagaaaga cattacggtt catgacctgt acggtgaata ccctaatttt     11040
     atcattgatg tagaaaaaga gcagcagctc ctgttagatc atgagcgtat cgtttttcag     11100
     ttcccaatgt attggtacag cagtcccgcg ttactcaaac aatgggaaga tgatgtgtta     11160
     acacatggct gggcttatgg aactggagga actaaattgc atggaaaaga actactctta     11220
     gctatctcct caggcgcaca ggaatctgat tatcaagcag gcggagaata taatatcacg     11280
     atcagcgagc ttatcagacc gtttcaagtc actgctaact atataggaat gcgttttctt     11340
     cctgcgttta cacaatatgg gacacttcat ctttcaaaag aagatgttaa gaacagtgcg     11400
     gagagattgg ttgactatct taaagccgag cattaatccg gtattcgcga gggaagttga     11460
     aacaaatgat gtgttatgaa ataagggttt gtaacagatt ttaataaact taatttcaaa     11520
     gttacatcaa atacttaatt cagggggggg catagtgcga ggccttaaaa ttaattaaag     11580
     cagggcaatg agtacgtatt tcttaatgaa atgtagagtt ccttggcctc taataggtac     11640
     ccgatttgtg tccagaattc tgaaaaatga tgaaaataag tataaataaa ataaacatat     11700
     gctttgaata aaagcttttg taactcatga tatgttttta ctatgttgag ggactagtgg     11760
     gcgtggtata tgtcagaaaa gaaaccgatg attcaaaggt gttttgaccc ctgtttatga     11820
     gacagggatc aaaacacctt ttaaacatca ttattacctt cctctgataa tgaaatataa     11880
     aaaagttacc agcaactctc tgcggcatct cgccgtgttc aattgtttag tccttttttt     11940
     tcataatctt tacaaatctg aaaaagtcat catcattcag taggggcttg tcatcttcac     12000
     gtccattgcg atgcatatgc ggattagagt gatgttcatt gtagaactct acgatatgaa     12060
     atccacactt attcacatag aagttgatat ttcgcttttc gaaataaggt gtcacggttt     12120
     cccaaagcac agtatccgga tactgtgctt caatggcttt ccaagcagaa agaccaatcc     12180
     cttggctgtg atattctgga gatacataga ataaatctag cgaattatga tttgtttggc     12240
     tgttgatacg tactactgca ccaccgacat tcttaccatc ctgaagaata tgatatacca     12300
     ctgctccggg agcattgaaa gactcctgaa catcattgtc cgatggaatc ggcccatctt     12360
     cgcaatcacc gaacgtttca atcacggcga tcgcaaaggc ttcttgtaat tttttttgga     12420
     attctggcag atcagattcc tttgctagtt ccagaataac ttttggttca tttttagttt     12480
     tcatgattgt tcactccctc agttgctaaa atatagagtt cagtcgttca gtaaaacatt     12540
     cgagctgctc tgcgaggcct tttcacaaaa aagtgattcc atcgctcttt cttccgcggt     12600
     aaatttggcg ttaaaatact tcaaaagctt tctcctgtct ttttgtatga ttctttttct     12660
     ttgtttcatt ggaaaacaag ctgcatgtaa ccctaattta ctattgttca ctaccgtatt     12720
     aagtgtcgta tgcgggattt gtcatcattc tcgaattttt cctgcgaaaa gttacaaaaa     12780
     tagtcgaatg aggcgccttt gactatgaac atgcgtaaaa gattcaattt agattcgatc     12840
     atgagcaatg cacattgagt aaactctggt ggatttatta gcccaaagaa gcctaaatga     12900
     tataaaaata actagtccat atatcaaatc tgtccgttta atgcccgctt cattcaacaa     12960
     cactaatttg aagtcatgca atctgtgcaa gggggttatt tctgaataga tttttccgaa     13020
     tgcagcggag ttgctttggg actcccgttt actttgccgt acgtcagctt gcgccatact     13080
     aattccatcg gaccgtacct aaaccgtttc aaccacaatg tactaaagct cataagaacg     13140
     aagtacacgg ccagactgaa catgaacgtg ccggcggatt gaatatgatc cgcaagcccg     13200
     aatccgtacc tgaggaacag aactgttcca atgatagagt gaagcagata acaggtcaat     13260
     gacatccgtc cgactttggt gaatatcatc atagggcctc gcagctgagg aaggtataga     13320
     aacagcattg caaaagtgct catataaaac atacttccgg ttaagccgcc attttgaccc     13380
     aagacagagg aaatgtcctt ccacagcata ttctcagaaa gattaaacat gtctagtaat     13440
     atactgcttt gtgttattag aaaagcgatt gtgctaatga tccagatacg cttccatata     13500
     ggctttttcg cttccatgtc tttgaaaaat tccatcttaa caaagtacac gcccagcaga     13560
     aacatgagaa acatggaata gatcatagag aaagagccgg cagccatcgt gaccatatct     13620
     gtccaccgag tgctgatgga ttccatgtag gtaaggctgc tgtggctaaa caaagtaaac     13680
     tctgaaaaat tcgggttttt tgaccctgca gtattgatga cattgtacaa cattgtgaaa     13740
     acaggagtca ggaattgaaa cacgataagt gcgataatcc atctaagcac cgttttggcc     13800
     gtgcgtttat agaaggcgag taacaggaag ccacttacgg cgtaaaaggc caatatgtca     13860
     ccgacccaaa caaatgtgat gtgcaaaatg ccaaatccca acaggataga taacctgcgg     13920
     gcaaacagct tgttgggact ctctaccttc tgcgcggctc gatccataaa gatcataaac     13980
     ccgactccga acaggaagga gaataacgta acgaatttcc cttcggcaaa ccaggaaacc     14040
     agcttatgca gtacgtcatc ggaggccatt tcgaatccct ttactgaatc tacgatcaga     14100
     aaataattga caataataat gccaagcaag gcaaatcctc gtacgatgtc cagaaaatga     14160
     acccgttccc gcagactcac cggttgcccg cgtccttctt tttgtacaat catatcaata     14220
     ctcctttccc atttatcacg gcaatgtgta gtgcggatct gaaaaacttg agccttacaa     14280
     tggataaata taaagaccga atcttaacaa tttatgaaga gtcatcattt tttttagaaa     14340
     atgtgacaaa tttgtggcga gcatcagctt tcataaattg gtaagattta cgtagtatct     14400
     tataacgtac ttattactat gaacgatata tagtaaggac acacgagaaa taacaacaag     14460
     aatcatgagg tgagagagac atggcctatc gaatattagt cgtagaggat gatgaggata     14520
     ttggtgatct tttggaggaa tcccttacac gtgcaggtta cgaggtgcta agagccaagg     14580
     atggaaagcg agcattgcaa cttgtgaatg actcgcttga tttggttatt ttggatatta     14640
     tgatgccagg catttcggga attgaaacat gtcagcacat caggaaatcc tctaacgtcc     14700
     cgattctgtt tctgacggcc agatcgagta cactcgataa aactgaggga ttactcgccg     14760
     gcggcgatga ttatatgact aaaccattct cggaagagga acttcacgct agagtgattg     14820
     ctcaattacg cagatatact atctatcagg aaaagaagga acaggaagaa acatttctta     14880
     tcgggggcaa actaagagtg agcgaagaat ttaatgaggt gtggaaagag gagaagcaaa     14940
     tcaagttgtc agatctggag tatcgtatcc tgaaacttct gatgaacaaa cgcaacaaaa     15000
     tattttctgc ccaaaatata tatgagagtg tgtggggaca gccttacttt tactgttcca     15060
     acaatacggt gatggtgcat atacggaagc tgcgctccaa aattgaggat gatccggcac     15120
     gtccggttta tataaaaact gaatggggaa gaggatatcg atttggcgca tcttaaattt     15180
     acgctaacca aaaaactggc tttgctgata atggttgctg cgattgtgag tggtgtgatc     15240
     tttctgacgt tgcaaaagat cacagatgat ctgatcgagg gatatctgag ttcggaagag     15300
     tattatcacg aggagtcagc aagatacatt caaaaattca gcaagtacgt ttcagaaaat     15360
     gagttgtcta catcagatag aaaagcgttt ggcgagtggg tcaaaaaaga aaattacatt     15420
     aacctcacca tattcaagga tcaggagctg caatatgatt ctatttattc cgaatcggat     15480
     tatggaaagg aaaagctgac tcagtacgct caaaatcatt cacatcctgt caagtttagc     15540
     gatggtgaag gacgagtcat tatcgacggt ttctactctt cccgatatta tgatctggcc     15600
     tttgcattgg atttgctcgg ggcaaccctc atctttttaa tcattgttct cttcggaatt     15660
     cgccaaagtc ttcgctacct taaaacgatt catcaagaga ttcatattct tgaagggggc     15720
     gaactggact acgagatgac gataaaaggg catgatgaat tagcgatgat tgcaaagagc     15780
     attgaggatc tgcggaaagc tttcctggat aaacttaaag ctatcgagga attgcaagct     15840
     gagagccgca gcctggttac cgaaatgtcg cacgatatgc gcacaccgct gacgtcgctg     15900
     atcatgaatc tggagtttgc caaaaaagag ggaggcgaag cgggtgccag caaagatcgg     15960
     tatgtagcca atgcttatgg taaagcactg caattaaaaa gcttgtctga caatctgttt     16020
     gcgtatttcc tgctgaacaa ggaatatgag gccgatctgg agaccgttgc agtgaaagaa     16080
     gtgatctacg atctaatatc agatcagatt gctatccttc atcaggagca ttttcgggtc     16140
     catatttcag gcgagctgcc ggaaacctat attaacgtga atttggagga gcttggtcgt     16200
     gtatttgata atgtgatgtc aaacttattg aaatacgcag atccggaaga aaaaatcagt     16260
     atcacgtttg tatcggatca agagatattt gagatccatg ttagcaatac gattaaactt     16320
     gcagatataa caccggaaag caacggactc ggtgaaagaa gcattgcgcg aatgatgtcc     16380
     cgcatgcagg gacagtttca cagtatacaa aagaattcta agtactacat tgtgctacga     16440
     ttttggaaca ccaagatgta ggctgagaat aaaaaccacg aatatattga aataggagac     16500
     aacatgatga gattttctaa caaattcaaa aaggtgcctt acctgttaca agcgcttctc     16560
     aacgtctgtc tgtcctttct ggcgttagcc ttaagcgcac ttctgatcag cgagacttgg     16620
     tacattgtgc tattcgtata caagtcactg ttcaacaaag tggacagcta ttatgagatg     16680
     cttggagaac tgcttatatt cttcatgtac tttgagttca ttgctttgat tatcaaatac     16740
     ttcaaatcag actttcattt tccgcttcgc tacttcattt atattggcat cacagctgtc     16800
     attcgtttga ttatcatcga tcatgatcag gcgatctcaa cgttctggtg ggcgatggcc     16860
     attcttgcaa tgatttgtgg attctttatt gccaatagac gaaattctgt tgttgaacat     16920
     taataaatta gttcgcatta tgccgaaacg ccgccgaaat gtcctaattg tgaaagggaa     16980
     ctggtacaga tttttataac tctatctgtt taatgtcagc tcagaaatct gtagtggatc     17040
     aaattgaatc gtggttgtaa gtggatatcc gaatgtattt attggctact ttaacagaca     17100
     tgtcccgatg aaatagcatt aactgtttgg agatgaaaat cgcttcttta tttcacaagg     17160
     aagaggttaa aattcttaat aaataagatg aaaaagttag gttggacgtt tattgggttt     17220
     ttgtaaccat tttttaccat aattgatata aacgtataga aatgataaca aatgaatata     17280
     tagtgtgtaa tgaaaataag ctttcataac caatgagcta gatttactat attgagggcc     17340
     tagtgatata gaaaacagat cgatggtaca aaccatcggt ttttttattt gttttcatac     17400
     tcattgaaaa tcacctcatt aggacaaaca ggtattacgc agcattaccc aaggggtgat     17460
     gtattttatg aaggtaataa tcatcgaggg actgcaaact gacaaatgca tgaacgattg     17520
     ctatcattat ttaataaaac tttataggca ggagatccag ggtgatagca atatatcgtg     17580
     gaacaagcga tcaagggatc gagcatcgac agccagatcg aggcctgtat aaagaaagca     17640
     gggactaaag atgtactgaa gtataccgat ctaaggattt tctcaggaga gcttttagaa     17700
     cgtccggctt tgaatgcctg cgggaggatt ataagtcaag ttatttgtta cgatcctgcc     17760
     tgtctttctc ggagagctta tcagcgatga aaaaaatgat tttcataact ctttcaaata     17820
     gagaaagccg gagtatgaga tccggcttct tctgcattat ttccccttcg ccttcttccg     17880
     cttttccttc tctgcccgat aaaactcatg aaacatcttc atcagcgccc gcttttcaat     17940
     ccgcgataca tagctgcgtg agataccgag ttctttggca atctctcgct gcgttttttc     18000
     cttcttcaaa tcaagtccaa accgcccgac aatcacttcc ttctcacggt catctaaaat     18060
     gtcaatgtat tgtttcactt tttcaagctc catattgagc tggatcgtat ctatcacgtc     18120
     ttcgttttct gatttcaaaa cgtcaatcag gcttatttca ttcccttcct tatcctgccc     18180
     gatcggatcg tgaagggaga cgtctttttt tgtttttttc aatgcgcgca aatgcatgag     18240
     gatttcatta ttcattacaa aaaggggggg cataaatttc ccgtaacagt ttgactaaat     18300
     aaatgttgag tcagtttcct gtaataaatg cttaaacgtt tcttagcgaa tgaaggggat     18360
     accttaaata accaagctac attttcaatt gcatgtgatt gtatgtacgg aaggttgata     18420
     ttacgcaaca tgcaagttgg aatgcaaaag tgatatgtaa aataattgga ctgccaatcc     18480
     aaataatcag tccaagttgc aggcattgtt tttttatcgc cttcatgtct atatatatgg     18540
     caaaattcat gagcaaaatc ataccattgt tcagttcggc ttttacggct gtccaagcat     18600
     atattataaa ttccgctgtg tttaagtgcg aagcttgtaa caggtttaaa cgaaagcctg     18660
     atatctaaag cctcggcaat ccgttcaaaa ttaatttgtt ctggttctgt aatatcaatc     18720
     ttcttgtata agttttcaat ccaatcctct aaatgactgt ttgtatacct caagatgaaa     18780
     aacctcctta aagacgacaa tctaaaaatt ggattcgttt aaatattata tggaaatcaa     18840
     gacttttttc ataggaaaat gcgtctaagg agatggaata tgaatccgtt taatcatgac     18900
     tgttttcgta agtattatga ttttaacacg catctggatt tccctcgaaa agtaaaggtc     18960
     ttttagggat ttatgtcaaa ataatagtaa gtacgttatg caacaaacag ggagtttggt     19020
     tgcttaataa ggaggggaag tatgaaaaaa aatattcaca tattgggagc ctctggtgtc     19080
     ggaacttcaa cattgggtgc tgcattatca aagcgtttgc ctcatacgca tcttgatact     19140
     gataattact attggttaga caaattcact aaaaaaagag aaattcctga aagaagaaag     19200
     ttgcttgaaa aagacttaac aatcaatgaa aaatggattc tttctggtgc agtgtgtggc     19260
     tggggcgata atctaaaaag ttattttgac cttgtcgtct tcttatggat tccacaagat     19320
     atacggcttg agagactaag gcacagggaa tttcagcgtt atggaaacga agtgttagcc     19380
     ggtggcagta aatatgaaca atcaaaaaca tttttagagt gggcttcttt atatgataat     19440
     gctggaatgg aagttagaag tagagctttg catgaacatt ggatggcaga tttatcttgt     19500
     ccagtgttaa agattgaaga cgactgctca gtcaatgaaa gagttgaccg tgtcttggat     19560
     tatctgagtt ctaattaaac taacggatag caatagctgc atcagaaaat aaatccaaaa     19620
     atcaaagaca gttccagtat ggcatttaat gagctgtttt tttaataccg ctatcaattt     19680
     gcctactatt tttggtagca tccccacaac agagaagaga ttgtccttca taaggaagtt     19740
     tttggatcag ttgcaggaaa tggaacctca acgattagat acatcctaaa acctgtccag     19800
     ctagtgctta tgttggttac cattgagtga aaagcacttg ccgatccttt tttgttggtg     19860
     taatcattag tgaattatta caattgcaaa tgataggggc aagggaataa atggacttca     19920
     aaggagttta atcatgaaaa ataatgataa gaagaaagag gttcaaagga aatacagaga     19980
     agagattaaa aaaaagaaac aaaagaatga agataataaa aattttatta aagaaacaat     20040
     tattgttgtt acgataattg tattgtttat ttttttcaca tacactttgc aaggttttta     20100
     acaagaagcc ctcttttccc atttcgatac tctgcaattt ccctcacaat aaacgctcaa     20160
     tttttttaca tgagaatata aaagaaacat aaatgaaaat ataaatgaga aaaacaacaa     20220
     aaacccttgt cacgtaaggg tttgtaaagg attcaaaatc actttttaaa tgagggtatg     20280
     aatgaaatat aaatgagaat ctaaatctta ttagtaaaca gaattaaaca taataaacag     20340
     aaataaataa taataaacta actgcgttta tttatctgat ttccgtcttt cttttaattg     20400
     ctccgttata atctccaaag cagcctgtaa gatctcatct gttacctcac cgtcttttgc     20460
     tgcaaggaat gtttcaggat cgtttaacac tttttttgct tcatcctgaa atactttttc     20520
     attgctttct cctttaagaa gataatccaa agaaacatca agtatgtttg aaatattaat     20580
     taaggtttta tagtcaggct cacgactacc tagttcatag gcggtgtagg caggccgagt     20640
     aattccaagt ttatcagcca tattttgttg ggttagtttc ttttgttttc tgcacttttt     20700
     caagttctcg gagaacatat taatcacctg acttttgttt ttattctata tctcattgta     20760
     acgtaacaaa gggttacata taagttttgg taacaaaacg atactttttt tatgaaaatg     20820
     tgttgacaat gtaacgaatc gatactatta tctaagtaac gaaacgttac attttctgat     20880
     taagggggtg aaaaatgatg agaaaatggc ttaagaaaaa ccgcttagaa aaagggttta     20940
     ctcaagaaga agttgccaaa gctgcacaga ttggtagagc atactacacc atgatagaaa     21000
     atggtactag gaagcctagt gttattgtct caaaaaaaat aggagagaaa ttaggctttg     21060
     actggactat tttttttgag gatgtatgta acgaaacgaa acataattct aaggattcag     21120
     catgattaga attcacaaag gaggcctttt aattatgaaa gtcatcttga aaaaaggacc     21180
     actgtttgaa caggcagagg ccaaagccta caaatacctc agtggcatac ttgttcagcg     21240
     tatgaatgaa caccaagaga agcttgcgca aaaaaataaa aaggaatcag cctaagtcat     21300
     ttataaacag catggtcttt caacttcaat tttaaaacta aaaacctaat ataacaggag     21360
     gcaaacatat ggagaacaac ccatacaata tgcgtaattt accgcagatt atgcgtagtg     21420
     cccgtaaggc tgcaggtctt tcacaatacc aaatcggcaa gttaatcgga ggtaaggatc     21480
     aaaggtatgt ttcagatgtt gaaaatggac ttgccaagct tactccagag ttatgtatta     21540
     aatggtttga gaagtgcgct gcctatgaac atattgatct tgtacattac ttattcaaac     21600
     ttcatcctac agccgctgct cctattgatc cggcactcaa tgaatgtgca agtaatgcgg     21660
     tgattaatat ggttcaccaa ttggaggaag cactgcaagc aaccaaacat ttagcccgtt     21720
     ggctcacgga taaccgacca ggtaaaacag aggagctgcc gatggccgat attaagcaga     21780
     tttttgattt gattgcggct aacaaaacat tgatttattc acttgttcgt actcacgggt     21840
     tgaaaatgca ggaacttgca gatagatgga cgcggaaagc tctagttgat caagttgcta     21900
     tggcaaaaca agaaggaagg caggcggttt cagtatgaat actaatcatt tcttgaaggc     21960
     agatgttcct atcgcaaaaa gaaaaatcga atcagcagaa gagctatcaa tcatgctgtc     22020
     agaggcatta cgtgatggtg attatgaaga agcgattagt cttgctggaa gcatcaaggt     22080
     tcttactgag gatattagcc ggcttgcaaa caaaggacgc ctttatgaaa cggcattgaa     22140
     aatgcaacag caaggtatca acttaactgt agtgagcagg tgtataggat gatggttcat     22200
     tttgttcata aaccggcaac tgctctggaa gttcgtaaat ggtgtgtgat gattcgtaac     22260
     aatagtgaat tccatctgtt atgggataga cgtgcagaca aattcagaga ggagaataag     22320
     aatggtcgaa aatccaatgg tcataaacaa ctggcacgat aagctgactg aaacggatgt     22380
     acaaatagat ttttacggtg atgaagtaac accagttgat gattatgtaa ttgatggcgg     22440
     cgaaatcatt ctcagagaga acttggaaag gtatctaagg gagcaacttg gttttgaatt     22500
     taaaaacgcg caataaaaaa gcccactcgg caaagtggac ttctttaaag gctatctaaa     22560
     aaaactcatg tgcaaatatt ttatcagata gcctcaataa aaacaatggg ggttaggtgg     22620
     aatgacaagc aaacgggctg aggttcttgc taagaattct gaaatgagcc gtgatgaatg     22680
     gcttattgaa agaagaaaag gaattggcgg ctcagatgca tccattatct tggggctgaa     22740
     caagtggaag acaccttttg aattatggtt agacaaaaca ggacaggtcc ctgttagtga     22800
     atcgcaaagt gaagctgctt actttggatc attgctagaa gatattgttg caaaagaatt     22860
     tgagatacgt agtggcaaga aggttagacg taaaaaagca atactcagac atccagaata     22920
     taatttcatt ttggctaatg ttgatcgaat gatcgttggt gaaaaagcga tccttgaatg     22980
     taaaacaaca tcagcctaca acttaaaaga atgggaggac gaagaaatcc ccgagagcta     23040
     tatcgttcag gtccagcatt atctgggtgt gcttggacct gaatatcgga aagcttattt     23100
     tgctgtgctg attggcggga acaaatttgt ctggaaagag attgagcgag acgacgagtt     23160
     aattgacatg atctttaaag cagagattga gttctggaat gacaaggtct taggtggaca     23220
     agctcctgct ttagatggtt caagtgctgc ggaggaatac ctcaaaaaac gatatgccga     23280
     aacggaaaat aacaaagcta ttgatttaac tgcggctaat cgagaacgta ttcaacaata     23340
     cttgcttatt aaagaacaga tctcagagct tcaaagccag gcaaaagaat tagagaacca     23400
     aatcaaacat gaaatgaagg atgcagagta tgggtttatc ggtaactatc aagcttgctg     23460
     gaagcctgtt gtctcaaatc gaattgacac gaaaaagctc aaagaccagt ttccggatgt     23520
     atacgagaaa gttaaaaagg aaactcattt cagacgtttt ggaatcaagg aggttagctg     23580
     attatggcta ctaatcaatc aattaaaaac aacatccaaa agaaacaaaa aaacgtacct     23640
     gtgcaacaac aaggagcaac aatgaaaggg ctactttcct caccatctgt tattaaacga     23700
     tttgaggaag tgttagggaa gagggctaca cagtttactg cttctatctt aagcctttat     23760
     aacagcgagc agatgctaca gaaaacagat cctatgagcg tcatatcctc agcaatggtg     23820
     gcagctacac tcgatttacc tatagataaa aacttagggt atgcctggat tgttccttac     23880
     ggaggtaagg ctcaatttca gcttggatac aaaggatata tccagctagc cttacgaaca     23940
     ggccaatata aatccatcaa ttgcataccg attcatgaag gcgaattgca gaagtggaat     24000
     ccgttgactg aggagatcga gattgatttt gaaaaacgag aatcagacgc ggtaattggt     24060
     tatgcagctt attttgagtt gataaatggc ttccgaaaaa cagtgtactg gacaaaggca     24120
     caagtagaga agcacaaaaa gaaattcagt aagtctgatt ttggatggaa aaatgactgg     24180
     gatgcgatgg ctcttaagac tgtattaaaa gcagttttga gcaagtgggg gattctctct     24240
     gttgaaatgc aaaaagcagt tattgaggaa gatgaaacaa gggaacggat tgacattacc     24300
     aatgaggcag acagttcaga aattatcgat tccgagcctt caaacaaaga tgaaacggaa     24360
     aaaccaagcg cccaagaaac cgatcctttt gacggcaagc ctgtagatat aaaagacgat     24420
     gaacttccgt ttgattgagc cggcatctct gacataactg cactctgtga aaggaagtag     24480
     gtgattgact tggacataaa agcaatgggg tatgtggtca taccccgact accattcaaa     24540
     gagtttaggg atgaaaaaat ttatgatcac ttgttcaaaa gagctgaata caggccaaat     24600
     caagagctag aacttgggca gaccattatc aaagttgtgg aactagcaaa agattttaac     24660
     tggtcagctg cacagatcaa atactcacta gaccgaatgg agaaacaggg atatatcaaa     24720
     ttgcaccgtc ttccacaaaa aagagggctc atcgtcacca tacttcatta tgcagactac     24780
     atacaactag gaaattacat gaagaacaaa gctttggaac cagctcagat tgaacatcag     24840
     gaggtcgatg acaaaatgaa aaatgccttt gagctatatg aaaacaaagt tgctcggtca     24900
     gtcggcccga tggaggcaca gcggatcggc tacatggtcg acgattatgg tgaggaaaaa     24960
     gtgatggagg ctatcaagac agcgtttcaa ttaaagggga aagctgcaag tttgtcatat     25020
     gttcaagcca tcttatcaaa tccattcact caaaagagaa aggagaaaca atatggctat     25080
     aaacaaagca gtcagtatag acaccgcatt tcaaacgatc atgcaggaac ttcgggaaag     25140
     gtcagcccgc tttttgggaa caaaacaggc cgtatcagaa gaaaaggctg aatttgattg     25200
     tccttattgt aaggatcgtg gaattgtcgt ttatcgagtc cataaggaca cttcttggca     25260
     tttagatgaa cagttagacc ttatggttcc ggacgatatg gtgtcggaag atgattttct     25320
     gttaggtaag gtttgtacgc cggataaagc tagcgaatgg aaagatactt attcaaaaca     25380
     gtgtgaatgt gtaagacgaa agaaaattgc cagactcatg gcagctagtg gcattacaga     25440
     agagtttgaa aagcttctct ttggtaactt cataacggac ggtaagccag acatgatcaa     25500
     ggacgcttat gagtgtgcag tggaatacta taaagatttt caaaagatca aaggagaaag     25560
     gcaaaacagt atcgcattac ttggacagcc aggtagcggt aaaactcatt tgctcacggc     25620
     gattatgaat aatctgatca agaaaaaatc agtacactgc atgtatttcc cttatgtaga     25680
     gggcatgggt gatttgaaag ctaactttga taacttagaa gcaaaactcg atgccatgag     25740
     aaaggtcgaa gttctattca ttgatgattt atttaaacca ataaacggtc aaccaagggc     25800
     aacagactgg caggttgaac aaatccagtc agtcttgaac taccggtatt taaatcacaa     25860
     acctttgctg atttcttcgg agttaacaat cgatgagatt ttggatatag acgaggctct     25920
     tggttcacga attcaccaga tgtgccgtga ttacatagtg attattagag gcgatcgaat     25980
     gcaattaaat cataggttag gtgattggga atgaaaaaga aaacgaatat aaaagcaact     26040
     ggtggacttt atatatttgg cccttcaaat cgaaatgaag gtaaagatct tacaccaaca     26100
     atccgtttac ttgaggaaaa aataaagcaa atggagcgga tgctgagtgc ttaaagcagt     26160
     cgtgtctctg ctgataattt tactttctgc accgagaata gaaaaagaaa ttaagttatg     26220
     ggaacagctt gacgggaggt aaagaacagt tggattgcat taagttcact gtttatggtg     26280
     agccagtcgc acaaggaagg ccgcgtggat caatacgaaa tgggaaggtg catatgcgtg     26340
     atccagcgaa atcaaagtat ttcaaacagt atgtggcatt ggttgcgtct cagcatcgac     26400
     cagaaacaat tattactggt cctgtctcaa tggatgtcaa agtgtacaga ccaatgccta     26460
     agtcagtttc aaactcaaaa aagaagaaag agaaagctga aaagggcctt ctgcggccga     26520
     ctacaaagcc cgacgttgat aattatgtaa agggcgtgaa agatgctttg aatcatctga     26580
     tatacaaaga tgatagtcag gttgtggatt tgaaagtcag taagttttat agcgaagagc     26640
     caagggtgga agtcatgata agagaggttt ctgcctaaaa ataaaaaaca ccgaagcgct     26700
     tagcctcagt gttcttgata tgaactggta cttctatcat aacatagggg gcgctttgag     26760
     tgtacaatcc aagagaaata aacatcaaaa aagacttcac tattcagcag aaaattgacc     26820
     caggaaaagt tcagatcatt gttttagatg ggaatcaggg aactgcacat gttttagatg     26880
     ctccggagca cggcaaaaca gtgattcaaa ctgtaaaggg cagctttgca agggttgatc     26940
     atgagatagg gtttaaggtg aaatgagaag aagatataat actttataaa aaggtaaaca     27000
     agaaggagga tatctcctcc ttcggcttgg atgtgcaggt tattcctgtt caggtaaatt     27060
     gtcagctaat gtttctaata attgttgagg ctcttctaaa ttcttttggg gttcaggaaa     27120
     ggcttcaact gtttcagaag gtgcatctaa agatgggtgg aattgggtac cttcatggag     27180
     taattctgca aagattttaa ccgattgttt tatatgtcct attgattctg ttgaataatt     27240
     tgctccttca gtaacatttt ttatttcggc atctgttatt gtgtcaatac ccttttcaat     27300
     tccatctagc aaagctttgg aagtttcgac ttgtagcttt aattgctcat tttgaagagc     27360
     tagcttttcg atgtttgcct tagtaatgag taattcttga gatcgctttg aaatgtttat     27420
     agctgcatct ataagttgtc caacaaatat tactgcagct gaactgttta ctaagatgtc     27480
     aatccacatt gaacctgtgt caaaaccctg taatttataa tgtccattaa tttcctcaag     27540
     ggtaatacca ttctgaaatg cattatttaa ttttttgatg aatttttcta gttcttctaa     27600
     tgagttgtat tgagggagtt ttacgctaat tacgttctca ttttgatcag aaactgactg     27660
     atcaattaaa attccaaaac cacgtaattt ttcttttaca atttttatat gattagtaat     27720
     ttgattagcg atgtgattat ccacttcaat cttatcttca ggtacacgtg aataatatat     27780
     acttcctaga tctttaaatc tctcaatatc atcatctaaa aaaccaagtt tagacaactc     27840
     gttaattgca tctaaagact tttgtaaatt aagaacagtc tttctgttgc tgtgcggtac     27900
     gtgcgaaaca ctaactccaa tttgtttatt ataattgtcg agtaaatttt ttatttctct     27960
     aactctcata taacaacctc cactacttta taataaaatt ttaccatatt taaggaggga     28020
     gttgaatttt tttccttagg taatgtgaat tcattaaagc ataaaatatc cagttagtcc     28080
     aagacggaaa gcctgcggac actgaactta cagtattacg ctgtatgttt ggtgtccgtt     28140
     tttattttga aaaggaggat actttcatga atcgaaaaga aattgaaaat ctaatcaata     28200
     gctatcactg gatggtgaaa gaggttcgtc gattgcaaag ggtactctat ggttcagtaa     28260
     ttcccatgaa gaattggggt gttgctcaat atggattaga agctactatg ccaaaaggaa     28320
     gtcctgggaa gagtcaggct gagctaaggc aaatggatat gagagaggaa cgtcttttca     28380
     aacgtcttaa gtattatgaa gagcgagtat atgcagttga attaggggct gaaaagatcc     28440
     atggtgagca gcataaagtc atttatgatt gcatgatgga gggtatgagc taccgcgcaa     28500
     taagtcttca ccttggcatt tcaagggaaa ctgtacgcaa aatgaaagat gagttcatca     28560
     gccaattatg ccaagattgc cactttgagc gtttgttgaa tctgaaaaaa tctgtagtgt     28620
     aaaatgggag gcaggtcggc gcggcgaatt attcctgcgt caccactaaa tttaggtttt     28680
     atacaacagt ttcgttcgac aaattttgcg aatagtacct gtatcgctct cttttgccga     28740
     taattagtaa aaggagggga tgaaattgat tcaaatagat tttggtacag tcattactag     28800
     tgctataaca gcagtttttt ttacaggtgg aactaattat gttttacaaa agaagaatag     28860
     aaaaggaaat gaaattttca caaaaggcta tatactaatt gatgagattt ataatattaa     28920
     caataaaaga attgaaaccg ctgctgcctt tgtaccgttc tataatcacc cagaaggata     28980
     cttagaaaaa ttacatactg attattttaa agagctatcg gcatttgaac tgattgttaa     29040
     gaaattttca atactctttg ataaagaact gaatatcaag ttacaggaat atataaatta     29100
     tttaagagaa gttgaagtgg cattaagagg ttttatgaac gatgatccaa taattgaggt     29160
     gaacttcaat caagaatata ttgagcggtt gattgatgaa ataactaatt taataaaaaa     29220
     acatatttaa gcttcttttg aggagctttt ttattttcaa aacaactcaa tctaaaagga     29280
     ggcggcagtg aatgtagatg gttgataagc acatacaggc gtataaggat tacgccaaag     29340
     gtatgaaata caaggacctt gccgagaaat atggggtatc tgtgaacacc attaaatcgt     29400
     ggaaacaacg ccatggttgg caaagaaaaa agggtgcacc cttaaaaaaa ggtgtgcaca     29460
     caaaaaaagt aggtgcacca ctcggtaaca agaatgcgtt aggtaataat ggcggcgcac     29520
     ctaagggaaa tcaaaacgct gtgactcatg gattcttctc taagttcctg ccagaagaaa     29580
     cgctatccat catggaaggg attcaagaac gttcgcctgt cgatatgata tgggatcaga     29640
     tacagatcca atatgccgca ataataaggg cgcaaaagat catgttcgtt tctgataagc     29700
     aggaaatgat taaagaactg aaaaagaaaa agtctgtgct atctgagaca aacgaagtcg     29760
     aagaggaaga attcgaattt caattttctt gggatcgtca tgcaacgttc ttgaacgctc     29820
     aatctcgtgc aatggcagag ctcaggaatt taattaaaca gtttgatgaa ttagcccatt     29880
     cggaagacga acgacgcctt aaattggagc atatgcgctt aaatatcaac aagaaaaaaa     29940
     tagagatcga agaacttaca gaagaagata aaccttttga gatcaccatt gtaaacaaag     30000
     gtgatgacag tgattaaaca ggtaaatcca cattttaaag aatttctctt tgactggaat     30060
     caaaagtttc agtttcttgt gggtggttat ggatcatcca aaagctatca tgtggcgctc     30120
     aagattgtcc tgaaattgct cagagaaaag cgtactgcac ttgttatcag agaagtgtac     30180
     gacacacata gggactcaac attttcactt tttgatgaac ttgtaagtga tctaaaatta     30240
     gatcatatcg ttagatgtgt atcttctccg atgcagattc gattttcaaa tggcagcaga     30300
     atcatcttta aagggatgga taagccagcc aaactgaaat caatcaataa tatttccctc     30360
     atttggattg aggaatgctc tgaagtaaaa tatgaggggt tcaaggagct tcttggacgt     30420
     cttcgtcacc cgacattgcc gcttcacatg atactttcaa caaatccagt tggagaggac     30480
     aattggactt ttaagcattt cttcaaggat gatagggaga agcgctttgt actggatgat     30540
     aaggaacttt atgaaaagcg gataatcgtt agcaacgaca cctattatca tcactcaacg     30600
     gcagatgata atcttttcct gccagaaagc tatgtccagc aacttgaaga attgaaggaa     30660
     tacgatccag acctttaccg aattgcgcgg aaaggtcatt ttggcgtgaa tggaattcgg     30720
     gttctgccgc agtttgaaga gcgaccgcat gaagaggtta tgactgcaat ctctaatatt     30780
     aaccgcccgc ttaaacgggt tggcatggac tttggttttg tggaatcgta taacgccgtc     30840
     gttagggttg ctgtggatca tgaaaagaaa tatctctata tctactggga gtattacaaa     30900
     aatggattaa cggatgataa gacagccgaa gaacttaagg aatttgcaga gactaaggaa     30960
     ttaatcaagg cggattcagc agagccaaag acaatccgtt attttcagca acacggtttc     31020
     aatatggtgg gtgcccgtaa atatcaagga tcacgccttc agtatacaaa gaaaatcaag     31080
     cggttcagga agatcatttg ctctgatcgt tgcgagaaca cgatttatga gcttaagccg     31140
     cttgcttatg ctaccgataa gctggggaac atcatagaag acgagttcac catagacccg     31200
     catacactgt cagctatctg gtacgctctc gatgattatg aggtaaccga tttgaaagaa     31260
     gaatcaaaag gaagaccgca aagatcaaga ccaggaagga ggtaaagcat gtcaaaaaaa     31320
     tctgttaaag cacgagtgat caaagcctct ccacctactg aatcaacgaa acaaatttat     31380
     gaagatgaat ttgctgacag ctatgacagc aatattttgc ctcctccgta taacctaaag     31440
     gaattaaaaa tgattgctga gtattcaaca atcttacagc aatgtgttga tgcctacagg     31500
     acaaatattg tgggctttgg atttgatttc gagtattctt ttgatgtgaa ttcgccagat     31560
     gtgacaaatg aagaaaaaac agaagctgaa agtgaatgga caaagcttga agagttcgtt     31620
     aaatatcttc actttgatga gtcagctgag actttactcg gatttgttat tgaagataga     31680
     gaaaagacgg gcaatggctt tattgaggtc attcgaaacg gtgaaaataa gccagccggc     31740
     attgaataca tggacgttca aaatgtacga gtttgcaaac tgtctgaacc aatcgaagtt     31800
     gattttacgt acttcgaaca aggacaaatg aaatcaatca aaagagagaa acgattccga     31860
     aagtatgttc agatgattga cggccgtatg gtttatttta aagaatatgg tgatcctcgc     31920
     actttaaatt tagagacagg tcaatatgat gaacagaccc cattggagaa acgagcaaat     31980
     gaagtggtcc atttcaaaat aggaagcggt atttatggga aaccgcgatg gattggccat     32040
     attgttaatt tgtatggtgc tcgtaaagct gaagagctga actttatgta cttcaaacaa     32100
     ggaagacata ttcccgctgc catcacaata gaaaatggaa tgttgtctga ggactcatac     32160
     acacaattgc aggattacat gaatgggctt gaaggagtgg agaacgctca taagtttcta     32220
     ttacttgaag cagaagggat agcgaagggg aaaaacattc atggtgatga agagattgca     32280
     ccagtgaaag ttgatattaa gtcacttgct gaaatccttc aagaagatgc tttgtttctt     32340
     gaatatgacc aaaagaaccg agataaaatt agatcggctt ttcgtttgcc cccactttat     32400
     acaggtgaag ctcaagatta caacagagcg acagctgaca cagcaagaaa gattactgag     32460
     gaacaagtat ttcagcctga acgaaaatta atcacaggta aactgaatgc tttatttcta     32520
     aatgatcttg aaattcataa agtccgactc caactaaaag ggccagactt tagagatcct     32580
     ttagaaattg ctaaggttct aacaccgttt ataacagcag gtgcagtttc tccgaatgat     32640
     ttacgcgatt tggctggacg ggtacttggt aagacgcttg aagaatggcc agaagaagaa     32700
     tacaacaggc cgcttggtaa aactaacgag tcgtccgttt ccgatccttt ggctgcactg     32760
     tttaaatcta agaacggtac tcctaatatg atcgggttat taaaagatat gcgggatgtt     32820
     ctggaggatt tgaagagatg aacaaaacgg ataagctatt ggagagttta aatgtcttta     32880
     ttcaaaaagc cgaggaaaat cagtataagc aattggggga gatggtacct gactttcctg     32940
     gcaaatctaa tatccccaaa tatgtggagg aatatgaaaa aggcattgcc agattgctca     33000
     gacgccagca taagaagttt ttagatggtc tcaaaggttt tgtaagcaaa gactcagaag     33060
     agacgttaaa agcccttcta gtgtttttta ctcagaacct attcgcggag gatgacttcg     33120
     aggaagaatt tcaggaactg actgagggat tcctgcaaca gactattgaa gaaatggctg     33180
     aagtaatcat ggattcaata gatccagagg tgccttttaa agtcttatcc aatcgtacga     33240
     ttaattggat taaggattgg tcaaagaagc tggctgagat catgaagtta aacacacatg     33300
     aagtggtgga ggacgtgcta actaatgcta tcgagaacgg ttcatcaatc caggacattg     33360
     agttgactct caaagacatg ccacaatttg atagggagcg ggcgcgtacc acagccatca     33420
     cagaagtgct tgccgcttcc tctgccgcgc agcatgaatc atatgcacaa tcgccggcag     33480
     taaagaaaaa gaaatggcgg cacagcggag ggaagaagaa caatcctcgt gaaaatcaca     33540
     ttgatcttga cggtacagtc attggagtag atgaagaatt tcagataccg ggcagtagcg     33600
     aaacctgcat gtttccgagg gatcctaaac tatcaacaag ggagcgggtt aactgccatt     33660
     gtgttctatc gcctgtggta gatagtaaga ttttaggctt atcacccgaa gaaaaagaag     33720
     agattcaaag agaagtctta gcaaacatgg aataaaatag tataatgtcc tcattacata     33780
     ttaggtgggg aaaatatgaa ttggatggag tttatctctt caatagtcaa atcaatcatt     33840
     tggccggtag caataattat cttggttttt aaattaaaac aaccggtttc aaatttgatc     33900
     agtaccttgg cgaaaattaa atataaggat tgggaatttg aattcactat tgaccaaaaa     33960
     ttagataaga ttagtttcca attgaataaa gagaatcaat atggaactga tgatcaaaat     34020
     ctaaaagatt cattaaattt agaaagtaat tctgaaatca ctgaggaaac acattcccat     34080
     tataatgaga agacaagcat taaaggggat aatgacttac tactaaaaat ggaaatgatt     34140
     cgtttatatg gagcagtgaa aaatctttat gaaaaagtat cagaaaaaga tgatgcggca     34200
     gataaatctc aaggtatagg catgttatac atggttgatt atttgaaacg ccataaaatt     34260
     cttaatgatt catttgcgga aagcttactt gatataatga atatagttca tgacttagag     34320
     aaaagtcata tttcacaaag ctacattatg aataaatttt tctggaatgt agataagagt     34380
     gtaaaaaggt taatggagat aacaagcaat tatgttgctg agaatacagc tggtgagact     34440
     tctaattaga agtcttttct tattttaagg aggtgaataa catgccaaga gaattggtga     34500
     acgcaaaaat cacacatgtt tcttatgtgg ataaggctgc taatcaaaag cagttcttta     34560
     ttgtgaaatc agaaaaacaa cctgattttc aaaaggaagt cagaatcctt gcgaaagagg     34620
     cagacgagca aaaacttgtt tacggtatcg tgtatgaccc tgatacagtg gacgcccacg     34680
     gagatttcat gacagctgca gaaatcgaaa aggccgctca tggattcctg aaagatgctc     34740
     gtcaaatcga caagcaacat gactttcagg gtggtgttgg tgaggtggtt gagtcctatg     34800
     tcgcaccggc agactttgaa atgaatgggg aaaccattaa aaagggatca tgggtccttg     34860
     tcacaaaggc ttctgaggaa gtatgggagc aaatcaaaaa aggcgaaatt accggttatt     34920
     caatggcagg aactgctgag acgattgaaa aacaagaaaa gcccgtttct caagagaaaa     34980
     cagatgagaa agggctattt aatttgctca aaaacttttt tgttggaaaa caacagcaat     35040
     catatgaaga gccagttgca aaggcgggca gaaaattttc cgcttcaaac ctgcaagaaa     35100
     ttaagaatgc tcatgctgcc cttggtaatt tactgagtca ggtagaaaca aaagaggggg     35160
     aagaagaaat gacttcggag gaagtaacta aatccattca agaagcatta gagccaatta     35220
     agaagcggct cgagacatta gaaaaagagg aagagcttaa taagaaagat aaagaaaaag     35280
     aagaagagac tgaaaaagag ggcgagaagt tgaaaaaggc aatttcagaa gctgttcaac     35340
     cgctcgctga tcgtattgaa gcaatcgaaa aaagtcgcgg aacatctaag caaactgaag     35400
     aatcgggttc cgaacaagtt caaaaatcaa tctggtcagg gttgttttaa tggataagga     35460
     ggatacgaat gagaaatcaa gaggttatta ataaagcaga aatgacgctt tctactttag     35520
     agagcggcgg gattatgaat cctactcagg cttcaacttt tattcgaatg gtacaagata     35580
     cgccaaccat tttaagagat gcgcgagtta ttcaaatgga ccatgacaca cagaaaatcg     35640
     agaagatcgg ttttggtcag cgtattttaa gggcagccca agagggagtt gcgctaacta     35700
     aagatcaaaa gtcagttcca tcaactagca cagttaactt aagcacaaaa gaagtaattg     35760
     ctgaagttaa cattacctat gacacacttg aaaacaacat cgaaaaagat ggccttcaga     35820
     atacaatcat gcaaatgata gctgaccgtg ctgcggttga tattgaagag ttgcttgtaa     35880
     atggggatac atcttcctcc gactcatatc ttgcacaatt agatggcatc agaaaacaag     35940
     ctacatctca tattgtcgat gctgcaggtg aggaactgac acgtcaaaca tttaaacgag     36000
     gatacaaagc tgtacctcct aaatatttgc gaattccgca ggagttccgt ttctatacat     36060
     cgcctggtat tgaggtcgaa tggaaagatc gtgtagctga tcgtcaaaca aatttagggg     36120
     atgcagctgt tcaaggtggc ctttcatctg cttttggtgt tccaatcaaa ggtattgcaa     36180
     atttacagcc ttatacgatt ggagagggag atactgcagc cgatgtttct gatatcatcc     36240
     taactcatcc gaagaatatt attctcggat tctctcgtaa cattcggatt gaagtagata     36300
     aggacatccg tcgccgtatg tttatcattg ttttgacagc gaaattggat agtgtttttg     36360
     aagaagagga cgccgtagcc aagatcgtga aagtgaagga gtaggtggtc tggtgtgttt     36420
     actgcaaagc ttattaaagg caaaacatac aatgtgatgg gaataacctt tcgagcaggt     36480
     gtcagtcaaa cagtaccgaa aaagctctat gagtatttaa atgaaaatcc atattttata     36540
     ctaacccaag agcttaataa tcaaaaggat gatccgataa attatactga atcggaattg     36600
     aaaggtatga ataaagcaga gcatgaatcc attatttcta atcttggtcg caatccgtct     36660
     gacttcaaaa acgcagatga aagaattgcc tacatcctta agcaaataga taacaaaggg     36720
     gagtgaccta tgctgttaat cactcccgat gaattaaaga gttattcagt ttttgagtct     36780
     gtaaagacca gacctgacga gttgttaaaa caggatatcc ttgaggcaac tgccgatatc     36840
     attcttaaag ttggacatga tttttcagat gcagagtata tccctttgcc tgaaacggtt     36900
     cgactggctc tattaaagtt gtctcagttt tatgctctta taaatggcga cgagtcaatt     36960
     attaaaggat atacaactga aaaaattggt gactattctt atactctagg ggatggcagt     37020
     cctcttcaaa aacctgatgt gtatgcatta ataaaagatt atgtgaaacc ggctgaccct     37080
     gatttagaag ggattgaagc gaaagtgcgg atgagatcaa tatgagttat caatccttat     37140
     tgactcacag atgtgacatt taccatctgc aggagaaaaa agaaaataga aagcaaaaat     37200
     tcggggtgcc ggttgaagat gttcaaccgg ttttttcgta ccctgatgag ccggacatag     37260
     aaaatcagcc gtgttatttt acagagaaga gtcagtccat tatccaacag gagtcaaatg     37320
     tatctattta tcaatctttc cttgtgcatt tccctgctac tgctgatatt cgagtaaatg     37380
     acagggcggt ttgggatggt actgcttata aattacagaa gccccgcaaa atcaggaatc     37440
     atcattggga agtgacggca gtacgggagg ttgaatactt atgaaaattc ggggtctcga     37500
     tcagttcata caatcattag accgggcttc tcgtggggga ctgaagagga aatatgagca     37560
     gtggcttgaa tcaatgggtt ttgagttctt agatatcatc caagatgaga tcattaggac     37620
     gaagaccgtg gacactcgcc gcttgctcaa ttcctttcag aaaggtgacc aggataatat     37680
     cttttcaatg acagaaggca gcttaaagtt ggatgttgga acaaatctgg attacgcctc     37740
     atacgtcaat gacgggcact ttactatcga tccgtctaaa aatcaggata gacgatgggt     37800
     tccaggtcgg tggaaaggcg accgtttcga atatgaccct gctgaaaaaa attccggcat     37860
     gctgctgaag ttccgatggg tagacggttc ggggttttgg gataacgcca tggccatttt     37920
     tcagttgatg tttgagagaa gccttgagcg gaagctgcag caatggattt atgaagaatt     37980
     ttaaggcggt gctgccatga atcaagaagt aggttcaatt atgggctatc tatacaaact     38040
     gtatcctgtt caagtgtatg aagaagaaat accgcaggac ttttctgttc cgtctcttta     38100
     ctttccaccg gcttccacgg tcgatggggt ggacacagta tccacgtttc agaaagcata     38160
     tgttttaaac gtaaaactct ttcacgaaaa cgtacagaag gctcataacg aagcggaacg     38220
     aattgcggat acacttagaa gcagaagagg cataattccg cttatacaag attctggcga     38280
     ggatactggg gattttattc gcctatctcg aatagaaacg cgggtatcag acgattatgc     38340
     gaccattgtc ttaaactgga cgagccgcta ttggtatgag cgggaagatc agcgttcaat     38400
     agatggtttt aaatttaaaa gtggggtgaa atgatggcca ctaaaaaaga gaaagcagaa     38460
     aatgcttttt atattaagga tttgcgagag cacagtcgag agctctttgg ggtaaaaccc     38520
     gaggtgtttg acggtgctct ttttcatgtt cataaaatga gtattacaaa atcggaagcg     38580
     aagaagttga tttctcagtt tcttcaaaag gaggtcaaat agatgaacgg cggaactttc     38640
     acacctggca aggaaaaaga gcgtgccggt atttacttta acttcaaaac gaccgcggag     38700
     aaccgtgttt ctgccggaga acgtggaaca gtggcgctgc cgatagcgtc cagctggggt     38760
     gaggttaaga aattcatttc tatctcttca atcgaggact tgaataaaaa agtggggttg     38820
     aacattgatg atccttcgct gttgctttta cgtgaggcga tgaagaaggc gaatacagtc     38880
     ttgctttatc gcctaacgga aggtcttcgt gcttcagcag acattagcga aggtgtaaag     38940
     gctactgctc tttatggcgg cactaaaggt aatgacatca ttattagtat tacggagaac     39000
     gttattgact cttcgaaagt tgatgtcact acctaccttg atcaatctga agtggataaa     39060
     caaacagtgt ctaaagctga agaacttaaa ccgaataaat atgtcacgtt tacggggaaa     39120
     ggagatttaa cagttactat tccgttaacc ggtacggccc ctgaagatgt tagcggtgct     39180
     ctccctgcaa cttccggaat ccgcttgtca ggcggaacag acaaaacacc gacaaatgcc     39240
     gattatacag ctttcttgga agcggctgaa acggaatact ttgacacaat cgctttacct     39300
     gtagaggata acgagcaatt aaaagcaacg tttgttgcgt ttatcaaacg gctgagagac     39360
     aaccaagggc aaaaggttca aggtgttctt tcaaattaca agggagacca tgagggtatt     39420
     atcaatgtaa caggtggtgt cctacttgag gatggaacgg agatcactcc tgaaaaagct     39480
     acagcttggg ttgccggtgc aagtgcgggg ctacatttaa tcaatcactt acatttgtag     39540
     aatacgaggg agctgtagat gtccttaacc gaattgacaa cgacgaaatc gttgaacgat     39600
     tgtcaaatgg ggaattcttg tttacttatg attctcgtga taaatcagta tcggttgaaa     39660
     aggacattaa ttcactcaca agcctaacag cagagaaaaa taagatgttc cagaaaaaca     39720
     aaattgtccg tgtacttgat gcaatcaata atgacctgac atcacaattg aaagcattga     39780
     tcaagtctcg aaaagcgagc ggcagtgatg ttcccgctac aaatgacgga ctgcagtttg     39840
     taaaaacgct aattactcaa tacttgagtg ttcttcaaga taacgagggc attactgatt     39900
     ttgattcaga gaatgacatt acaattgctc tgaataatga tcgtgacggc ttcctgattg     39960
     atcttgcagt tcaaccggtg gatgcagctg aaaaattcta ctttaatgtt gaggtgaaat     40020
     aggaatggca ttaaaagcgc aaaacaccat ttcaggtaaa gagggcaggt tgtttcttga     40080
     tggagaagaa atggcccata tcaaaacgtt tgaagccaat gtagagaaaa acaaatccga     40140
     ggtcaatatc atgggtcgtc ggatgacggg gcacaaaacg accggagcaa atggaacggg     40200
     aacagccact ttttataaag tgacttctca atttgttctt attatgatgg actatgtgaa     40260
     aaagggaagt gatccttatt tcaccttaca agctgttcta gatgacgcct cttcaggtcg     40320
     tgggactgaa cgagtcacct tgtacgatgt gaactttgat tctccgaaaa tcgctgggct     40380
     tgatgttgat tctgaagcat tggaagaaga agtgccgttt acctttgagg attttgatgt     40440
     gcctgaacag ttaaaatcca cattctaatc actttcacga aaaatcgccg actttaacga     40500
     agatatttac gaaaaaatgt ggtaagatta ctttagaagt aattcaaccg taccaaatgg     40560
     aaacatgtat ttctttcaaa agaaatgcat aaaataaaag agacccggtt gccgccgggt     40620
     cagtataaat gttggcccat caagagggct ggcttaacaa cttcatgaaa gtatttagga     40680
     tagactttac ccttttactt tgccgagctc aaggggtggg tctatttctt ctttatataa     40740
     gtcaacaggg caattataaa tgacccgaaa gcaagcataa gcattaatgc ttgaaatgtt     40800
     gacacgtgca tcaccccctt tcatgaggga gtgagccaga ccgcccttga gatgttgaaa     40860
     gccaatattc atttatacta aaccatattg taccataaca ctttcataat ccgagggttt     40920
     ttaataaaag aaaaagggtt aaggcttcta tgatcaggtc attttgaact catagataaa     40980
     aaaagtaaca aataaaagat acaaataatt atataatcaa tatatattca tgttataatg     41040
     gtgccaagca aaagtattgc aactactggc gtaagcttat agttggtacc acattaccac     41100
     attaccactt gttaatgtgt gttactttca tgagaaatgc taaaatataa aagccagagt     41160
     gtggcagcac tctagctttt aaaaaagaaa ctacccttta ataggagggt cctcgtgtag     41220
     acacttttcc tttacagtaa tgtaaatagg atgagtgtct ttttttctaa gcatgaataa     41280
     taatgttaaa agagatatta cccatgtcat aatcccgcct attaaattgg caaagccgat     41340
     catgaccatt agagattcat aggtcgacat aatttcacct cctttcatat tcggaggata     41400
     agctaaggta gcttcaagaa tctattatac atgaattata tggaaagcac attcaaaaag     41460
     tatgaatgtg ctttttttct tgtccaaaac taaaaagtaa aaggagttaa taaacatgag     41520
     tgaaaaccaa aacgaaaaag tatacgatct ttcattcttt atgccaggac aaacaattga     41580
     cgcggaagag gtagaagtcc cgatttctaa acggtttgta gacaaagaag gcaatgttgt     41640
     tccattcatt ttcaaagcaa ttacgactga ccgaattgac gaacttgaga aagagaacac     41700
     cacttacaaa aatgtaaaag gccgcggccg tgtgaaggag ttggacagcc aacgctttta     41760
     tgctcgtatt gcggttgaaa cgactgttta tccgaccttt aaagctaagg aactacgtga     41820
     ggcttacaaa acagaagatc cagtggaagt cgccaaacgt gttctttcag tcggcggtga     41880
     atatgcaaat tggctgaaca aagcaattga aatcaacggt tttgatgatg atctcgaaga     41940
     ccttgaagaa gcagcaaaaa actagtaaaa gacggggaca aagaggctgt atacctttac     42000
     tatgctatgc atgagctcaa atacgccccg tcagaattaa gagaactata tgaggctccg     42060
     aaagcattca aggcgctctt atatggatta atcggtttta agcttgagct gttagaaaaa     42120
     gaagcgaaga agggaggtaa ttaactatgg ctaaactaac agccacgttt gaattacatg     42180
     ataagatttc ccgcaagctt cgaatgatac aaggcaatgc tgaaagactt aagagggctg     42240
     ctaatggccc tcttattttt gaggctgaag accggactga aagagttatg cggcaaattg     42300
     atcgatcagc caaccgtttg acggctcggg ctcgattgct tgaaatgggt ttagatgatc     42360
     gagtttcgaa tggcttacat tctatacgcc agcaagcaga ggatcttacc gaaggcagtc     42420
     atgaggtgac ggtttccgta aatgatcaag ctacaccacg ttttcgtttg atccgtggag     42480
     gtctcactga tttgaatagc tcgcacgctg agccaactgt ttcagtacgt gatcatgctt     42540
     ctaaccaatt agatgagatc cgtcgtcatg tgactgatgt agatagcgaa catgcagagc     42600
     caactgtttc tattaaggat agagcttcag cggctctgga tgctattgaa gcgaaaatag     42660
     acagcttgaa gggtgctacc attactctgg cagttgcagg tggttttcct gcaggttcaa     42720
     ttatgggttc tggtaaaagc acaatgtctc aggatgctta tgtgtcagca acttcaaacg     42780
     ttaataagaa agatgttgca aaaatgacgg atcagatcta tttcaacaat aaagcgggca     42840
     gttctcggga agaagtcagt ttatctctaa gaaacttatc gcaacagaca ggggcgtcta     42900
     aaaaagctct ggctgaattg actgagtcat caagtaagat tgcccagctt atgaatgctg     42960
     atcaggcaga ggtagatcgt gctttcagtt caatgtataa caacttgaaa ttgtctggga     43020
     aacaaagcgg agacttaatt gcttatgtat accggaatgc cggtgaccag gctgatgatt     43080
     tattagacac gatgaatgaa tacagttcca cctttaaaga cttgaagctc acaggcggcc     43140
     aaattgcaaa cgcaatgata aaaggaacaa agggtggagc cagaaacttc gataacctag     43200
     ccgatagtat gcgtgagttt aacatccgcc gaaccgaaat gtctgatagt caagtggacg     43260
     catttaaaac actgttcgga gccaaggaaa ctaagaaaat gttcaagggc ttcaaagatg     43320
     gttcaataag cggagaggaa agtttattta gggtggcaaa agccctttct aaagtgaaag     43380
     acaaaacaaa gcgggctgct attgcgactg agcttatcgg gacacaatat gaagacctta     43440
     agcagcctat tttagatatg gctgagggta ttggtacaag tgccaaaaca agcggtgaat     43500
     tggaacgaag ctttacgaaa cttcgggata ataacccgat gacaccggtt aatgatgcca     43560
     tgagagattt tgaaagcata tctaaggata tgggaacctc tctgctaact ggattaggac     43620
     cggcctttga taaaatcagc tcgttcatta acagtaaaga aggtcaggaa aaacttaaag     43680
     agatcaaaaa agatattgct gatctaggtg aggagatagg tgataagtta aacgtagcca     43740
     ttgagtggag cgtcaaccat tgggatgatt tgaaaacagc gattaaagtt gtgatcccct     43800
     ctttaattgg attgattggt tatttgaaaa tacttcgtcc gctgttaaaa ggcataggta     43860
     ctgtcggaag tgatgcagca ggcgtaatcc gaaaattaat tccaaaacgt actcctaaag     43920
     ctggtactaa tacgcaaagt gaaaggagga atagaaacag taatcgtaat gctagcacaa     43980
     ggggcagaga atccaaaact gccacaggtc caacgagttt acctcgaagc ggcagcttga     44040
     catattgctg ttgtagcgat ggaggtaaaa atgatcgcat tcgtagaaga cgagggaaaa     44100
     gagttttagg tcgacgcggt aatccaaacc gaatgaaccc ttctgatagt tcaattgctg     44160
     tgtcatctga acggttggag agaaggcgtt ccggtagaac tgtaggtact aatccaacta     44220
     gagattcaag atcagcaata atcactacga gatcggagct atactcagct ggtagagctg     44280
     caggcggtac atcgaagttc gggaaagtct taagtcctct gaaaagtgtt ggcaagtttg     44340
     caaagggagt ccctctatta ggaacagcgt tagcggcaac cgatttaatt gggatgaata     44400
     aagataatgt tggtgaaaaa attggatcag ctggcggtgg ccttgctgga gcggctacag     44460
     gagcagctat tggcagtgtt attccaggag tgggaacagc tattggtgga ttagttggtg     44520
     gtatagcagg caccatgggc ggctcaagtt taggtaaagc gtttgatggt tcagaagtaa     44580
     agaagaaact aaacagtaca ttatttgatc aaaaatggtg gtctgaaaaa tggtcaggca     44640
     ttaagagtaa tgcgaagact tccatcaatg ggttaagtga tacatggtct aatgtaaaag     44700
     aaaaggtgaa gtccacttta tttaatagtg aatggtggtc tgaaaagtgg tctggcgtta     44760
     aaagctgggc acaaaacaaa tggaatagtg catcacctgt ttgggagtcc gtaaagggaa     44820
     aaataaaatc cactttgttt agtgagaagt ggtggtcagg taaatgggaa ggcgtaaaaa     44880
     gttgggctca aagtaagtgg gacagcgcgt cttctgtttg gcaatcagtt aaaggaaagc     44940
     tgaaatccac tctatttagc gagaagtggt ggtcaggaaa atgggaaagt gtaaaaagct     45000
     ggtccaaaaa taaatgggac aatgctaaat caatatggaa aagtgttaag agttccatct     45060
     cagaaaccct ttttagtaag aagtggtggt ctgaaaagtg gcagagtgta aaggaattgg     45120
     gaagcagtat tttaggcggg gtaaaagaag ttggtggtaa agtagcttca agtgcgaaaa     45180
     aaactgctgg taaagcgtgg ggatatgtga agagtggcgt aaattattta tttggttcgg     45240
     gaaaagaaaa gccaaagaaa catgctactg gtggttacat tacgaagcca acaatatctt     45300
     ggattggtga agctggtaaa gaattcgtta tccctgttga gaataataaa ggtcgcggca     45360
     aaatgctcct ttctcaagct gcttcgaaat tagggatgag tgtggttgat gatatagcgt     45420
     ctgcttcatc tgcaggaggt gaaccggcaa cttccccgct agtccgtagt gcggcggtga     45480
     ctgcttctgt atctcctatt attgacacat ccagtcttga tgaacaagca acatcatttg     45540
     gtcaacagtt cacgaagagc tttgatcaag gaattagaga taatgttgtt tctatggaag     45600
     catggaaaca gaaaaacgtt ggacaaccaa tgaacaattt aatctcttat tctccgaatt     45660
     acggaaagca agtggtcaat ggttatgcta aaggtcaaaa cagcacttcg accggtacag     45720
     atggcttctt gcagacgaag gttaaaatgc catttcagaa cactgttaat aaatcttcat     45780
     catggggaag cggaacgatc aaaggttttg cttccggaca aaatagctca caaactggta     45840
     ctgatcaata cgtcagcact catattaaca agccgtttat ccgctctaaa gaatcatcaa     45900
     acggatgggg aagcggtatg atcggtaatt ttgtttcagg catgacttct aaggcaagtg     45960
     aagtcaatga ggctgccaag gaactggcga aaaaagttga gaaggcattt cgtgaagagc     46020
     tggatattca ttcaccttcc cgtgtcatga tgagtcttgg gcgttttgcc tctataggta     46080
     ttgtaaaagg tctggattct gttgatgtaa aaaagtttgc tgaaaaacaa gcaggctcac     46140
     tagctgccgc ttattctgga atgggcgcag taagcggaaa tgtgaagcaa tggctcatgg     46200
     ctgctatcat ggctacaaag acaccgatga gctggcttcc agggctgatg acaattgctc     46260
     agcatgagtc aggcggtaat ccgaaggcaa tcaacttatg ggatagtaat gcgaaagcag     46320
     gacatccatc tcaggggctc atgcagacaa tcccaagtac cttcaacgca cacaaattgc     46380
     cgggcatgaa taacattctt aacccgattc acaacgctgc tgctgcgatt ggctatatca     46440
     aaagcagata tggatcaatt aataatgtac caggcattag aagcatgaga catggaggtc     46500
     catatgttgg ctacgctaac ggcggactta ttaccaaaga gcagattgcc cgtgtcggtg     46560
     aaggaaacaa aagggaatgg atcattccgg aggagcgagg catccgtgga cgttatttat     46620
     tagcccaagc agctaaggca ctcggaatgg aagtcacaga cccatctgaa aaaggtcaaa     46680
     ctgaattatc ttcaggtcag gtaacagctg ccacaacggg tcgtaatcaa acaacgttta     46740
     aagctgcagg tggcaaagag gtcattattc agtttaatgg cgatcagcat tttcacaatg     46800
     accaagacat gaacagtctt gtagctaaga ttaagcaggc ccttgtcgat gagcttgaac     46860
     aggatatcaa cattggaacg aagggagtcg ttgcttttga ctaaatccat atatgaattc     46920
     tggatttcac aagggaagga caagctgcgg cttccggtcc ttcctgaaca aattgatata     46980
     tccaacacaa ttcaaaatga atcagtaaaa gtggctagtt ttggggagat cacttttatt     47040
     gataaaccgg gagcgaaaga aatttcgttc tcttcttttt ttccaaagaa acacagcccg     47100
     cttgctgagt ataagggatt tccttctcct gaaaatgcta ttgcaaagat cgagaaatgg     47160
     gtgaaatcta aaaagccggt tcaattctta attactggaa cgaaaattaa tttaacttgc     47220
     agtatcgagg ttttttctta tacagagggc caaaaagata taggtgatcg tgattatgaa     47280
     ataaagctga aggaatacaa aactgcttcg ccgcggaaga tcaagcagaa gaaaaagacg     47340
     aagaagaaac ggccatctaa atcagctcct aaaacataca ccgttaagaa aggcgataca     47400
     ctgtgggacc ttgccggcaa attttatgga gacagtacaa aatggcgcaa gatatggaaa     47460
     gtcaataaaa aggctatgat caaacgaagc aaacggaata taagacagcc aggacactgg     47520
     atctttcctg ggcaaaaatt aaaaataccg cagtaagcag gtgatgacat gatagaactt     47580
     ttcgtcatta aagaaacgga atggcttgag ctggtaactg aaagtgtttc cctcgaaggg     47640
     caacggtatc aggcgccgcg atcgattacg gccaagatca ttacgaaaca gggaacccat     47700
     tcatattaca gcgtatctga aggggataca gttttattta agtggaaggg caaagaactg     47760
     ttccggggca ttgtgttttc tcgcaatccg gaagaacact ggatgacttt tacggcttat     47820
     gatatgctgc aatatttggt caagaacaaa gatgtttatg ttttctcaaa tcaacgtgca     47880
     gacgagatta taaaacggtt ggcgcgagat tttcagattc cgactacatc cattgcaaat     47940
     acaggttaca ccattaaatc attagtgttt aaagatgata cgagccttta tgacatgatt     48000
     ctaaaagcct tgaaacaaac gaaaagccaa accggaagga attatcaatt atattctgcg     48060
     aaggggaagc ttggccttcg cgcttggcca gatctgtcag aagtatgggt gttggagacg     48120
     ggtgtgaaca tcaccggcta tcaatacagc acttcaatta atgacacggc cacaaaagta     48180
     aagctccgcc ggcagaaaga caataaaaca tacacagcca ctgcaagtga cagctcaggg     48240
     atcagtaaat atggtgtgct tcagtatgtc gaaacggttt ctgataacat taaccaggcg     48300
     cagcttcagg agcgtgcgaa agtcaaacag gcacagaaaa aaggtgttaa aaaagaactc     48360
     aagagtattc aagcgattgg cattccggat cttcagagcg ggttgcccat ctatatctca     48420
     attccggaag tcggggttaa gaaaacatac tggatcgata cagacaaaca cgaatttaaa     48480
     ggatcgacac acacgatgac cattgatgtg gttgagaaaa attctatccc tgatggtgtt     48540
     tcctcatgag attaagtgaa gcaatcaaac atttggctgt ccgtgcagtt gattctgagt     48600
     cgccagtgga tattctaccg gctgaagtgg tttccgtttc ccctgttgaa ataaggctta     48660
     atgaaaatga caaattaata atacctgctg atttgattat tgttccaaag cggctgcggg     48720
     ccggtgaaga agcattaaat acaggtgagc gtgtgatgat tgtctcctta aaaggcgggc     48780
     aatcattttt tattctcgac aaaatatagg aggtgtttgg aatggctttg tctccggaaa     48840
     tcgagtttga ggatatagaa gatgacagcg aagtcataga gacctcgcaa acctacaaaa     48900
     tagattttga aaatggccgt atcacaaatg aaatcatcac aggccttgaa gcgatcaagc     48960
     agtttgtata tttgtctctc catactgagc gatacgcata ttctgtttac agtcatgaca     49020
     ttggaaatga acttcaagac gtgctggcag ataacgaaac aacagacgca tataagaaaa     49080
     tggagatccc tcggctgata gaggaagcac tgatctatga cgatcggatt tctgctgtta     49140
     cagattttga aatagaaaaa caaggcgaat cgttccgtgt ctcctttaca gtcgagactg     49200
     acgaaggaac attggagatc gaggaggtgc ttggcgagga tgtttgaaga tcaaacctat     49260
     gaatcgatta tggatcgaat gttgaacagc atttcagcgg acattgataa aagggaaggc     49320
     agcgtgattt ataacgcgtt agctcctgta gccgcagaat tggccaagtc ttatatttgg     49380
     ctcgatactg ttctggaact tgtcttctca gacacggccc aaggggaatt tttagatcga     49440
     cgagctactg aagcaggcat tgagcggact gctgccacaa aagcagtcag ggcaggggag     49500
     tttactgaag gcgtgaccat tcctgtaggg tctcgctttt atgttgataa tctttatttt     49560
     caatacacag ctgacgggac gttggagtgt gaaacagcgg gggaagcagg gaacgcaaac     49620
     atatccggtc agaatctatt gtcattagac actatacctg ggcttcaaaa agcgattgtg     49680
     aaagagattc tgattcctgg acgtgaagaa gaggatgatg acagtttaag agctagatat     49740
     tttacccgcg tgcgtcgaga agctgtcagt gccaataaag cacactataa acaatgggct     49800
     gaagaagtag acggagtggg gaaggtaaag gtctttccgc tttggaacgg ggacggtaca     49860
     gtcaaaattg tcgtgaccaa tgctaacttg gaacctgctt ccgatatttt aatatcaaag     49920
     gtgaaaaact atattgatcc tgaacccgga caaggtgagg gacaagcgcc aataggtgcc     49980
     tttgtcacag tggagagtgc ggtatggaaa gaggttgaga tttcagccga ggtacttccc     50040
     gaggtcaata gctctatcga tcaggtaaag caagaaattg aatcaggtgt tttaaatctt     50100
     tttaaaaaga ttgcctttga agataacgtc atccgtttat cgcagattaa taatatcgtc     50160
     tacaattcac cttcagtaag tgattacgca gatattaaaa tcaacggcgt ggccgaaaat     50220
     ttggttctga gtgccgtcga aatccctaaa ttggggcagg tgaacatcat tgagcaaact     50280
     cgatgaaatg actgcttacc tgccgccgtt ccttaccaag ttaaaggaaa tggctgaact     50340
     tcttaaagcg gaagctccgg aatttgagaa gcaaaataac agcatctttg atctgacaga     50400
     tcagctgttt gttactacgg caacctgggg gcttgaacga tgggaaaaga ttttgaacgt     50460
     accgcgggaa tcaggtgaca ccgatgagat ccgccgattg cgcctaatct ctaaaatgtc     50520
     caatataccg ccggcaacat atagggccat tgaacacgcg ttgaaccggt tcctgaaaaa     50580
     tccgtcagct caggttcggc tgcttcccgg agagtaccgt tttaaggttg atattgatat     50640
     agatgatatg cagcatatga gcgagctcat agaaacattg gagaatatga agccagctca     50700
     tttggcatat accttgcgag ctgctttgaa tgagccactc caaataaaag atactgtcat     50760
     tttgaattac agaaggtatc gaaaagcaag tgagctaaag gtaggttatt ccgtcacgct     50820
     caataataac gaggtggtcc ttgtatgatt acacagcttt atagagagcg tacagctgca     50880
     gatttgaaaa atagaatatc gaaagtgctg ctgaatggaa atgaaacaga aattgtggaa     50940
     ctcaccattc agggtgccgt tgtcacggtg cttactcaac gagaggaaga catcaaacat     51000
     attaagagtg ttcagatact tgatgatcaa aacaacgtga ttacggaaag aacaacagat     51060
     ttagacgtta gtaataatag aacgctagat tttaggatta cttttgaggt ggtttaacaa     51120
     tggcttatga tgcaaaaaca gattggctcc cggacgatcc gattaatgaa gatgatgtga     51180
     accgttggga gaaaggcatt caagatgcgc ataaagattt agctgtacat aaaaatgaca     51240
     tgaacaaccc tcacaataca acaaaggcgc aaatcgggct agggaacgtt gataatgtac     51300
     agcaagcttc gaaaaaagaa tttgaagagc atcgtaatga tttacaacgg cacattacac     51360
     cagtggaacg ggagaattgg aatgcaaaag aaacaattgt cggagctcag gaaaaagcgg     51420
     ataaggcttt atcggatgca aaatattacg tggataccaa ctataaaaat aacaatctga     51480
     cgttaattac tggagacaat gctattcaag atgcaagacc aggaggggaa gaatatcctt     51540
     taggactgac cttaatggac attgggcagg gaaatactac aggctacccc ttgggttatg     51600
     gcattgtcaa aaatgaaaaa tataataatt accgttcact caatactttt acggaacagg     51660
     gaatgagtct gggacttact atgacagtac aggagtttgg attagacact ggtggagtgg     51720
     ttcacggctg gactccgtgg caaaagatat caggttttgc tcatgcgaat attggaacta     51780
     caggtgttca gtatttaaaa aagattgatc acactaaaat tgcatttaac agggtcatca     51840
     aggatagcca taatgctttt gatactaaaa acaatcgatt tattgctccg aacgatggaa     51900
     tgtacttaat cggggcaagt atatatacct taaattatac atcttatata aactttcatt     51960
     tgaaggttta cctaaatgga aaagcatata aaacactgca ccatgtaaga ggagactttc     52020
     aggaaaagga taatgggatg aatcttggtt taaacggcaa tgcgactgta cccatgaata     52080
     aaggagatta cgttgaaatc tggtgctact gtaattacgg aggagacgaa acactgaaaa     52140
     gggcagtaga tgataaaaat ggtgtattta acttttttga tatacaagaa cttggaggcc     52200
     gaaactatcc aagattttag gaggtaacga tgaatatagg tgaagctatt ctttttaaat     52260
     acccaacagc tgatcccaca aaggatttta ttgtccagaa taatggtgat ggaactccct     52320
     catatatagc agagtggaat attagggcac ctatacccac ggaagcagag ttaaaaactt     52380
     ggtgggaaga gcttcagagt acatctgcat atgaaccacc agttcaagtg gatctacttg     52440
     caagagagtt gtcacaggaa aaactggctc gtaaacagct tgaagaatta aaccaaactt     52500
     tgggaagcga gctttcaaaa ataaagttgc aactgcttac tctacaagga gggcaaggtt     52560
     catgaattat tgggtgctgg ctttgcatta taactgggct tcttctgaaa tggtgaaaca     52620
     ggcaattcat ctcaaagatt gttcgcccga agatttacag gaaggaatag agaaaaaact     52680
     cattacagct gaacagtata aagagatcac aggagaagcc atttagggct tttttatttt     52740
     tccttaaagg aggtggttcc gttgtaaacc catgctcacc actaatgatc tacaatagca     52800
     aggaggattt attatggcat catatagttt tcaattttca acagatgcaa ctggtaagcc     52860
     gggggcagcc aagccataca gagaaggaaa cagagatttt gttgtgccgg tagcttcaat     52920
     ctccggtaat tcagagctgc tgacgaacgc agttttaaaa gccactgaag tctacacgca     52980
     atatggacaa gatcgattag gtcaggtttt aatttcaaaa gtaaaaggtc acgcttattc     53040
     tgatcgtgaa ggtaccttat tcattgaaga aagtaacgat atgaattcat ggaccacaat     53100
     ctcttcattg gttgttaaag caaatacgct tggcgagact gagtggattc atttaactaa     53160
     acgatatttc cgtttcagat acgcaaatgg taacctgcag caatctgaat tcttacttta     53220
     ccagtcattg ggcgcaggtg aagaggatat aaacattaac catactgttc ctattacagc     53280
     agttgctccg ttctcagtcc agttagataa aagcgggtta actaatgatg gtcgtttaaa     53340
     agttcaaact gaaggcttga atcttagctc attagacact caatcaaaaa caatggatat     53400
     tgtctttcac gataaaacag aaaccatagg tgagggtaac ccattcaccg ttggatcatt     53460
     caaaacgttg ctcattgagg tttatgggac ggctgagaca agtgaattga agttctgggg     53520
     taaatcctta tcgggaacaa aaagagccct tagagggcag aaagtggatg acggaacgtt     53580
     tgccactagc acaaaaggaa aatcagaagc ttggtctttt agcattactg gctttaaaga     53640
     aattgttatg gagcttacag ctttaacaaa tggaaacttt tcagttagag ggacggccgt     53700
     ctcataagat ccggctgtcc ttttttattt gcctcggagg aggtgattag aatggaggag     53760
     acaagtttgt ttatcaattt tgaaacatta gatttagcaa gagtatattt atttggaggg     53820
     gtgaagtacc ttgatttact tctagtactt agcataattg acgttttaac aggagtaatc     53880
     aaggcatgga aattcaaaaa actgcgaagt cgaagcgcat ggtttggcta tgtccgcaag     53940
     ctactcaatt tctttgcggt cattttagca aacgtgattg atacagtact caatttgaac     54000
     ggtgtcttaa cctttggtac cgttcttttt tatatcgcta atgaaggttt gtcaataact     54060
     gaaaacttag cacagattgg tgttaaaata ccatcatcaa taacagatcg attacaaaca     54120
     attgagaacg aaaaagaaca gagtaagaat aacgcagaca aagctgctgg ctaagccagt     54180
     ggcttttttt atcttactga cagaaggaga gagggtatat ggccattaaa gttgtaaaga     54240
     atctagtctc taaatcaaag tatggattga aatgtcctaa tccaatgaaa gctgaatata     54300
     tcactattca taacactgcg aatgatgctt cagcagccaa tgagatttct tacatgaaga     54360
     ataactctag ctcaacaagt tttcactttg cagtagacga taaacaagtc attcaaggta     54420
     ttccaacgaa tcgtaacgct tggcacacag gagatggaac aaacggtaca gggaatcgca     54480
     agtctattgg tgtcgaaatt tgttatagca agtcaggagg ggtacgatat aaggcagcgg     54540
     aaaagcttgc tattaagttt gtggctcagc tacttaaaga acgtggatgg ggtattgatc     54600
     gagtccgcaa acatcaagac tggaatggta agtattgccc gcaccgcatt ttgtcagagg     54660
     gaagatggat tcaagttaag actgcaattg aagcagaatt gaaaaagttg ggcggaaaaa     54720
     caaactcaag caaagcaagt gtagctaaaa agaaaacaac aaacacaagc agcaaaaaaa     54780
     cgtcatatgc gctaccatcc ggtattttta aagtgaagag cccaatgatg agaggggaaa     54840
     aggtaacaca aattcaaaaa gcactggctg cactatactt ttacccggat aaaggagcaa     54900
     aaaacaacgg cattgacggc gtgtatggtc cgaaaacagc agatgcaatt agacgattcc     54960
     agtctatgta cgggcttact caagacggta tttacggacc aaaaacgaaa gcgaaacttg     55020
     aagctctctt gaagtaaata aatagtctcc ttgagtatct ttctcaagga gatacttatg     55080
     tttattttgt tacagatagt tcaaaattat tctaatattt gagtaaaaag tattattttt     55140
     ctagtctgaa cataatgtta tcatttacat gtaaataatt taaaagaaag ggattgattt     55200
     catgtttaag aaattacttt tagcaacatc tgcattaaca ttctctttat cattagttct     55260
     tccgttggat ggacatgcca aagctcaaga ggtaacatta caggcacagc aggaagtcac     55320
     ttatcaaact cccgttaaac tatccgaatt accaactaat acaactgaac aatctggtga     55380
     atttcacaca aatggtatta aaaaatggat tgctaaagaa gcaatgaagg caacagccag     55440
     tgcgcttcga catggtggga gaattgttgg tgaggtagtc gatgagttag gtggatcagc     55500
     aggaaaaaca ttcgcaaaac atactgatga tgtagcagat gctttggacg agttagttaa     55560
     acgaggtgac gttgtggagg acgcaattat tgacacggtt tcctcatatc taattgatgc     55620
     tggtgtaaaa tcttctacag ctagaactat tgcaagtgta tttactttct tagcttttta     55680
     attgaggtga tttgaattgg taacagtaga agaaaggctt gacaacctag aaaaaaaagt     55740
     cgagaagcag gcttttcaac taaggttagt ccaacaatta gcagctgatt atgatcggtt     55800
     tggcttattt gatcaagttt tggcctatga tttaagtgaa aaacagtatc aagaattaag     55860
     agagttaacg agccagtaca ctgataagat taaaaatggc gaagaggtct ctcttcataa     55920
     ctttactgaa gaatttaaaa gaattttgaa agatattgaa aaagaagtgg atttcgaaaa     55980
     gtttatttct ctctggttaa agggaccaga agaaggtttt ggattttcta aagctttaca     56040
     taaccatttc tttaattaaa gataaggacc agccacataa taagctggtc tttctttatt     56100
     ttccctcaag ttcgaactcc tatgaacaga ataccaggta tctatccttc caaatatatt     56160
     gttattagct tgagggtttg tgtgtttttc ttcattaatc atagaattct ccttacctca     56220
     gtcattttct tctattattt gcagctgatt tcaaattaaa taaaataagc ccttctcatt     56280
     gagaggggct tataaagtga ctcttcttta ttaaagtcat taaacaacag attctctctt     56340
     tatatcaaaa atatcaatct gttttgattc cagaagatct tgtaaataat ctgagccgtg     56400
     tttttcagct acttgcaatt ctccttcgga tataggtaaa gccattagcc aagtaacatt     56460
     tttgttacta aattcaagta gttctaaatc ttcctcccat aaaaatgggg gaacgaacat     56520
     aatatgtttc atgtcggttt cctgatcata catactaatc acatttttaa aaataacacc     56580
     tggtgcacaa gtgaaatttg agttgattat attaaaggca caagttgata aaacattagc     56640
     atatatgtct gaagctgact ccattgcagc tacgatttct atccgcaacg gagtgccatt     56700
     cacctcataa ttaatagaat gatccgacaa acctagagtt gaatatgacg tgataccttc     56760
     ctgaggctgg tcactaaccg ataaaatatc tatgctgcta ttcttgttat catcccaata     56820
     tttcgtaacc ttcggtttcc ccccaaaagc tcctaaaact gttctagcaa ttactttatt     56880
     ttcttgtgtt acgcccatta gacaatctct ccttaatctc caaagtaatc atccgtcata     56940
     tcttcccctt tatgactcct attggaggaa ggtaattcgg gttgatagtg gtctggatta     57000
     ttatgttcat ctaaaaattg ctttcgacta atatttcttt ccatcgcact ttgttgatgt     57060
     tttctaaatt cataacctgg tttatgaccc atatcccatg gttcatcttt tttcattact     57120
     tgttttgtta acgggtcttt aacagatccg gttgaatcct tagcattttc ccaaacctta     57180
     tctctaacgc ctttacggaa ataagttggt cttttgtacg ttttaggaac tttaggtttt     57240
     ttgctggtgt tagtcgatgc ttcgctaact cgagaacttg attttgcatt aagctttttg     57300
     ttaattccgc gagctccgaa aggaaccaac attgccattg caccactaag gctctgttct     57360
     tgcctctctt tggagacttt attcccgaac atatcgcgtc ctgttatagc ttcactaaaa     57420
     ccatttgcag aagcaagtcc ataaagtcct ttgctggagt tttgaagggc atggaatgtc     57480
     ttaggtgttt tatatacatc gagagctttg tctgctctat acaatgcttt acttgttgaa     57540
     taaacagctt ttccaccttt agctaattta cctgcccatc ctacgatagg gatgtatcct     57600
     gccgcagcca ttgcaccggc agcgacccgt tgtccagcag ttagcttttc gccggtaaca     57660
     ggatcaaccc catcagcggc tcttttataa tcataatatc cagagacctc tcctgtaaaa     57720
     ttacaaacag catcccaaga cttttcatac catggtctgt tcgccagttc ttcttgttct     57780
     tttgcaattc ttctttgttc cgcctgttgg tccttaaaag agatgtagtc tgttgattgt     57840
     ttctttacat cctcagtcat cttgtgaatc tcactgtctc tataagcctt cgcattatag     57900
     tgaataggag aggcgctttt gccttttgct gtcgcattca ttaaagcttg ataatcagct     57960
     tgaatcattt gttcatttgc ttctgatagt ccgtattctg atgttaagtt ttggtcaact     58020
     tcatccattt tctcaatggc ttcttttcgt ttcttttcgg cagacgaaag ttcattttta     58080
     aaagtttctg tcgagaacag atccaaaggc agtatatcgt tgatatcatt taatatatct     58140
     ttcatggctt ttttctgttc agacataatg gattttgatt tggtgtaggc gttagcaagc     58200
     tcatgcgcta aaaaggtttc ttctatgtag gcatctgata agttggcatc ttctaaaaaa     58260
     ccaggaatac tcgttaagaa agaaattttc atctcaatta aatcaatcca ttggtcagca     58320
     atgccagctt gatcttcata aaatgattta atgttattag cgcctttgcc tgaaaactcg     58380
     ctatcatcta aatctgcaac agctttgaac gctttcttta atttgaccat tttacttttt     58440
     aaatctttgt attcctgtgc tcgcttttca gcctcggtga gcaaggtttt ggcttcaaat     58500
     actttcatga tcatatcctt tcatttaatc gtcataacaa aatattacca tggaagaatg     58560
     atgaaactaa ctgttatgtg gatcaaatgg tggaaatgaa tcattcgatc tgtgtcattt     58620
     tacctatttg ttaatccttt caatgaaagg ggactttcca attgtaacat cgccatcatg     58680
     aaaaaattcg ataacgtagc cagattcact aaacataaaa gtatccgatc caacggcagt     58740
     tacatcatca attacgttta atgcatgctc aagactggtt tttaatgctg gctgttctcc     58800
     gtaaccccaa agaataataa tgttcctatc tttaaaatgg tgtttagcta gccaatcgta     58860
     aatctcttcc tcgtaatcta tagattgatg acaacaaact tcttcccact tgattcgtcc     58920
     ccaagatgta agggaaaact gtttgaaagc agttcataat attttgccgt taattcttct     58980
     gataagattt ctttgttttt ccctagagct tctaagcatt catcaaataa gtccaaaatg     59040
     ttcacctcaa aagctttaag tatgatagat tttttcagta ttagaaataa gaaaaagccg     59100
     ttatgaaacg gctaaaggga atcagaacta atgttgttta tcgaattaaa caaggaattc     59160
     atgagtaggt gcgagagtta cattccggga tgcttccttc atttcgccat tatacataga     59220
     tccgaaaaag gcaagtccaa ttaaaacggc ggataaactg ataaacaatt tagatttcat     59280
     acatgcattc ccctttcgat atttgctttt gagcatatac catcttcttg aaacagatga     59340
     tactatcctc tattttccca ttataatcga aaaggttgcc tcctaacaat gccagctctt     59400
     ccagataagg gtatcctttg ccgttctcta aacgagaaaa aatgttgaga agtttaggtg     59460
     tatcgccatt tcttatataa agaacgtcta atgcttcaaa taagttcata aatagttcgt     59520
     ctttaaaatc tacagcactt ctgattcctt tgcggaagca atccattgct tgtccttttt     59580
     tgccttgttt aaaataaatc aacgctaggt catgataagc ttgcggaagt acgtcagagt     59640
     taatttttct gtattgaacc aaggcttgtt cgatgtaacg agcagcctta tttaagttgt     59700
     ccattttgtg atagcaattg ccgagattga aaaacgcagt ggcatagata tgagtatttt     59760
     tacttttaag cagctcggca ccttttaaag cttcttgaag gtgggggaga gctttttcat     59820
     gattttcaag gtcatcgtag ttaccggcaa tgacaaaatg gcactgaata cgacgaacag     59880
     agtaaagctc gtgtttctta taaatgttgt atgaaagctc agcgtaatgc atcgaaatgt     59940
     gtgtcatttt catatgataa tagacttcag acagtttaaa ataaaactca gctttttcaa     60000
     tcttgtcgga gattgtagga attttgcgtt cagctttttt gtaatatgta atggctcttg     60060
     tgtattcacc gtttctaaac tcatacatcc cgcggaagaa gttataataa tatgcccgca     60120
     tattgtctaa ttttttctta tggccctcaa ttttatttaa atattctgaa agttccattc     60180
     ggttttcatc agatggcagc gtgtattcca acataatttt atggcgaaag gccattagtt     60240
     gataataaat aagcaagtct tgatcttctt ccataacctc tatatcacgt tctatttcag     60300
     cttttaacat ttcagcatca gttacgttga atttttgaat atgcctatgc cattcattaa     60360
     tcttcattcc cacttcagct gatgtgattg atatcaagat attcaccctt cccttaactc     60420
     tactagtact gtaaatatta acaagttttc gttcgcagaa aaaggaaata gggcaccgca     60480
     atttaaattt tcggtgagac cgcaataact ttttgcttta gagagttatg aaattccctc     60540
     ctgggagtac catgacttgg catcaaaaaa cagggaattt cggtcattct tgtgatagtt     60600
     taaaattgaa aacatccaga aagtccagcg ttagtcgttt tgaggggctg agtgtgcatg     60660
     tacagctaaa cgcagaactg attctggatt tttcttgata aggaaattac ttacctaccc     60720
     actaaaactt aaccaattaa ttaattaata ttcatttgga tatatggaaa agtaattaga     60780
     cattcacctc cttcgtgctc ccgcaataca ttatgataaa tgccttcgga ggtggattta     60840
     ttgactgagt tatatgctaa aagtgatctt gaaaaaatta aagaaacgct acctggttgg     60900
     caattagatt cgtttaacta tttgaatgaa aaaataggtg ataaagaaaa taaatttcct     60960
     tgtataccgg gaaggcaagc atttttaagc gaccagctgc gaattgcttt tgtcggtgat     61020
     cctaggaatc ccgagactgc gaaggaatta gcgccattgc ttactcggta tggaactatt     61080
     tcacgagaga caggaaagta tgcatcatta actgtaatat ttcatacacc agaagaatta     61140
     ctgactgatt acaaaattga ggattacgaa tcgttgtttt ggcagttgct caattcattg     61200
     agtatggaag atccagctga ttggccagat gatataccag aaaatccaga taactttcaa     61260
     tgggaatact gttttaatgg agaaccatat tttgttctgt gtgctacacc ggctcacagc     61320
     aaaaggaaaa gcagaagttt tccttatttt atgttgacgt ttcagcctag atgggttttt     61380
     gaggatctaa atgatactac tgcatttgga cgaaatatga gtaagcaaat tcgaaaaagg     61440
     cttgaggcat atgatgaagt acctatccat ccgcatttag gatggtatgg aaaaaaagac     61500
     aatctggagt ggaaacagta cttcttgcga gatgatgaaa atcaagtgtc acaatgccct     61560
     tttatgaaaa tgaagaactt attcaaaaag gaaaggtctg attaaattgt ttaaaacctt     61620
     atgtggaagg atggattgaa tggcttatat cttcacataa ggttttaatt gatgataaat     61680
     ctgtgtgctc tgactaaata cgtattatct cgaattatta tcgattctac atattcacaa     61740
     aaattattta atgttttttt cttgaaatta gaaattagcg tttatgatct ccgttgctgt     61800
     agtagcaaag tagcgatgga ggaaataata aaaatggaaa acctctatct ggttacacaa     61860
     gcttttagcg ggttttacaa ttaatcaaaa taaattgatt tatttgcttg cattatttta     61920
     aaaatcatga gtataataaa tacatcaaaa aaaattgatt aaagaaggcg atatgaatgg     61980
     atgagacgaa atcagaactg ctacggaaat atgaacaaaa atttaaggct cttgctgatc     62040
     agaaacgatt agagatcatg tatgaacttt gtcaaagggg aaaaacctgt gtttgtgatc     62100
     tgactgagat ttttgaggtg acgcaatcta aactttctta tcatctaaaa attttattgg     62160
     atgccaactt aataacgaaa gagacaaagg gaacatggag ttattatgat ctaaatgatg     62220
     aggaagtaaa tggtttatta tcagaagagc tttgttgtat atttagaaaa aaaggtgaag     62280
     gagattgctg ctaaaaaaat tttttaggta ttatatcaaa tttttttgat taatatataa     62340
     gagggggaat taaaatgaaa tatgttcatg taggggttaa cgttgtcagt ttagagaaat     62400
     cgatcaattt ttatgaaaaa gtttttggag taaaggctgt aaaagtaaaa acagactatg     62460
     caaagtttct attagagact cctggactga atttcacttt aaatgtcgca gatgaggtga     62520
     agggaaatca agtgaatcat tttggattcc aagtagatag tttggaagaa gttttgaaac     62580
     acaagaaaag gcttgaaaaa gaagggtttt ttgcacgtga agaaatggat acgacttgtt     62640
     gttatgcagt ccaagataaa ttttggatta ctgatccaga tgggaacgag tgggaatttt     62700
     cctataccaa atcgaacagc gaggttcaaa aacaagattc ctcctcttgt tgtgtaacac     62760
     cgccaagtga tattacaacg aactcttgct gttagtaaaa aaggtgagga taaagtaatg     62820
     aaacgtttat cttttttaga ccgttattta accatctgga ttttccttgc gatggcattg     62880
     gggataggat taggttttat atttccgagt tttgttggtg gattaaacaa attacaagta     62940
     ggaactacat ctatcccttt agctattgga ttagtattaa tgatgtatcc accactagca     63000
     aaggttcgat atgaagaaat tggacgggta tttaaagata ttaaagtgtt aattttatct     63060
     ttagtgcaaa actggatcat cggaccgact ctcatgttta ttttggctat catctttttg     63120
     ccagataaac cggagtatat gattgggctt attatgattg gattagctcg ctgtattgcg     63180
     atggttattg tttggaatga cttatcaaaa ggtgatacgg aatacgcggc aggattagtt     63240
     gctttcaact caattttcca aatgcttttt tcctcagttt atgcttacat ttttgtaaca     63300
     gttatcccgc aatggttagg gatggaagga gcagtagtga atattacgat ggcagaagtc     63360
     gcaaaatcag tattcattta ccttggagtt ccttttattg caggaatggt gacacgttat     63420
     atttttgtaa aagtgaaggg caaagaatgg tatgaaaaag tgttcattcc taagattagt     63480
     ccaattacgt taattgcttt gctatttaca attatcgtca tgttttcctt aaaaggtgat     63540
     gtaattgtta gcttgccgtt agatgttgtc cgagttgcga ttccattatt gatttacttt     63600
     gttttaatgt tctttgtttc cttcttttta gggaagaaaa tcggggcaaa ctatgctgta     63660
     actactactt tagcttttac agcaggaagc aataactttg aattagcgat tgctgtagct     63720
     gttggtgtat ttggaattca ttcgggtgca gcatttgccg ccgtaattgg tccgcttgta     63780
     gaagtgccag tcatgatagc acttgttaag gttgctttat ggtttcaacg aaaatacttt     63840
     ggaagtcact cgatgtagag gtggaatata tggagaataa aatcatttac tttttatgta     63900
     cagggaactc ttgccggagc caaatggctg aaggatgggc taaacaatat ttaggtgatg     63960
     agtggaaagt gtatagcgcg gggatagaag cacatggatt aaatccgaat gctgttaaag     64020
     cgatgaagga agttggtata gatatctcta atcaaacgtc agatataatc gattctgata     64080
     ttctgaacaa tgctgattta gttgttacgc tttgtggaga tgctgctgat aaatgcccga     64140
     tgacgcctcc acatgtaaaa cgtgagcatt ggggttttga tgatccggca agagcacaag     64200
     ggacagaaga agaaaaatgg gcgtttttcc aaagagttcg tgatgaaata gggaataggt     64260
     tgaaggaatt tgctgaaaca gggaaataaa taaactcttt tgttaaagga tgcatattta     64320
     tatgtgtcct ttttttatta atgtctagct atacgaactt gacaccagtg aaatgtcatt     64380
     aactatctaa caatgaaaaa cactactcca ttgtactctc aaataataat aaatcattga     64440
     aaactataat aagcgaatgt tgaggcatag aaaataaaat cttttctatt gaggacctaa     64500
     aggagtgtag aaaagtcaca acaacttttt ttaaattttt tgcatattca ttgaaacgtt     64560
     taataacact atagtttaat ttaaaatctc ctcatttgga caaacagctg ttacatagca     64620
     ttacccaagg ggtgatgcat tttatgaaag tgataatcat cgagggaccg caagctgaca     64680
     aatgcattaa cgattgctat cattatttaa taaaacttta taggaaggag attcagggtg     64740
     atagcaatat atgtaagggt atcgaccgag gaacaagcga tcaagggatc gagcatcgac     64800
     agccaaatcg aggcctgtat aaagaaagca gggactaaag atgtgctgaa gtatgcagat     64860
     gaaggatttt caggagagct tttagaacgt ccggctttga atcgcttgag ggaggatgca     64920
     agcaagggac ttataagtca agtcatttgt tacgatcctg accgtctttc tcggaaatta     64980
     atgaatcagc taatcattga tgacgaattg cgaaagcgaa acataccttt gatttttgta     65040
     aatggtgaat acgccaattc tccagaaggt caattgtttt tcgcaatgcg cggggcaatc     65100
     tcagaatttg aaaaagccaa aatcaaagaa cggacatcaa gcggccgact tcaaaaaatg     65160
     aaaaaaggca tgatcattaa agattctaaa ctatatggct ataaatttgt taaagagaaa     65220
     agaactcttg agatattaga agaggaagca aaaatcattc ggatgatttt taactatttc     65280
     accgatcata aaagcccttt tttcggcaga gtaaatggta ttgctctaca tttaactcag     65340
     atgggggtta aaacaaaaaa aggcgccaaa gtatggcaca ggcaggttgt tcggcaaata     65400
     ttaatgaact cttcctataa gggtgaacat agacagtata aatatgatac agagggttcc     65460
     tatgtttcaa agcaggcagg gaacaaatct ataattaaaa taaggcctga agaagaacaa     65520
     atcactgtga caattccagc aattgttcca gctgaacaat gggattatgc tcaagaactc     65580
     ttaggtcaaa gtaaaagaaa acacttgagt atcagccctc acaattactt gttatcgggt     65640
     ttggttagat gcggaaaatg cggaaatacc atgacaggga agaaaagaaa atcacatggt     65700
     aaagactact atgtatatac ttgccggaaa aattattctg gcgcaaagga ccgcggctgc     65760
     ggaaaagaaa tgtctgagaa taaattgaac cggcatgtat ggggtgaaat ttttaaattc     65820
     atcacaaatc ctcaaaagta tgtttctttt aaagaggctg aacaatcaaa tcacctgtct     65880
     gatgaattag aacttattga aaaagagata gagaaaacaa aaaaaggccg caagcgtctt     65940
     ttaacgctaa tcagcctaag cgatgacgat gatttagaca tagatgaaat caaagcacaa     66000
     attattgaac tgcaaaaaaa gcaaaatcag cttactgaaa agtgtaacag aatccagtca     66060
     aaaatgaaag tcctagatga tacgagctca agtgaaaatg ctctaaaaag agccatcgac     66120
     tattttcaat caatcggtgc agataactta actcttgaag ataaaaaaac aattgttaac     66180
     tttatcgtga aagaagttac cattgtggat tctgacacca tatatattga aacgtattaa     66240
     agaggggtgt atgcaccccc cttttgtaat tacaatctca ttttcaatac acctcgctgc     66300
     atacgtcgcc acctttgtcc cttttccagc ggaatagctt tcaattcctt taataagccc     66360
     gatcgttccg atggagatta agtcctctgc atcctcacct gtattttcga actttttcac     66420
     aatatgggcg accaagcgaa gattatgctc aatcagcatg tttctggcat gttcatcccc     66480
     tttagccatg agctctaagt attttttttc ttcgctgctt gagagcggtt gtggaaaggc     66540
     attgtttttc acgtaagata ctaaaaagac aagctcttta acaacaaagc cgagcgctgc     66600
     gaaaacacct gtcaccatcg tcacctccac aaaagtatgt aggcaaaagc ctatatgtaa     66660
     atgtatgtga ccgggaggct gtctgtgtct gtaccgggaa atttctcgcg ggggagtccg     66720
     gctttggtaa gcagcatact aacttcaaat gttaaaaata ttcttcatca agcgcccata     66780
     cattgaaatg aacaaaggta tggggggatg gggatgaaaa aatggatggc aggcctgttt     66840
     cttgctgcag cagttcttct ttgtttaatg gttccgcaac agatccaagg cgcatcttcg     66900
     tatgacaaag tgttatattt tccgctgtct cgttatccgg aaaccggcag tcatattagg     66960
     gatgcgattg cagagggaca tccagatatt tgtaccattg acagagatgg agcagacaaa     67020
     aggcgggagg aatctttaaa gggaatcccg accaagccgg gctatgaccg ggatgagtgg     67080
     ccgatggcgg tctgcgagga aggcggtgca ggggctgatg tccgatatgt gacgccttct     67140
     gataatcgcg gcgccggctc gtgggtaggg aatcaaatga gcagctatcc tgacggtacc     67200
     agagtgctgt ttattgtgca gtagtaaaga agaggctctt tcttgagcct ctgttgttac     67260
     aatccttcgc cgagctgaat tttcggggga taggtttctg cttttcgcca atattggcgt     67320
     gtgccttcgt cccgtacaac gatgcccagc tgtgccagtt cgagacggaa ttcttcaata     67380
     tcgtcttttt cttcgtcctg cagtgctttg tgacgagctt ttaataaggc atgggcgcct     67440
     tgcgataggt ctggtgcatc aggaatccat cggcgaaatt gatctttaaa cggatcacca     67500
     tctgttgccc attcgtaatg atgctgtcta aaggccttct caacgtttac tggtttttca     67560
     tcaatttctt cccgtaccaa ttcatatccg gctgttccca ggaggacaag ccgtttgtga     67620
     tccataaata caagagcgat gtcatcggaa tgaattgttt gcactttttt tcctttgatg     67680
     aattccactg tgtgatctgt taattttgac agacagcagc attgcaataa cagaatgagc     67740
     gaaccaaatc cccgcacaca taccgagaag agcagtgata aatgaaactg tagtaccctt     67800
     gaaaagaggg taatgagccg aagtggtcct tcaagaggga tccaggggag ggataatgcc     67860
     catttcgcaa tctgcggaat aaaatacccg attgcaaaac cgatgattgc aagtgcagcg     67920
     tataaaaaga atacagcggt tttcgtaact ccaataagag tatgagattg attctgcaac     67980
     atgtcacctt ctttttactg aaaaaatcga attccttccc atattttaac ttaaactgat     68040
     ggtaaatcaa ggataaagcg ataattatgg atataaagag attcagtaat agaactggca     68100
     ggcgccgtcg gtcatgaaaa ataaaattta catgcgcaga cgatgtaagc cccatttgtt     68160
     ttctgcgtat cacaatacaa tccataggga acataaagag taaaggcttt ttagacaatc     68220
     aggaggaaca gatatgaaaa tcggattaat cggcttaggg aaaatgggca taaacatagg     68280
     aaagcaattc attgaccgca atcatcaagt ggttggatat gatgtaaatc aagcggctgt     68340
     tgatgaactg aaagcatacg gggctgaggg gacaacaaat cttaaagagt tcatttcttt     68400
     attacacccg ccgcgcatcc tatgggttat ggtaccgcat ggcattgtcg atgctgtttt     68460
     gcgtgatgta tcacctttat taagtaaagg cgatatgatt atcgaagctg gaaactctca     68520
     ttataaagaa tcaattcgcc gctacaatca aatgaaagaa gcgggtatcc attatctcga     68580
     tgccggaacg tcgggcggaa tggaaggcgc acggcatgga gcctgtttta tggtgggggg     68640
     cgatcatgaa gcatgggaga ttgtggaacc gctttttcgt gatactgccg tcgaaaatgg     68700
     ttatctatac gctggtgaag cgggaagcgg acatttttta aaaatgatcc ataatggaat     68760
     tgagtatgga atgatggccg cgattggtga aggattcgaa gtgcttgaaa acagccaatt     68820
     tgattttgac tacgagaagg ttgccagagt gtggaatcat ggttctgtca ttcgttcttg     68880
     gcttatggga ctgactgagc gagctttcgc taaggatgcg aaactggatc agatcaaggg     68940
     cattatgcat tcctcaggtg aaggaaaatg gacggtggaa accgcgcttg atctgcagac     69000
     ggcaacgccg gtcatcgcca tgtcactaat gatgagatac cgttctttaa cagacgatac     69060
     gtttacagga aaggtggttg ctgcgcttcg aaatgaattt ggaggccatg cgacagaaaa     69120
     aaagtaaggg ggccaacaag cctccttatt tttttggcac cttcagaaga tgagggaact     69180
     ttttataaat gaccagcatg atgatcagaa tatatgtacc gtaaatgctg atagacaata     69240
     atttattgct ggtgaaattg gcacctgcaa tagtgacaac aacaatattg gggattttcc     69300
     ctattaaaga cgcaaagaaa aaaacatgcc agcgaacctg gctcagcccg cagatcacgt     69360
     tcattacaag tgaaggtatg acaggtatca gccttcctaa taaaacagcg gtaaaagcgt     69420
     ttttgttgaa ggaagcctcg tagctttgta tggcaggata ggcctgaact ttttttctgg     69480
     cccaatctct aaaactgtac ctggcgagaa aaaacagcaa tattgtacca agcattgagc     69540
     cggtcagtgt aatccaaatt ccatttgcag tcccgaacac tgcgccattt aaagcagcaa     69600
     tcaaagcaaa cggcactatt gggaaaaaaa catcggcagc aatcagcagc atactaaata     69660
     aaacggaaaa catccctcct gctttgattg catcaagcca agcttctttc tgaaaaaaac     69720
     caactgaaat gatagcgata atcacaagta tacctattac tttttttaac atgtctatgg     69780
     tcactcccaa cttaggtgat gtcaggagtc aaaacctccg tcatctaaat tagtataact     69840
     ggtgccattt cagctgttca actgaaaacc aggttaagaa cacaattctt ttttacctca     69900
     taaaaaaggc tgtccatctc tctgttttct gcattcttat taatagggag ggatagaaat     69960
     ggtaaccata aaaaaggatt ttataccggt atcaaatgat aatcgtcctg gctatgcgat     70020
     ggcgcctgct tatattacgg tgcataatac agcgaataca gccaaaggcg ctgatgcgaa     70080
     aatgcacgcc aagtttgtga aaaacccgaa cacatccgaa agctggcatt ttacagttga     70140
     cgattcagtc atttatcagc atctcccgat agatgaaaac ggctggcatg cgggagacgg     70200
     tacaaacggg acaggaaacc gcaaatcgat cgggattgaa atctgtgaaa atgctgacgg     70260
     cgattttgaa aaagcaacat caaatgccca gtggctgatc agaaagctga tgaaggaaaa     70320
     caatattccg ttaaatcgtg ttgttcccca caaaaagtgg tccgggaaag aatgtccgcg     70380
     gaaactcttg gaccactgga actcttttct aaacggaatt tcttcctcgg atacacctcc     70440
     aaaagaaact tcaccatcat atcctctgcc gtctggggtt ataaagctca cttcgcctta     70500
     tcgaaagggc acaaacattc tccagctgca aaaggcttta gctgtacttc acttttaccc     70560
     tgataaggga gccaaaaaca atggcataga tggagtttac ggaccgaaaa cagcgaatgc     70620
     cgtcaagcgt tttcaactca tgaacggatt aactgcagac gggatttatg ggccaaaaac     70680
     aaaggccaag cttaaatcga agttaaagta aatgcaggat ttaacggata acctgtttcc     70740
     agtgcggatt caggttattt tcttttcttt ggtttgtgtg tttttcagat tggaaagaag     70800
     ggaattttaa aaaatcatca gctgcgccgc aatgaaagca gaatgatatt cactgagggg     70860
     gacacgttaa ctataggaaa aaacagtgat agcgaaaaac tcttcattga acgaagagaa     70920
     acagaggtat aacattaaag tgaggctttt gggggtgtaa agatgaaaca ttttatcatc     70980
     cttttccttc tgctgttcgt tacagcagga tgcgagggaa ggggatacga agacgttgta     71040
     gcatttggtg acagtaatac gcgtggctct aattgggatt atcgcgatta tccaaaagca     71100
     cagcagtggg tcaatatatt aaaaacagct gagcgcggta accttgatat actcaatgcg     71160
     ggaatcggcg gacagacgac agaggatgcc cgtctccgat ttcagacaga tgtgctggat     71220
     caaaaaccga agtatttgtt tattatgttc ggaaccaatg acgctgccat actgactgag     71280
     gggaaaccga gagtgtcgaa gcagcgtttt agagaaaatc tggtttattt tattgaagaa     71340
     agcagaaaac acgggatcaa gccaatctta atgacgtgta tcccaattat agaaggtaat     71400
     gggaagcatc atttgtttta ctattccaga tatcaagcag ctgcttttga accaaaaggc     71460
     ggagcaagga aatggcacaa ctcatataac gatattacaa gagatgtgtc gaagcgcctg     71520
     gatgtccctc ttgtagataa ctggaagcat tttatagaag cagacggcgg aaaagcaact     71580
     gatgaagcgc ttatccaatc tggtcttata gatccttctg gaaatcatat gacacctaaa     71640
     ggggcaagga tcgtatatga aggaatacaa gatgggcaga tcctgcagcg ttgagccgga     71700
     caaccgccta gtccgattta tttctcctac ataggctgtt ataaaacctt attaaggagg     71760
     cgcttcacat gtatggcgca ggcagagcat atggatacgc ttttattgtt gttttagttg     71820
     ttgttctcct tgttgtgggc ggcatatact ggttagcata ataaccggcc ctttaaaaca     71880
     cctcttttta ggggtgtttt ttgctgaaaa tagtagtaaa gcgcgcagca aaagtgatat     71940
     aatatcagtc atctgagtaa aaaaaggaaa tacgcccgga aaaaatagac aaattcctat     72000
     taagaagata cggaaataat atgtccgagc gatcttcttt ttatttcgtt ttcaattaac     72060
     tcaataaagt cacggtttaa attcatttcg gtggctttga aataagattc tattagtaat     72120
     tcatcagaca gttttctcat gctaggaacc caattaatgg gagaggcacc tccttaaaag     72180
     ttggaatcat tcatgatttt aacgcataca atgataagtt gcattcatct gaggttgaag     72240
     ttatctttaa tctaccatga aatgcatata agaacaatcg ttctgttatc cacaccaaaa     72300
     agtggataac ttgtgagtat cgtgtttata atttgtctaa agagtgatgt aataagagtg     72360
     gatagtgtgt gtaaatttat ccacacctgg tgaagaaacc caatttttgt cgaaattttt     72420
     ttgctcagtt tttctttagg cgcaagttcg atttttttcg acaatcattt tgaaagaaag     72480
     aaaaagggaa gggtgcgggt tttgttaaaa aagttttttt tacctgacga gtttgtaaaa     72540
     aatatttttc atattacacc tgagaaatta aaggaacgaa atgtaaaagg aattattact     72600
     gacctggata atacgcttgt tgaatgggac aggccgaacg cgacgccgcg attgatcgag     72660
     tggtttgaag aaatgaagga acacggcatt aaagtgacaa ttgtctctaa taataacgaa     72720
     agaagagtga aacttttctc agaaccgctt ggaatcccat tcatctataa agcaagaaaa     72780
     ccgatgggta aagcctttaa tagagcggtg cgcaatatgg agctgaaaaa agaggactgc     72840
     gttgtcatcg gagaccagct gctgaccgat gtactcgggg gaaaccgaaa cggctaccat     72900
     acgattttgg tcgtgccagt cgcttcctct gacggattca ttacgcgctt taaccgccag     72960
     gtcgaacgca gaatactgag tgctctcaaa cgaaaagggc acattcagtg ggaggagtaa     73020
     gaaatggaaa aggttgtttg tatcgggtgc ggagttacga tccaaaccga ggacaaaaca     73080
     ggtttggggt acgcgccgcc tgcatcgctt acgaaagaaa atgtgatttg ccagcgttgc     73140
     ttcagactga aaaactataa tgaaatacaa gatgtctcct taactgatga tgattttttg     73200
     aacattcttc acggtattgg agaaacggac tctctggtcg taaaaattgt tgatattttt     73260
     gattttaacg gcagctggat taatgggctg cagcgcttgg tggggggaaa ccctatctta     73320
     ttagttggca ataaagcgga tattttgcct aagtcactga aaagagagcg tctgatccaa     73380
     tggatgaagc gtgaagcgaa agagcttggc ttaaaaccgg ttgacgtatt tttggtcagt     73440
     gcgggtcgcg gccagggaat cagagaagta attgacgcga ttgagcatta ccgcaacgga     73500
     aaagacgtct atgttgtcgg atgtacaaat gtaggaaagt caacctttat taaccggatt     73560
     attaaagaag tgtcaggtga agaagatatt attacaacat cccaatttcc tggcacaacc     73620
     cttgatgcga ttgaaatccc gctggatgac ggttcatcgc tttatgatac accgggaatt     73680
     atcaacaacc atcaaatggc gcattatgtc aataaaaagg acctgaaaat attatctcct     73740
     aaaaaggagc tgaagcctcg cacattccag cttaatgatc agcaaacact gtattttggc     73800
     ggacttgcaa ggtttgatta tgtgtctggg gaaagatctc cttttatttg ctatatgccg     73860
     aatgagctga tgattcatag aacaaaactt gaaaatgcag acgcgcttta tgaaaagcat     73920
     gcaggggaat tgctcacacc tccgggtaaa gatgaaatgg atgagtttcc tgaattggtc     73980
     gcccatacgt ttacgataaa agacaaaaag acagatatcg ttttctctgg gttaggctgg     74040
     gttactgtcc atgacgctga taaaaaggta actgcatacg cgccaaaagg cgttcatgta     74100
     tttgttcggc gttcattaat ttaagaaaag gggagaggtg tatgaaaaag ctgtacgggg     74160
     ttatcggaaa tcctattggc cattctatgt cacctgatat tcataacgca tcattgaaag     74220
     acctcgggct tgacggacat tatcatgcct tcaaggtaga agagaatgat ctggaggatg     74280
     cggtaaaagg aataagagct ctaggcgtac aaggaatcaa tgtgactgtt ccgcacaagg     74340
     tttccattat ggattatttg gatcatattg atgagagtgc aaaagtgctc ggtgccgtaa     74400
     acacggtcag aagagaggga gataagcttg tcggatacaa taccgatggg gaaggcttcg     74460
     tgaagtcatt aatgaaggta ttagacaagc ccatctctga actgtcattc ttaatgatcg     74520
     gcgctggcgg agcggcgaga gccattttta caacatttgt ccgaaatacc ccgaaaaaat     74580
     ttgacatttg caaccggacg ttagaaaaag caaagcggct tacagaagct actccctcgt     74640
     ttcacaataa agaagtatta agcataaaag aagcagaaga acgtcttgag cagtatgatg     74700
     ttatcatcca tacaacgtct gtgggcatgt atccgaacgt ggacgatgtg ccgctttcat     74760
     tacagcgtgc cgcgagcagt gccgtcgtat gtgatatcgt gtataatcca atacagacgg     74820
     cacttttaaa agaagcaagc caaaaaggct tgaaaacact cgatggtgtg ggcatgtttg     74880
     ttgaacaggc agcattgtct ttccaattgt ggactggaca agagcctaat attgaaaaaa     74940
     tgagatctat tgtaatagga aaattaggag gaacagaatg ttaacaggta aacaaaaacg     75000
     ttttttgcgt tcaaaagcgc atcatttaac gccgattttt caagtaggta aaggcggagt     75060
     aaacgacaac atgattaaac aaattgctga ggcgcttgaa gcgagagagc tgattaaagt     75120
     cagcgtgctt cagaattgcg aagaggataa aaacgatgta gcggaagctc ttgtaaaagg     75180
     aagccgctct caattggtgc agacaatcgg caatacgatt gtgttatata aggaatcaaa     75240
     ggaaaataaa caaatcgagc ttccttaaag gtggttgaaa tgaagaaaat cggaattttc     75300
     ggaggcacgt ttgaccctcc gcataatggt cacctcttaa tggcgaatga ggtgctgtac     75360
     caggcggggc ttgatgaaat ttggtttatg cctaatcaaa ttccgccgca taaacagaac     75420
     gaagactata ccgacagctt tcatcgcgtg gaaatgctaa agcttgcaat tcaatctaat     75480
     ccgtccttta agctggagct tgttgaaatg gaaagagaag ggccatcata tacctttgat     75540
     accgtttctt tactgaagca gcgttatcca aatgatcagc tgttctttat tatcggcgct     75600
     gatatgattg aatatttgcc gaaatggtat aagctggacg agctgctgaa cctcattcaa     75660
     tttattggag taaagcgccc cggttttcat gttgaaaccc cttatccgct tctctttgca     75720
     gacgttccgg aatttgaggt atcatcaact atgataaggg aacggtttaa aagcaagaag     75780
     cccactgact acttaatccc tgataaagtg aagaagtatg tagaggagaa tggtttatat     75840
     gaatcgtgag gaggcacttg catgcgtgaa gcagcaattg accgaacacc gatatatcca     75900
     tacggttggc gtgatgaaca cggcgatcga acttgcggag cgttttggag ccgattctaa     75960
     aaaagcggaa atagcggcaa tctttcatga ttacgccaaa ttccgcccga aagaagaaat     76020
     gaaacaaatt attgcgcgtg aaaaaatgcc tgcgcattta ttggatcata atccggagct     76080
     ctggcacgct ccggtcggcg cttatttggt ccaaagagag gcaggggttc aagatgaaga     76140
     cattcttgac gccattaggt atcatacctc aggccgcccc ggcatgacac ttttagaaaa     76200
     agtcatttac gttgccgatt acattgagcc aaaccgggca tttcccggtg tcgatgaggt     76260
     gcgtaagctt gctgagacag atttgaatca agcgctgatt cagtccatta aaaatacaat     76320
     ggtttttctt atgaaaaaaa atcaaccggt ttttccagac acatttttaa cgtataactg     76380
     gcttgtgtct ggcagctgaa caggaggaat ttgtgaatga accaaaagtc cattttaaag     76440
     atcgcagctg cggcttgcga tgataaacgg gcagaggata ttttagcact ggatatggaa     76500
     ggtatttctc tggttgctga ttattttctg atctgccacg gaaattcaga taaacaggta     76560
     caggcgattg cccgtgaaat caaggatcaa gctgatgaaa acggcattca agtcaaaaag     76620
     atggaaggct ttgatgaagc aagatgggtt ctcgttgatc taggcgatgt agttgtccat     76680
     gtcttccaca aggatgaaag aagctactac aaccttgaaa agctgtgggg agacgctccg     76740
     ctcgcagatc ttgactttgg aatgaatcaa tgatttatca aggctttgca agcgtgtatg     76800
     acgagctaat gtcacacgcg ccttacgatc aatggacaaa atggattgaa gcatctctcc     76860
     cggaaaaagg ccgtattctc gatctggcat gcggcacggg ggaaatctcc atccggcttg     76920
     ccgaaaaagg cttcgaggtt acaggcatcg atctcagcga agagatgctt tctttcgccc     76980
     agcaaaaggt atcgagtagc cagcctattt tatttcttca gcaggatatg agagagatta     77040
     ccggctttga cggtcaattt gacgctgttg tgatatgctg tgactcatta aattatttaa     77100
     aaacaaaaaa tgatgtgatc gaaaccttta aaagtgtttt tcgggtatta aagcctgaag     77160
     gcatcctgct gtttgatgtt cattcatctt ttaaaattgc ggaagtcttt ccggatagca     77220
     catttgctga ccaggacgaa gatatcagct atatttggca gagctttgcc ggaagtgacg     77280
     agctttctgt cattcatgat atgtcgtttt ttgtgtggaa cggagaagcg tatgatcgtt     77340
     ttgatgagac acacgagcaa agaacgttcc cggtggaaga atacgaagaa atgcttaaga     77400
     actgcggctt tcagctccat cgcgtgacag ctgattttac ggataccgag ccatcagcac     77460
     aatcagaacg cctctttttc aaggcgcaga aatcaaaaac catcgtttcc taaaacgatg     77520
     gttttttaaa atgctttttt atgcttttgc agtacagacg aacgtatgac atactcgtct     77580
     acacatgaaa ctgctttttc actgcggaaa tatcctcctc gtacttcata tgagtatttt     77640
     gaaatacccg gtgaaacata tcctgcacac cgctttccag cgctttaatg ccttctcctg     77700
     ttacaccgcc tttaacgcaa accttttcct gtaatgcagg cagggtatac aattcggttt     77760
     ctaacagttt tcccattccg acaagcattt ccttacacat caaaatcgcg tcctgtttag     77820
     acactgatgt ttccgaaaca gctgcatcta taaaccgctg aatcagatag ctcataaaag     77880
     cggggccgca gcttacgatg tctgatgcaa ccctcgtgat gtcactttca atttgcagcg     77940
     gatgagagat atgctgcatc agctcattga ttttcgcttt tgcagattcg ccgcagcttg     78000
     tgccgaaagt gacgagagaa acacctgcca gcgctctgtt cgtaatactt gggatcactc     78060
     gcgccacttg acacggcaca tattgttcga gctgttcggt ttgaacgggg cttgtaattg     78120
     aaatgagaat atgatctttt cttaaataag gtaacgctct tgccagtaaa ggatatatat     78180
     caagcggctt aacacaaata aaaatcatct cgttttcaga aacgagcttt tcgagacttt     78240
     cggtaacgtt tatgctgttg tagcggtttt ttatgtgcaa cgctttttca attgtgcggt     78300
     ttgtgattgt catgtttgag ggatcggccg cttttgattc aataaatgat tcgataagga     78360
     tcgtacccat atttcctgtg ccgataaagc ctatcttcaa tggtttcccc tcctttgagc     78420
     tattatcctc taaaccatat gtgttatgaa aataaaatat gacgaaagcg gggaacatgc     78480
     acgatgaatt ggttgaatca gcataagaaa gcaattattt tagcggcttc tgcggctgtt     78540
     ttcacagcga ttatgatctt tctggccaca gggaaaaata aagagccggt gaagcaagct     78600
     gtaccaacag agacagaaaa tacagtggta aagcaggaag caaacaacga cgagtcaaac     78660
     gaaacaattg tgatagacat caaaggtgct gttcagcatc ctggcgttta tgaaatgcga     78720
     acaggggaca gagtatctca ggcaattgag aaagcgggcg ggaccagtga acaagcagac     78780
     gaagcgcaag taaatttggc ggagattctg caggacggga cagtggtgta catcccgaaa     78840
     aagggagagg aaacagcagt gcagcaaggt ggcggagggt ctgtccaaag cgatggaggg     78900
     aagggagcgc tggtgaatat caatacagca accttagagg agttacaagg catctcaggg     78960
     gtggggccat ccaaagctga agctattatt gcataccggg aggaaaacgg tcgtttccaa     79020
     acaattgaag atatcactaa ggtttcagga ataggtgaaa agtcatttga gaaaataaag     79080
     tcttccatta cagtaaagtg atttgacggt catgcattat gataggtaaa ctaaaggtca     79140
     ggcaacacaa catttggagg gaacaacgtg gaacgaattt catggaatca atactttatg     79200
     gctcaaagcc atttattggc gctgcgcagc acatgtccga gattatctgt cggcgctact     79260
     atagtcagag acaaacgcat gatagcagga ggctacaatg ggtcaatcgc gggcggcgta     79320
     cattgtgcag atgaaggatg cttaatgata gatgatcatt gcgcaagaac cattcacgct     79380
     gaaatgaatg cgattcttca atgctctaag tttggggtgc cgactgatgg agccgagatt     79440
     tatgtgacgc attatccgtg cattcaatgc tgcaaatcta ttattcaagc tggtatcaaa     79500
     acggtttatt atgctgagga ttacaaaaca catccgtatg cgcaggaatt atttgaacag     79560
     gcgggtgtaa ctgttgaaca ggttgaactc gatgaaatga tcgttgatct gaaaaacaga     79620
     gaaaagcttt catttgtagc gggtctaata gggaaattgg ctgatgccgg tttagcggag     79680
     gaagaattga aaaagataca tgaacaggcg aatacacttt tcacgagcta cgtgtgatga     79740
     atgcgtaatt cgcgcttatt attgcctatg gcggcagctt cggcaacggc tggaattact     79800
     gccgccgctt atttccccgc tatttttctt ttcatcctct ttctcctcat cattttaatc     79860
     aaaacgaggc acgcttttct tattattgtt tgtttcttct cttttatatt gttttttgta     79920
     ctgtatgcag tcacagattc tcagaatgtc tcttcctatc ggcagggaac ctatcaattc     79980
     aaggcagtga ttgacactat tcccaaaatt gacggcgacc gtatgtctat gatggttgag     80040
     acacctgata aggaaaaatg ggctgctgcg tatcgcattc agtctgctgg tgaaaaagaa     80100
     cagctgttat acatagaacc aggaatgtca tgtgagttga ctggtacatt ggaagaaccg     80160
     aatcacgcaa ctgtgccggg tgcatttgat tataacgagt atctttatcg gcagcatatt     80220
     cattggaact actctgtcac gtctatccaa aactgcagcg aacctgaaaa tttcaagtac     80280
     aaggtgctca gcttgagaaa acatatcata tcattcacaa acagccttct gcctcctgat     80340
     tcgacaggga ttgtacaggc acttacagtt ggtgacagat tttacgtgga ggatgaagtg     80400
     cttaccgcgt atcaaaagct tggtgttgtc catctcttgg caatatcagg actccacgtg     80460
     gggattttga cagcaggttt gttttatatc atgatccgcc ttggtataac tagagaaaag     80520
     gcgtcaattc tgttgctgtt atttctgccg ctctatgtga tgttgaccgg cgctgctcct     80580
     tcagtgctac gcgccgctct catgtcgggt gtttacttag ctggaagtct tgtcaaatgg     80640
     cgtgtccgct ctgcaactgc aatttgcctt tcgtacatcg tccttctgct cttcaatcct     80700
     tatcatctct ttgaagccgg ttttcagcta tcgttcgccg tcagtttttc tttaattcta     80760
     tcctcttcta tttttcagca ggttaaaacc tccttggggc agctgacaat tgtatcactc     80820
     atcgctcagc tgggctcgct tccgattctc ctatatcatt ttcatcagtt ttctatcatc     80880
     agcgtaccga tgaatatgtt gatggtacca ttttatacct tctgtatttt gccgggagct     80940
     gtagcaggtg ttcttctatt aagtctttcc gcttcgtttg ggagattgtt tttcagctgg     81000
     tttgatttat tgataagctg gatcaatagg ttaatcacaa acattgcaga tgttgatgtg     81060
     ttcacgatta tgatcgcaca tcctgcacct gttttgcttt ttttattcac agtcacgatc     81120
     atcctattgc ttatggcgat tgaaaaacgc tccttgtcgc agttgatggt aaccggaggc     81180
     atttgctgca cggtgatgtt tctgctcttt atatatccgt gtcttagttc cgaaggagaa     81240
     gtggatatga tagatattgg acagggtgac agcatgtttg taggtgctcc gcatcagcgg     81300
     ggtcgtgtct taattgatac cggcggcact ttgtcttact cgtcagagcc ttggcgcgaa     81360
     aaacagcatc cgttttcact gggggaaaag gtgctgattc cgtttttaac tgctaaggga     81420
     atcaagcagc ttgacgcttt aattctgacg cacgctgacc aagatcatat cggagaggcg     81480
     gagattctgc tgaagcatca taaagtaaag cgcctcgtga ttccgaaagg gttcgtttct     81540
     gaacctaaag atgagaaagt gctgcaggca gccagggaag agggagtggc aattgaagag     81600
     gtgaagcgag gcgatgtgtt gcaaataaag gatttgcagt tccatgtact gtcaccggaa     81660
     gcacctgatc cggcaagcaa aaataattca tctctcgttc tgtggatgga gacgggcggt     81720
     atgagctgga tcttgacggg tgatctggag aaagaagggg aacaagaggt gatgaacgtg     81780
     tttccgaata taaaagcaga tgtgttaaag gtggggcacc atgggagcaa aggctctacc     81840
     ggtgaagaat tcatccaaca gcttcagccg aaaacggcca ttatctcagc cgggaaaaac     81900
     aatcggtacc atcatcctca tcaaaaagtt ctgcaactat tacagagaca ttctatccgc     81960
     gtgctgcgaa cagatcaaaa cggaacgatc caatatagat acaaaaacag agttggaacc     82020
     ttttctgtct atcctccata tgatacatca gatataacag agacgaacta aaaaagactg     82080
     ccgagaaatc agcagcccgg gcagtcgctg ttatgaacca actaggtgaa taaccgttgc     82140
     catgacaaac aagaaggcga aaaatccgaa ggacacaaca aaaccaacag ctgaatctac     82200
     agcatcattt cgtttgcttt gaacgttttt ttcaaaatca ttcaacttta tccctcctga     82260
     ctgacttaag tataatggaa ttgttttgaa aaatctagaa gctaaggtaa cgttttctgt     82320
     tctggtgatt atcgcctttt tacaagctgt cccgggggct tgcgaacagg cgtttaatat     82380
     aaatggggaa gcagcagtca ggcttcctct ttactatttt gcaaactcaa tttaggatag     82440
     aaggggatga tgaaagagag gaagtcgtac aacaatggta tttgatgtgt ggaaaagcct     82500
     gaaaaaagga gaggtccatc cggtttattg tttatacgga aaagagacat atctgctgca     82560
     agaaaccgtc agcaggatca gacagacggt cgttgatcag gagacaaagg atttcaatct     82620
     gtccgttttt gatctggaag aggacccgct ggatcaagcg attgcagatg ctgaaacgtt     82680
     tccgtttatg ggggagcggc gtcttgtcat tgtgaaaaat ccatattttt taacaggtga     82740
     aaagaaaaaa gaaaaaattg agcacaacgt cagtgcgctt gaatcatata tacaatcacc     82800
     tgcgccttac acagtctttg tcctgcttgc tccgtatgaa aagcttgatg agcgaaaaaa     82860
     gctgacgaaa gcgttaaaga agcacgcgtt tatgatggag gcgaaggaat taaatgcaaa     82920
     ggaaacgaca gactttactg tcaaccttgc aaaaacagag cagaaaacaa tcggcacgga     82980
     agcggcggag catttggttc tgcttgtgaa cggtcatctg tcatcgattt ttcaggagat     83040
     tcaaaagctc tgcacgttta ttggagatcg tgaagaaatt acgctggatg atgtaaaaat     83100
     gcttgttgct agaagccttg aacaaaatat ttttgagctg atcaataaaa tcgtcaaccg     83160
     aaaacgaaca gagagtctgc aaatttttta tgatttgcta aaacaaaatg aagaaccgat     83220
     caaaattatg gcgcttattt cgaatcagtt ccggctgatt ctgcagacga agtacttcgc     83280
     ggaacaggga tacggacaaa aacaaatcgc ttctaatcta aaagttcacc catttcgggt     83340
     aaagctggcg atggatcaag caaggctttt ttcagaggag gagctccgtt taattattga     83400
     acagcttgcc gtcatggact atgagatgaa aaccgggaaa aaggacaagc agctcctgct     83460
     cgaactgttc cttttacagc tgttaaaaag aaatgaaaaa aacgatcccc attattgagg     83520
     atcgttttta tattatgcag aaagtccgtt cacttttttc gctagtcttg atttgtatcg     83580
     agctgcggta tttttgtgta caagacctgt tttcactgct ttatcaatac gtttagctgc     83640
     ttcagtaaga gcagttttcg ctttgtcagc ttcgttgttg gcaacagaag cttcaacttg     83700
     tttgattgca gtacgcatag cagatttgat tgtcgcgtta tgaacgccgc gttcgttgtt     83760
     tgtttttgta cgtttaatcg ctgatttaat gtttggcatg tgtttcacct cctaagatac     83820
     aacctgtagc acagtgtctt aaggttaaat cttcttcaca atagaacaaa ttgtattcta     83880
     tcaaacacac ctttagattg caatataaat gtaaagtatt tttcattgaa ggttctcttt     83940
     ttagcatgat ttattcagca aatggcaaca atataggtac ttaatgtgaa ggaggcccct     84000
     gtatgaaaaa gagtgagctg gatgtgaatc agtatttgat acggaccgat ttggcagtgg     84060
     aaacgaagga agcaatggcc aatcagcagg ctgtgccgac aaaagaaatt aaaggcttta     84120
     ttgaaaaaga gcgtgatcac ggcggcatta aaatccgcac agttgatgtt acaaaggaag     84180
     gcgcagagct ttcgggaaaa aaagaagggc gctatttaac gcttgaagca cagggaatca     84240
     gggagaatga ttcggaaatg caggagaagg tctctgctgt ctttgcggag gaattctcag     84300
     cttttcttga aaaccttaat atctcaaaag atgcgagctg tttgatcgtt gggctcggca     84360
     actggaacgt gacacctgat gcgcttggac cgatggcagt agaaaatctg ttggtaacaa     84420
     ggcacttgtt taagcttcag ccggaaaacg tacaggaggg ttacaggcct gtcagtgctt     84480
     ttgcaccggg tgtaatgggg ataacaggaa tcgaaacaag tgacattatt aaaggtgtga     84540
     ttgagcaatc gaagcctgat tttgtcatcg ccattgatgc gttggcggcg cgggcggtgg     84600
     aaagggtcaa cacaaccatt caaatatcgg atacaggcat tcacccgggc tctggagtgg     84660
     ggaataaacg aaaagattta agcaaagaca cgcttggtgt tccggtgatt gctatcggtg     84720
     ttccgacagt agttgatgcc gtgacaattg ccagcgacac ggtggactac atattaaaac     84780
     attttggcag agaaatgaag gataacaggc catcaagatc gcttgttccg gcaggcatga     84840
     cgtttgggaa aaagaaagtg ctcactgaag acgatcttcc cgatcaaaag cagcgccaat     84900
     cgttcctagg tattgtcgga acccttcaag aagatgaaaa acggcagctc attcacgagg     84960
     tgctttcgcc tttagggcac aacttaatgg ttacaccgaa ggaagtcgat tcatttatcg     85020
     acgatatggc aaatgtttta gcgaacggat taaacacagc gcttcatgaa aaagtgtcac     85080
     aagaaaacaa aggctcctac aatcactaaa cagttctact tcctctagct tgttcataga     85140
     gtaattacta gacaagcgct ggagggattc aatgagaaat aaacgcagaa acagacagat     85200
     tgttgttgcg gtaaatggag ggaaagcggt aaaagccatc tttctattta tcgtaagcct     85260
     tatcgtgatt tttgttctat ccggtgtgct gacgtctctc cggccggaac ttaggccgtc     85320
     gtctgactct ttttatggga ttgctgaaga attgccgggt gacgtatttg cacatttgct     85380
     gcagatggaa aaccattatt tcgcttctga cctctctcaa acagacagct catttcatct     85440
     ttctcgtctt tctttaaagc tggcgacgag cattaacctc gaagatccgc ggagctttct     85500
     cggtcgggag ctgccaggat ttgcacaatt tgataccgag attttgttag ctggacaagg     85560
     aacggattat acgaatatgc ctgcggaatc gccgccgccg tctaaggtga tggaggaaga     85620
     aagagaagcg aatttggcag agattgaaaa acagcaaacg caatcagata atgcgcaaaa     85680
     agatccgccg aaacaaacaa caggtgataa aaaggtcgtg tttatctatc acacgcacaa     85740
     tacggaatca tatctccctc tattaaaagg cgagaccgat cctgacatgg cgcgccattc     85800
     taaagccaat gtcacgcttg taggagatat gttcggacaa gcgcttgaat cccagggaat     85860
     cggagccaca gtgaataaaa ccgatataca gtcaaaattg aataaaaaag gcttaaacta     85920
     tgccaggtcc tatgatgaat caaggccggt cgtgaaagac gccctcgctt caaacaaaaa     85980
     tctgcaatat atcattgaca tccacagaga ctctcggcgc aaaaaagaca caaccgcaac     86040
     gattaaaggg aaaagctatg ccagggtagc ctttgtcgtc gggaaaaaaa gcaaaaactt     86100
     cgaagaaaac tataaaattg cgagtgagct tcataaactg atggagaaaa aataccccgg     86160
     acttagcaca ggtgtctttt ccaaaggctc gccaggcgat aatggtgttt acaatcagga     86220
     tttaaccgat agagcgcttt tgctcgagtt tggcggagtg gataataatc tcgaagagct     86280
     gcagcgtgcg gctaacgcgg ccgcggacgt attcagcgaa atgtactggg atgctgaaaa     86340
     ggtcaacgca gcgagcgggg agacgaaaaa acaataagaa ataggtggtt gatttgattg     86400
     catactttgg aaagtgctta ctgcttgtca cgatcatgtt tttaggcgtt ctgttcggca     86460
     tgcagcaggc aaaccacggg atgctgagta tgaaaggcta tcatgaccct tcactgaagg     86520
     gggcgtttac gctcaccgac ggaaaagata atgaaaaaga agcctcaatc ctaggagaaa     86580
     cagtcacggc aaaagattta gtagaaaaac aaaaagagct ggaaaaggtg gagacattca     86640
     atatgttttc aaaagccgga aaagcgcttt cggacaccgt aaccaatact gcccagtcaa     86700
     tgtatgaatg gatacgggat atgaatcaat aagtacgtga aagagaaaag caacccagat     86760
     atgataggga acttttctct ttcttgtttt acattgaatc tttacaatcc tattgatata     86820
     atctaagcta gtgtattttg cgtttaatag taggagtgat agattgtgac agataaagaa     86880
     aagcgtttag agaggcaatc gagaatacgg aatttctcta tcattgccca tattgaccac     86940
     ggaaaatcga ccttagcgga tcgtatttta gaaaaaacgt cggcaatcac tcaacgagaa     87000
     atgaaagaac aattgctcga ttctatggat cttgaacgtg agcggggcat aaccattaaa     87060
     ttaaactctg ttcagcttaa atataaagca aaagacggag aagaatatat ctttcatcta     87120
     atcgatacgc cgggacacgt cgacttcacg tatgaagtat cccgaagcct tgctgcctgc     87180
     gagggagcga ttcttgtcgt ggatgcagcc caggggattg aagcgcagac gctcgccaat     87240
     gtctacttag cgcttgacaa cgatcttgaa atccttccgg tcatcaataa aatcgacctt     87300
     ccgagcgccg agcccgaacg tgtgcgccaa gaggtagaag acgttatcgg ccttgacgca     87360
     tcagaagccg tgcttgcttc agcaaaagcc ggtatcggga ttgaggagat tttagaacaa     87420
     atcgtagaaa aggtgccagc tccgaccgga gatccggagg cgccgctcaa agcgctgatc     87480
     ttcgactcgc tttatgacgc ctaccgcggt gtcgtggctt atatcagagt cgttgaagga     87540
     acggtaaagc cgggacaaaa aatcaaaatg atggcaaccg gcaaagaatt cgaagtaaca     87600
     gaggtgggcg tgttcacgcc gaaagcaact ccgacaaatg aactgacggt cggtgatgta     87660
     ggcttcctga ctgcctcaat caaaaatgtt ggtgacacac gtgtcggtga tacaataacg     87720
     agcgctgcca atcctgcaga agaagcgctg ccgggatacc gcaagctaaa cccgatggtg     87780
     tactgtggtt tgtatccgat tgatacagcg aagtataatg atttaaggga agctcttgaa     87840
     aagcttgagc tgaatgattc ctcccttcaa tatgaagcgg aaacttcgca agcgcttgga     87900
     ttcgggttcc gctgcggatt tttaggcatg cttcacatgg agatcattca ggagcgaatt     87960
     gagcgtgagt tcaacatcga cctgattacg acagcgccaa gcgttatcta tgacgtgtat     88020
     atgacagacg gcgaaaaggt cgttgtcgac aacccgtcca acatgccgga tcctcaaaag     88080
     atcgaaaggg ttgaggagcc atacgtaaaa gcgacgatga tggtgccgaa tgactatgtc     88140
     ggcgctgtaa tggagctttg ccaaggaaaa cgcggcaatt tcattgatat gcagtattta     88200
     gacgcaaacc gtgtcagcat catttatgat atgccattag cggaaatcgt atatgagttt     88260
     tttgatcagc tgaaatcaag cactaaaggc tatgcgtcct ttgattatga actgatcggc     88320
     tacaaaccgt ccaagcttgt gaaaatggac attatgctga atggtgaaaa aatcgatgcc     88380
     ctttccttta tcgtgcatcg tgattacgca tatgaacggg gaaaagtgat cgttgaaaaa     88440
     ctgaaagaac tcattccgcg ccagcagttt gaagttccgg tacaagccgc aatcggccag     88500
     aaaatcgtgg cccgctccac cataaaagca atgcgtaaaa acgtattggc taaatgttac     88560
     ggaggggaca tctcgcgtaa acggaaactt cttgaaaaac aaaaagaagg aaagcgccgt     88620
     atgaagcagg tcggctcagt tgaagtgccg caagaagcat ttatggcagt tctgaaaatg     88680
     gacgacagtc cgaaaaaaca atagaagccg ccgcagtctt gtactgcggc ttctttctgt     88740
     aaagaaggtg aatccgttga aatcagctta tatccatatc ccattttgtg agcatatttg     88800
     ccactactgc gatttcaata aatattttat tcaaagtcag ccagtcgacg agtatttaaa     88860
     cgcactcgaa caggaaatga taaatacaat agcaaaaacc gggcagcctg atctcaaaac     88920
     aatctttatc ggaggaggca cgccgacctc cctgtctgag gaacagctta aaaagctgat     88980
     ggatatgatc aaccgcgtgc taaagccctc aagcgactta tcggaatttg cggttgacgc     89040
     gaatccggac gatttgtccg cagagaaatt aaaaatatta aaagaagcag gcgtaaatcg     89100
     ccttagcttt ggtgtgcaaa cgttcgaaga cgatctgtta gaaaaaatcg gccgagtgca     89160
     caagcaaaaa gatgtattca cctcttttga aagagcgcgg gaaatcggtt ttgagaatat     89220
     cagtcttgat ctcatgttcg ggcttccggg gcaaaccctc aagcatctgg aacattccat     89280
     aaacactgct ttatcattgg acgctgagca ttattccgtt tactccctta ttgtagaacc     89340
     gaaaacggta ttttataatt tgatgcaaaa agggcggctt catcttccgc cgcaggagca     89400
     ggaagctgaa atgtatgaaa tagtgatgag caagatggaa gctcacggca ttcatcaata     89460
     tgaaatcagc aactttgcta aggcaggcat ggaatctaag cacaatctaa cgtattggag     89520
     caacgaacaa tatttcggtt tcggagctgg cgctcacgga tatattggcg gcacacgaac     89580
     agtgaacgtc ggacctgtta agcattacat tgacctgata gctgaaaagg gttttccgta     89640
     cagagataca catgaagtga caacagaaga acagattgag gaagaaatgt ttttaggttt     89700
     gagaaaaaca gccggtgtca gcaaaaaacg attcgcagaa aaatacggcc gttccctgga     89760
     tggacttttc ccaagcgtgt taaaagacct cgctgaaaaa gggctgattc acaattcgga     89820
     gtctgccgtt tatttgactc atcaaggaaa ttattaggca atgaagtttt tggcgctttt     89880
     tttgggtgag ttataattga catttttctt gtggtttgat acttttgtta tagaattagc     89940
     actcgcttat tgagagtgct aacagaggtg atgatgatgt taacaaatcg tcagctgctg     90000
     atccttcagg ttataatcaa cgattttatt aaatcggcac agccggtggg atcaagaact     90060
     ctttcgaaaa aagatgaaat cacatttagc tctgcaacaa taagaaacga gatggctgac     90120
     ttggaggaat tgggctttat tgaaaaaacc cattcatcct caggacgtgt tccgtcagaa     90180
     aaagggtatc ggtactatgt tgaccatttg ctgtcacccg tcaaattgac gaaaagcgac     90240
     ctggaccaaa tccactcgat cttcaaagag aaaattttcg agctggagaa gacagttcaa     90300
     aaatcagcgc aaattttgtc cgatctgacg aattacacat ccatcgtact cgggccgaag     90360
     ttgagtgaga attaccttaa acagattcaa atcattccga ttcagcctga tatggcggta     90420
     gcgattctcg ttaccaatac ggggcatgtg gaaaacaaaa cgattaactt tccgaccaaa     90480
     atggatctgt ctgatattga aaaactggta aatatactga acgaccgttt aagcggcgtt     90540
     ccaatggatg aactgaatga gcgcatattt aaagaagttg tcatgtacct aagacagcac     90600
     attaaaaact atgacaatat actcgacgcg cttcgttcaa cctttcattc cacaaatcac     90660
     gttgaaaagt tgttttttgg cgggaaaatc aatatgctga accagcctga gttccatgat     90720
     atcacccgag ttcggtcgct gctttcatta attgagaaag aacaggatgt tttaaagctg     90780
     gttcaatccc cgcacacggg aatttcgatt aaaatcggaa aagaaaacga ctatgaagag     90840
     atggaaaatt gcagtctgat tacggcttct tattccgtag accagaagca gatcggctca     90900
     attgcgatta tcggcccgac ccgcatgaat tattccaggg ttgtcagcct gcttcagcat     90960
     gtgacttcgg acttgtcaaa agcattaaca agtctgtatg atgaataagg gaattttggc     91020
     aaattttatc gaagggcagc acctgtcctt ctccttacac tttgagggag gtgaacacaa     91080
     tgtcagaaga aaaacaaacc gttgaacaaa acgaaacaga agagcaagaa atcattgaag     91140
     aacaagctgc cgctgatgaa cagcaggaag aaacaaatga aagcgaactt cttcaaaacc     91200
     aaattaacga attgcaaggt ttgcttgagg aaaaagaaaa caaacttttg cgtgttcaag     91260
     cagactttga aaactataaa cgacgcagcc gtttagagat ggaagcgtcc caaaaatacc     91320
     gttctcaaaa tatcgtgact gatttgctgc cggctcttga cagttttgaa cgagcgcttc     91380
     aggttgaagc cgacaatgaa cagacgaaaa gtttgctcca gggaatggaa atggtccacc     91440
     gtcagctcgt agaagccttg aaaaaagaag gcgtcgaagc catcgaagct gtagggcagg     91500
     aatttgatcc taatctgcac caagctgtta tgcaggctga agacgaaaac tacggctcca     91560
     acattgttgt tgaggaaatg caaaaaggct ataagctgaa ggatcgcgtc attcgccctt     91620
     ccatggtcaa agtgaatcaa taattacata gcaggaggtt attcaagtga gtaaagttat     91680
     cggaatcgac ttaggaacaa caaactcatg tgtggcagtg cttgaaggcg gcgagcctaa     91740
     agttattgct aacgctgaag gaaaccgcac aacgccatca gttgttgcat ttaaaaacgg     91800
     cgaacgtcaa gtaggggaag tggctaaacg ccaatctatt acaaacccta acacaattat     91860
     gtctatcaaa cgtcatatgg gtactgatta taaagttgaa attgaaggaa aggattacac     91920
     tccacaagaa gtgtctgcta tcatccttca acaccttaaa tcatacgctg aaagctatct     91980
     tggcgaaaca gtatcaaaag cagttatcac agttcctgca tactttaacg atgctgagcg     92040
     tcaagcaaca aaagacgctg gtaaaattgc aggtcttgaa gtagaacgta tcatcaacga     92100
     gccgactgca gcagcgcttg catacggact tgataaaaca gatgaagatc aaacgatcct     92160
     agtatacgac cttggcggcg gtacattcga cgtttccatc cttgagcttg gcgacggtgt     92220
     attcgaagtt cgttcaactg ccggcgacaa ccgtctgggt ggggacgatt ttgaccaagt     92280
     tatcatcgat catctggtgt ctgaattcaa aaaagaaaac ggcattgatt tgtcaaaaga     92340
     caaaatggcg cttcagcgtt tgaaagacgc agctgaaaaa gcgaaaaaag atctttccgg     92400
     cgtatcttct acgcaaattt ctttaccgtt tatcacagct ggagaagcag gaccgcttca     92460
     ccttgaactt acattaactc gcgctaaatt cgaagagctt tcttctcatt tagtagagcg     92520
     cacaatgggt cctgtccgtc aagcgcttca agatgcagga ctttctgcaa gcgaaatcga     92580
     caaagtcatc cttgtcggcg gatcaactcg tatccctgcc gtacaagaag caatcaaaaa     92640
     agaaactgga aaagaagcgc ataaaggcgt aaacccggat gaagttgtag cgcttggtgc     92700
     tgcgattcag ggcggcgtta tcacaggtga cgtaaaagat gttgttcttc ttgacgttac     92760
     accgctttct ctcggtatcg aaacaatggg cggtgtgttt acaaaactga tcgaccgcaa     92820
     cacgacgatc ccaacaagca aatctcaagt gttctcaact gctgctgata accaaacagc     92880
     tgttgatatc catgttcttc aaggtgagcg cccaatgtct gccgacaaca aaacactcgg     92940
     ccgcttccag cttactgata tcccgccagc accgcgcggc gtgcctcaaa tcgaagtttc     93000
     tttcgatatt gacaaaaacg gtatcgtaaa cgtaagagca aaagacttag gcacaggaaa     93060
     agaacaaaac attacaatca aatcttcttc aggtctctca gatgaagaga tcgaacgcat     93120
     ggtaaaagaa gcggaagaaa atgctgacgc tgatgcgaag aaaaaagaag aaatcgaagt     93180
     ccgcaacgaa gcagatcagc ttgttttcca aactgagaaa acattaaaag atcttgaagg     93240
     caaagtggac gaagaacaag tgaaaaaagc caacgatgcc aaagacgctt taaaagcagc     93300
     gattgagaaa aacgaatttg aagagatcaa agcgaaaaaa gatgagcttc aaacaatcgt     93360
     tcaagagctt tctatgaagc tttatgaaga agctgctaaa gcacagcaag ctcaaggcgg     93420
     agcaaacgct gaaggcaaag cggatgacaa cgttgtcgac gctgaatacg aagaagtaaa     93480
     cgacgaccaa aacaaaaaat aagttctttt tagtgtcagc cccgcttccg gagctgaccg     93540
     aaaagaacac atttcataat ctgattcaat gattagaaag tcaaagtcag gcatctcttg     93600
     gctttgactt tttttcttgc ccgggataaa aggaattgaa aaatcataat tcaaaatgat     93660
     acaatctaat ttatgtgaga aattcgggag agtgaagcga gatgagtaag cgtgattact     93720
     atgaagtgct gggagtaagt aagagcgctt caaaggatga aattaaaaaa gcttatcgga     93780
     agctgtcaaa aaaatatcat cctgatatta acaaagaagc cggatcagat gaaaaattta     93840
     aagaggtaaa agaagcatac gaaacgctgt cagatgacca aaaacgtgcg cattacgatc     93900
     aatttggtca cactgaccct aaccaaggct tcggcggcgg aggttttggc ggcggcgatt     93960
     tcggcggttt tggtttcgat gatattttct caagtatatt cggcggaggc acaagacgaa     94020
     gagatccaaa actccgcgcc aggggtgctg atttacagta tacgatgacc ctgtcgtttg     94080
     aggatgcggc tttcggtaaa gaaacaacca tcgaaattcc ccgcgaggaa acgtgcgaaa     94140
     catgtaaagg ctcaggtgcg aaacctggaa caaatccaga aacatgctcc cactgcggag     94200
     gctccggcca gttaaacgtg gagcaaaata caccgtttgg aaaagtcgtt aacagacggg     94260
     tctgccacca ctgtgaaggt acaggcaaaa tcattaaaaa caaatgtgcg gactgcggcg     94320
     gcaaaggaaa aatcaaaaaa cgcaagaaaa tcaatgtgac aattccagcc ggtgtagatg     94380
     acgggcagca gcttcgtctc tcgggacagg gtgaaccagg aataaacggc ggcctgccgg     94440
     atttatttgt cgtgttccat gtacgcgcac acgagttctt cgagcgtgac ggcgatgata     94500
     tttactgtga aatgccgtta acgtttgctc aggctgctct tggagatgag gtagaagtgc     94560
     cgacgctgca tggaaaagtg aaaattccgg ccggtacaca aacaggaacg aaattcagat     94620
     taagaggcaa aggcgttcaa aatgtcagag gctatggaca gggtgaccag catatcgtcg     94680
     tccgcgtcgt tacgccgaca aatctgactg ataaacaaaa agacattatc cgcgaatttg     94740
     ccgaagtcag cggaaacctg cctgacgaac aggaaatgag tttctttgac aaggtaaaac     94800
     gcgcgtttaa aggcgattaa ttattggatg aggagttggt agttttgaaa tggtccgaat     94860
     taagcattca cacaacacat gaagcggtcg aacctatctc aaatatattg catgaagctg     94920
     gtgcaagtgg ggttgtgata gaggacccgc ttgatttaat taaagaacgt gagaatgtgt     94980
     acggggaaat ctaccagctc gaccccaatg attacccaga tgagggtgtc attgtcaaag     95040
     catatctgcc ggttaacagt tttctgggcg aaactgtaga cggcatcaaa gaaacgatta     95100
     ataatctcct tctttacaat attgatttgg gcagaaacca catcactatt tctgaagtaa     95160
     atgaagaaga gtgggcgact gcctggaaaa agtattatca tcctgtgaaa atttctgaaa     95220
     agtttacaat tgtgccgacg tgggaggaat atacgccggt ccatactgat gaactgatta     95280
     ttgaaatgga cccgggaatg gctttcggca cagggacaca tccgacaacc gtactctgca     95340
     ttcaggcgca tgaacgcttt gtgcaaaagg gtgataaggt gattgatgtc ggcactggtt     95400
     cgggaatttt aagtattgcg gctgcaatgc ttgaggctga atcggttcat gcctacgatc     95460
     ttgatcccgt ggctgtagaa agtgcacgcc tcaatctcaa gctgaacaaa gtcagcgata     95520
     ttgctcaagt gaagcaaaac aatttgttag acgggattga aggggaacat gatgtcattg     95580
     tggccaacat tttggctgaa gtcattcttc gctttacttc acaagcgtac aggctgttaa     95640
     aagaaggcgg tcactttatt acgtcaggaa tcatcggtca taaaaaacaa gtagtaaaag     95700
     aagcactgga acaagctggc tttaccattg tagaaatcct ttcaatggaa gattgggtca     95760
     gcattattgc gaaaaaataa cagttagtag gtgtcacagc gtatgcaacg atattttatc     95820
     gagctcacga agcagcaaat agaggaagcg ccgacttttt cgattaccgg cgaagaagtt     95880
     catcatattg tgaacgtgat gagaatgaat gagggagatc agattatctg ctgctctcaa     95940
     gacggcttcg aggcaaaatg tgaacttcaa tctgtttcca aagataaagt gtcctgcctt     96000
     gtgatagaat ggacgaatga aaacagagag cttccgataa aggtctatat tgcgagcggc     96060
     cttccgaaag gagataagct tgaatggatt atccaaaagg ggactgagct cggagctcat     96120
     gcctttattc ctttccaagc cgcgcgttct gttgtcaagc tggatgacaa aaaggcaaag     96180
     aaaaagcggg aaagatggac gaaaattgcg aaggaagcgg ctgagcaatc gtaccgtaac     96240
     gaagtgccgc gagtgatgga tgtccattct tttcagcagc ttcttcaaag gatgcaggat     96300
     ttcgataaat gtgtcgttgc atacgaggag tcatcgaagc aaggggaaat aagcgcattc     96360
     agcgcgattg taagcagcct tccgaaagga tcatctctat tgatcgtatt tggtcccgaa     96420
     ggcggtttaa cagaagcgga ggttgaacgg ctcacagagc aagacggtgt gacgtgcggc     96480
     cttggaccga gaattttaag gacagaaacc gctccgctat acgcgttgag tgcgatttct     96540
     tatcaaacag agttattaag aggtgatcag taatggcaac tgttgctttc catacgcttg     96600
     gctgtaaagt caaccattat gaaacagaag caatctggca gcttttcaaa gaagcgggct     96660
     atgaaagaag agactttgaa caaacagctg atgtatatgt cattaataca tgtacggtta     96720
     caaatacggg agataaaaaa agccgccaag tgatcagacg cgccattcgt caaaatcctg     96780
     acggtgtcat ctgtgtcaca ggctgctacg cgcaaacctc acctgctgag attatggcga     96840
     tccccggtgt cgacattgta gtcggaacac aggaccgtga aaaaatgctt ggctacattg     96900
     accaataccg agaagaacgc cagccgatta atggcgtcag caacatcatg aaagcaagag     96960
     tatatgaaga gcttgatgtg cctgctttca cggaccgcac aagagcgtca ttgaaaatac     97020
     aggagggctg caataatttc tgcacattct gtatcattcc gtgggcgaga ggcctgctcc     97080
     gctcccgcga ccctgaagaa gtcattaaac aagcgcagca gcttgtcgat gccggatata     97140
     aggaaattgt tcttacgggt attcatacag gcggctacgg cgaagatatg aaagattaca     97200
     acttcgcgaa gcttttgagc gaattagaca cccgtgtgga aggcgtgaaa cggatcagaa     97260
     tttcttcaat cgaagccagc caaatcactg acgaagtgat cgaggtctta gaccgctcag     97320
     ataagatagt gaatcatttg catattccta tccaatccgg atcaaacaca gtgcttaaac     97380
     ggatgagacg caaatataca atggaattct ttgcagaccg tttaaataaa ttgaaaaaag     97440
     cactgccagg cttagctgtt acttctgatg tcatcgtcgg gttccctgga gaaacagaag     97500
     aagaatttat ggaaacctat aactttatta aagaacataa attctctgag ctgcatgttt     97560
     tcccttacag taagcgtaca ggaacaccag ctgcacgaat ggaagaccaa gtggatgaaa     97620
     acgtgaaaaa cgaacgtgtg caccgcctga ttgctctttc tgaccagctt gcaaaagaat     97680
     acgcttctca gtatgaaaat gaagtgcttg agattatccc tgaggaagcg tttaaggaaa     97740
     cagaagaaga aaatatgttt gtcggttaca cagacaatta tatgaaggtt gttttcaaag     97800
     gtacggaaga tatgatcggc aaaatcgtaa aagtcaaaat cctaaaagca ggttatcctt     97860
     acaacgaagg acagtttgtc cgtgtggttg aggatgaaat aactgaacac atgcgtttgt     97920
     cttcttaacc taaaaaatcg gtgcattaaa atgtaccgat ttttttattt agccgggata     97980
     agaaggtgaa tcaatcggta aaacaagttt gtaagcggaa gaaataaaag agctgtcacc     98040
     acattaaata aaaggctgaa atgcgcgatc ttttgtgcgg gatcaggtga taactgctct     98100
     acaaagccgg tcgctgcggt cagaaaaggc aatactagag ccacccctag cacgttaaat     98160
     accacatggg catatgctgt ctgtttcgcc gcatatccgc cggatacagc agccatgaca     98220
     gctgtaatgc atgtcccgat atttgatccg agtacgacgc tcatcgcctg tgtcagtccg     98280
     ataatccctt cattcataaa actcatcaaa atgccgatac agacagaact ggagtgaatg     98340
     atggcagtta acaccatgcc gatgagcaaa gcggaccagt ttgaatcgtt aacatggtat     98400
     agaacgtcgg cgcccgtttt cagctttgtc agcggcccgg caagatggct gaatccgctg     98460
     atgcaaaaga agatgatgcc cagtccaagg aagcttgttc ccagctgttt caaaggatac     98520
     ctgccagtca gaaaaaacaa taaacctcct attaaaagaa cccaaatcac aatatccatt     98580
     ttgatagcaa taaattcagt tgtaaaagta gagccaacat ttgtccccag aatcatcggg     98640
     atcgtccgct taaaagaaag aacgcccgca cttacaaagc cgatgacaat gaccataaag     98700
     gctgagctgc tctgaagtat ccccgtaaat acaatactga taagaaacgc ttttaacgga     98760
     tggtctgtaa ataaaagcaa acgttcttca atttttgagt acgccattga aattaagccc     98820
     tttcgaagca tgttcatgcc tgcgagaaag gataatataa gagcagtaaa gctaatcaga     98880
     attaacatcc tattcaccaa cccctttctt tcattatata gacaggcagt cgcactcatg     98940
     acggaaaagt gaactcactt agttgacctg actgatggct tatattataa tgtcaaagta     99000
     catgtttata tgtgtaactt aaaggtagtc gattggtgta ttcggaggga gggaaagaga     99060
     atgtcaaaaa cggtcgttag aaaaaacgaa tcgcttgaag atgctcttcg tcgcttcaaa     99120
     cgcagtgtat caaagacagg tactttgcaa gaagcaagaa agcgtgaatt ttatgaaaaa     99180
     cctagcgtaa agcgcaagaa aaagtctgaa gctgctagaa aacgcaaatt ctaaaagagg     99240
     gtggatttat gagtcttctt gagcgtctca accaggatat gaagctgtat atgaaaaacc     99300
     gtgagaaaga caaactgact gtcgttcgaa tggttaaggc ttcacttcaa aatgaagcaa     99360
     ttaagcttaa gaaagacagt ttgaccgagg atgaggaact cactgtcctt tctcgtgaac     99420
     ttaagcaacg taaagactcc ctccaggaat tttcaaacgc taatcgttta gatttagtag     99480
     ataaagttca aaaagagctg gacattttag aagtttattt acctgagcag ctgtcagaag     99540
     aagagctgcg tacaatcgta aatgaaacca tcgcggaggt cggtgcgagc tcaaaagcgg     99600
     acatgggcaa agtgatgggg gcaattatgc ctaaagtaaa aggtaaagct gacggaagtt     99660
     taattaataa gcttgtgagc agtcaactgt cttaaatggc aaagaaaagg acatctttct     99720
     aagagagatg tcttttttta tacataaaaa aatgaaacct ttgatacatt tgttacgtat     99780
     gaagagaagg cacttattat aaaaggaagg agggatacac cgcccttgct tcaaatcaaa     99840
     ggattccgtg ctgctctttt gggtatattt ttactttctt tattaggcgt acagctgaac     99900
     gcaaaagcag aaaaacaaac tgtttatgtg atcccggttg aaaaaaatgt cgaacagggt     99960
     ctcgcctcgt ttttgtcccg ttcgttacaa gacgcaaagg atgcacatgc agaccatatt    100020
     attcttgata tcaatacccc ggggggattg gtcaaatctg ctattgatat ggccgatttg    100080
     ataaccgaaa gcgagatccc cgtaactgca tatgtcaaca aacgcgcgtt gtctgctggt    100140
     gcatatattg cacttcaagc agatcacatt tatatggcgc ctggcggaaa aatgggagcc    100200
     gccgcgattg ttgatggcca aggcaatgcc gctgaccaaa aagctcaatc actttggctg    100260
     gcagagatgg aagatgccgc agtgaaaaat aaccgcgatc caaaatatgc gctcgcaatg    100320
     gctgacccag atatagatgc caaggaagtt ggcgcgccta agggagatct gctgacactt    100380
     aacgcagaca aggcgattga ggtaggctat tcagaaggca ctgctgacaa tttgtccacg    100440
     ctcgtaaaga agcttgggtt cgaaaaggcg cagatcagct atgcaaagga gagctttgcg    100500
     gaaaagacgg caagatggct gacgaatccg gtcattgtcc ctattctgct gacaatcgct    100560
     tttttaggtc tgacggtaga gcttttttcc ccgggtgtcg gcctccctgg aacggctgga    100620
     ctcattgcgt tattgctgtt cttttacggg catcttgcag ccggccttgc cgggtatgag    100680
     acggttctcc tctttatagc aggggtgatt ctcattctgc ttgagatttt tcttcccgga    100740
     ggaatcattg gattactggg cttgggagcg attattgcga gcctgttttt agccgcgggg    100800
     agcttcactg tcatggcggt ttctctcttg atcgcctcag ctgtttcgat tacagctttt    100860
     attttactga caagggtgtt gggaaagcgt atgaaattct ttaagaaatt gatattaaat    100920
     gattctacaa acacggagag cggctacgtt tcaaatcaaa cgcgcacgga cttaatggga    100980
     aaagtgggta taacctttac accgctgcgt ccttccggta ccgtgattat tgatgatgaa    101040
     cgccttgacg ttgtatcgga gggatcgttt acagaaaaag ataaaaaagt aaaagtgata    101100
     aaagtagaag gctcacgcat tgtcgtgaga gaaatttaaa tagaaacgag gagaagttat    101160
     atggatccgt caacacttat gattctggca attgtcgcag tagcgatcat tgttttggca    101220
     gtatttttta catttgtgcc tgtaatgctt tggatttcag ctttggcagc cggagtgaaa    101280
     atcagcattt tcactctagt tgggatgagg cttcgccgcg tcattccgaa tcgggttgtt    101340
     aacccgctga ttaaagcgca taaagcggga cttaatgttg gaacaaacca gcttgaaagc    101400
     cactatctgg ctggaggtaa tgttgacaga gtcgtcaacg cgcttatcgc cgctcagcga    101460
     gctaacattg aactcacatt cgagcgctgt gctgccattg atcttgcagg ccgggacgtg    101520
     ttggaagctg ttcaaatgag cgttaatcct aaggtgattg aaacaccgtt cattgccggc    101580
     gtcgcaatgg acgggattga agtgaaagcg aaagcgagaa tcacagtaag agcgaatatc    101640
     gagcgcctcg tcgggggagc aggggaagaa accattgtag ctcgtgtagg tgagggaatc    101700
     gtttctacaa tcggttcatc tgataatcat aaaaaagtgc ttgaaaaccc tgacatgatt    101760
     tctcagacag tccttggaaa aggattggac tcaggaactg cgtttgaaat tctctcaatt    101820
     gatattgcag atgtagatat cggcaaaaac atcggggcaa ttttacaaac cgatcaggcc    101880
     gaggctgata aaaacatcgc gcaggcaaaa gcggaagaac gacgtgcgat ggctgtcgct    101940
     caagaacagg aaatgcgtgc ccgcgtagaa gaaatgcgcg cgaaagtagt agaagccgag    102000
     gcggaagtgc cgcttgcgat ggcagaagct ttgcgtgaag ggaatattgg cgtcatggat    102060
     tacatgaata tcaagaacat cgatgctgac acagaaatgc gtgattcatt cggcaagctg    102120
     acgaaagacc cttcggatga agaccgcaaa tcataatctc tctaagaagg gagaacgctg    102180
     atggaagatt tactgaccaa tccgcttatt attgcagcga tcatcggaat catttctgcg    102240
     attttcggca aaaagagcaa agaagaaaag caaaacagcc aaaaaagaaa aaaacctcaa    102300
     cacgtgcaat ctgcttctcc tcaaaagaag cagtcaaaag aagatgcccc tgcacctatc    102360
     cctaaccgta tggtacaggc aagacgggaa gcggaagaaa gacgcaggga aacagcaaga    102420
     aacctgaaag ggctggaacg agatcttgct gctgccaaac aaaaaacagt atacacaaaa    102480
     caaaaaatgc ttcaggtgaa taaagacacc gtcgtacagg ggatcgttct aggagaggtg    102540
     ttcggacctc cacgggcgaa aaaacctcac cgtacgatgc gcccggcccg taaaaattaa    102600
     agtgttagaa cctcctttca aatcatacac atgagatgaa agggggttct ttttgtatgg    102660
     ggcaaagaaa gaatcgtatg aaagcttggc tgacaagagc attggaaatt cccccggacg    102720
     ttatgatgga tctgccgagg attacaatgg ttggcagact tcatatctac atagaaaacc    102780
     acagaggcct tttgcttttc agtgagaatg aagtgcggct gatgctgaag cagggccagt    102840
     gcatcatatc tggtaaaaat tttgtcatca aggcgattct tccggaagag atacttttgg    102900
     agggtacgat tgatgtcgtt cgatatgttg agtcataaag ccgaggggga aatgttgtga    102960
     aaaataaatg gctgtctttt ttttcgggta aggtccagct tgaattgacg ggaagaggga    103020
     ttgagcggct ccttaatgaa tgcacaaaac aggggattcc ggtctttcat gtcaaaaaaa    103080
     agaaagaagc cgtatcgtta tatatacagc ttcaggatgt acatgccttt cggcgggtaa    103140
     gaagtaaatt taaatgtaaa gcccgattta tcaatcggaa gggatttccc ttcctgttgc    103200
     tgaaatcaaa gctgaatata gggtttacga tcggttttgc gatttttttc attcttttgt    103260
     ttttgctgtc caatatggtg tggaaaattg atgtgacagg cgctaagcct gaaacagaac    103320
     atcaaatgag gcagcatctt aatgaaatcg gcgtcaaaaa gggccgtctg cagtttttaa    103380
     tgatgtcgcc cgaaaaaata cagaaatcat taaccaatgg aatagacaat atcacttggg    103440
     tcggagttga tctgaagggg acgaccattc atatgaaagt tgtggagaaa aatgagcccg    103500
     aaaaagaaaa atatgttagc ccgcgcaata ttgtcgccaa aaagaaagca accattacga    103560
     gaatgtctgt gcaaaaagga cagcccatgg ccgccataca cgatcatgtt gaaaagggac    103620
     agctgcttgt ttcgggactg atcggcagcg aagaccatca gcaggaagtc gcctcaaaag    103680
     cagaaattta tggagaaacc tggtatagat cagaagtgac agtcccgctt gaaacattat    103740
     ttaacgtcta tacgggcaaa gtaaggacaa agcacaagct ttcttttggt tctttggcaa    103800
     tcccgatctg ggggatgacg tttaaaaaag aggaattgaa gcatccaaaa acagaacaag    103860
     aaaagcattc gcttcatttt ctcggattta agctccctgt atcctatgtc aaagagcaaa    103920
     cgagagaaag tgaagaggct ttgcgaaaat atacaaaaga agaagcagtt caagaaggca    103980
     ttaaattggg taaacaggat gtagaggata aaataggcga aaacggcgag gtgaaaagtg    104040
     aaaaagtttt gcaccagact gttgagaatg gtaaagtaaa gttgattatt ctctaccaag    104100
     ttatagaaga tatcgttcaa accacaccta ttgtcaggga gactgaagaa tgacagaaca    104160
     tttacttgcg atgaatcaaa aactgaaaaa cccggacgag gcgctttcac tcttcgggaa    104220
     ccaagattct tttttgaaat tgatggagaa agatctgaat ttaaatatca ttacgcgcgg    104280
     cgagacgatt tatgtttcag gcgatgatga atcgtttcag attgcagaca ggctgctggg    104340
     atcgctcctc gctttaattc gcaaggggat agagatctct gaacgtgatg tgatttacgc    104400
     catcaaaatg gcaaagaaga atgaacttga atactttgaa agcatgtatg aagaagaaat    104460
     tacaaaaaac gcaaaaggca aatcaatccg tgtaaaaaca atgggacagc gggaatacgt    104520
     ggccgctatg aagcggaatg accttgtatt cggcattggt ccggcgggaa ccgggaaaac    104580
     gtacctggct gtcgtaaaag cagtccatgc tttaaaaaac ggacatatca aaaaaatcat    104640
     tttaacaaga cctgccgtgg aagccggtga aagccttggt tttctcccag gtgacctaaa    104700
     agaaaaagta gatccttatt tgcgcccgct gtatgacgct ctccatgatg tgcttggggc    104760
     agatcataca gaacgtctga tggaaagagg catcattgaa attgctccgc tcgcatatat    104820
     gaggggacgg acgctcgatg atgcttatgt tatacttgat gaagcacaga ataccacgcc    104880
     tgctcaaatg aaaatgtttt tgacgagact gggttttagc tctaaaatga tcattacagg    104940
     tgacgttagc caaattgatc tgccgaaagg cgtcaaatcg ggacttgcag tagcgaagga    105000
     gatgctgaaa ggaatagacg gcatttctat gattgagcta gaccagacag acgtggtcag    105060
     acatccgctt gttgcgaaaa ttattgaagc atacgataag caaaattaat gctgaatgac    105120
     ccgatcgccc gttatcgggt catttttatg attgcttatg ggcttgatgt ttcaagagga    105180
     ggttcttgtg ttgaaaaaga aggctaagac caaaagcagc tcaaaaaaat ggagcagttt    105240
     taaaaatgcc cgctccatgc atgtactgct gtatcttctg ctggctgcca ttatgtttgc    105300
     tttgctcttt gtacatgtta agccggaaac acttgattta gacctgtttt cagtcagcga    105360
     caagaccatt tacgctccgg caaccgtaga agatcaaaaa gccacagagg aaaaaaagca    105420
     agccgctgag gacgcggttg aagatcaata tacattaaaa aaagaatata cagacaatcg    105480
     gattgacctt gtgtcatcaa tattcgacag tattagtgaa gtgaaaaaat catcggaaga    105540
     aggcagtaaa tcaccatcgg aaaaatcaat ggtcaaatct gtaaaggaca aattgacatc    105600
     agatgtgaat gattctatat cggaggattc catcaagaca ttgctgaaag cagacagtga    105660
     agacttttct tttgtcagag atacggtcat taccgcggta aatacggtca tgagcagtga    105720
     aatcccttcg gataaactat ctgatgcaaa ggataaggta gaaaaagagc taaagagcaa    105780
     ttctattccg tctaaatact tgggagccgc gacagaaatc gggcgttttg ctattattcc    105840
     gaattacgtc ttcgatccga aagcaacaga ggcaaaacgg caggaagcct cagataatgt    105900
     ccagcaggtt caaatcaaac aggggcaagt gctcgtggaa gaaaatgacc tcattgatcg    105960
     ggaagtgtac aggaaacttg agctgaccgg gttattaaat aactcaaatc tctttaaacc    106020
     gatcagcggg ctattgatta tgatcggact tttcattgca acacttgtat attattttga    106080
     aaaacagaaa caaaatctga agtttaaaaa ccaatccatt ctgttattct ccataatcac    106140
     aacacttttg cttgtgatca tggaggttgt cagtttgttt cagaagatgg agtataataa    106200
     tatcggctat ctggtcccca ttgcggccgg cgccatctta atcaaactgc tgatgaatga    106260
     acgcattgcc attttgggaa gtatcattct tgcgatttgc ggaagtatga tgtttaatca    106320
     gggtgtgaca ggaacattca attatgtcat agggatttat tatttgatca gcggcatttc    106380
     aggtgtatta tttttaggaa aacacaatgc aagatcaaag attttgcaga ccggactttt    106440
     cgtggcgttt attaatatgg ttgtcgttct atccttatta ttgatccaga acactgcgct    106500
     gtcgggtctt gaaatcggca cgttaatgct catgggggtt gtgtcggggt ttgcttcatc    106560
     tgtattgatc atcggtctga tgccgttttt tgagacgggc tttggcattt tatccaccat    106620
     gaggctgctc gagctgtcta atcctaacca tccgctattg cgcaaaatac tgacggaaac    106680
     accaggtaca tatcatcaca gtgtaatggt tgccaattta tcagaggcag cctgtgaagc    106740
     ggttggggct aatggtttgc ttgcaagagt cggcgcatat tatcacgatc tcggaaaaac    106800
     aaagcgcccg caatatttta ttgaaaacca aatgaatatt gacaatccgc atgacaagct    106860
     gtcacctcag ttgagcaaaa atattattat ctcgcatacg acagacggtg cgaatatgct    106920
     gagaagctat aaatttccga aagagcttgt cgatattgct gagcagcatc atggaacctc    106980
     gcttttaaag tttttttact ataaagcgaa ggaaaaaggc gaccagatta cagaggaaga    107040
     gttccgttat ccgggaccga agccgcagtc aaaggaagcc gcaattatat cagtggccga    107100
     cagtgttgaa gcggccgtca gatccatgca caatccaaat cctgaacgaa ttgaaaagct    107160
     tgtccggggt attatatccg ataagcttca ggacggacag ttcagtgaat gcgatttgac    107220
     atttaaagag ctggatacaa tcgcaaaaac gctctgtgca acattaaaag gaattttcca    107280
     ctcccggatt gaatatccgg aggctactaa gaaggtgaaa tagatgagtt tactgattga    107340
     tatcgttgat gaaacgggaa gcgtctcaga agagatgctc aaagaagtag aaaatctgct    107400
     tcaatttgcc gctgagcgtg aaggcgttca ggatcaggct gaagtttctg tcacgattgt    107460
     ttccaatgat gacatacatc agattaacaa agaataccgg ggaaaggatg ctccgacaga    107520
     tgtcatctca tttgctcttg aagaagaggg agaaggcgag atcgaaatcg tgggcgccga    107580
     aatgcctccg gttttaggta atattatcat cagtgccgat cgcacaagag agcaggcaga    107640
     ggagtataat cattctttta aaagagagct cggatttcta gctgtacacg gatttctgca    107700
     ccttttagga tatgaccata tgacgaaaga ggaagaagag gagatgttta ctaagcaaaa    107760
     ggaattgctg gacgcttatg gactcaaaag atcatagaaa tgagtgaatc gattcttcaa    107820
     aagcttcgtg catgcaggcc ggggcatatg ggaaacagcg cggacggagc ggaatttcca    107880
     atttcatgcc gcagccgcct gcgctgttct catttgcggc ttccttgtag agctcagcat    107940
     tattgagtgg atgattatat tccttttgat aggtggtatg ttttcgcttg aacttttaaa    108000
     tacagccatt gaacatacgg ttgatttaat aactgacaaa catcaccctc ttgctaaagc    108060
     ggccaaggac gctgccgccg gggctgtttg cgtttttgcc gtgatttcgt gtatcattgg    108120
     tttacttatt tttttgccaa agctgtaatg gctgaaaatt cttacattta ttttacattt    108180
     ttagaaatgg gcgtgaaaaa aagcgcgcga ttatgtaaaa tataaagtga tagcggtacc    108240
     attataggta agagaggaat gtacacatga acagacaaga attaataaca gaagctttaa    108300
     aagcgcgtga tatggcatat gcgccgtatt ccaaattcca agtaggagcc gctcttctta    108360
     ccaaggatgg aaaagtgtac agaggctgca atattgagaa cgcggcatac agcatgtgca    108420
     attgcgccga gcgtaccgct ttatttaaag ctgtttctga aggggataca gagtttcaga    108480
     tgctggccgt tgcggctgac acccctggac cagtatctcc gtgcggagcc tgccgacagg    108540
     tgatttctga gctttgcaca aaagacgtta ttgtcgtact gactaattta caaggacaaa    108600
     taaaagaaat gactgtggaa gaattattgc caggcgcatt ttcatcggag gatttacatg    108660
     acgaacgaaa gctttaaatc aggatttgta tccattattg gaagaccaaa cgtaggaaaa    108720
     tctacatttt tgaacagagt cattggacaa aaaatcgcga tcatgagcga taagccccaa    108780
     acgacgagaa acaaggtgca aggagtactg acgacaggca catcacaaac catttttatt    108840
     gacacaccag ggattcataa acctaagcat aaacttgggg actttatgat gaaagtggcg    108900
     caaaatacat taaaagaagt cgatttgatc ttgtttatga tcaatgctga ggaaggctac    108960
     gggaagggcg acgaattcat cattgagaaa ttgcagacga tgtctacgcc tgtattctta    109020
     atcgtaaaca aaattgataa aattcatccc gaccaattgc ttctgctaat tgacgaatac    109080
     cgcaaacgtt atccttttaa ggaaattgtt ccgatttctg ctttagaagg aaataacatc    109140
     gaaaccttgc tcgcgcagat cgaagcgtat ttgccggaag ggccgcaatt ctatccgagt    109200
     gaccaggtaa ctgaccaccc tgaacgattt atcatttctg aattaatcag ggaaaaggtg    109260
     ctgcatttga cgagagaaga aatcccgcac agcattgcgg tggccatcga atccatcaaa    109320
     gggcaggaca acggttctgt gcacgtagcg gcaacgattg tggtcgagcg ggattcccag    109380
     aaaggcatcg tgatcggtaa aaaaggaagc cttctaaaag aggttggaaa aagagcgaga    109440
     gcggatattg aagcactgtt gggctcccgt gtctaccttg aattgtgggt gaaagtgcag    109500
     aaagactggc gtaataaaat gtcccagctt cgcgattttg gctttaaaga ggacgaatat    109560
     taatctcttc ccgtgtgtgt cattatctca caggaacagg gatacattag caaattttgt    109620
     ttaacatgaa atggaggaca tctggtcaag ataaaggtaa gaatttggag tttaggtaag    109680
     ctagtttaac tacagaaagg tgggtttctt gtgttgaatt ttacctggaa cgtattttct    109740
     caaacaggaa atgttgatac gtatcttctt tttaaagaac tggaaaaaga gaacatggaa    109800
     agacccgaag aactagaaga tgagctagcc cgatttgatt atccaatttt ataaacctct    109860
     tggccgctcc tgcttgagga aggtgcggaa atgctgacaa aatgtgaagg gatcgttctt    109920
     cgcacaaatg attacggaga gacgaataaa atcgtaacat tactgacaag agaacacgga    109980
     aaaataggtg ttatggcacg aggcgccaaa aaaccgaaca gccgtttatc agcagtcagc    110040
     cagccctttt tgtatggttc tttcttaatg caaaaaacat cgggcctcgg aacgcttcag    110100
     cagggggaaa tgatcctcag catgagaggc atcagggaag acttgttttt aacagcatat    110160
     gctgcctatg ttgctgagtt agtcgacaga ggcacagaag aaaaaaagcc aaatccttat    110220
     ttatttgaat tcatattaga atcattaaaa cagatgaatg aaggaacaga tccggatgtt    110280
     atcaccttca ttgttcaaat gaagatgctc ggtgtcatgg gcctgtatcc tgagctgaat    110340
     cattgtgtac attgtaaaag ccaagacgga acctttcatt tctctgttcg tgataatggt    110400
     tttatatgcc accgctgttt tgaaaaagat ccttacagga taccgattaa accgcaaacg    110460
     gcaaggctgt taaggctctt ttactatttt gatctgtcga gactcggcaa tgtgtcctta    110520
     aaagaggaaa caaaagctga attaaagcaa gtgattgatt tatattacga agaatattcg    110580
     ggattgtatt taaaatcaaa gcgcttttta gatcaaatgg aaagcatgaa acatcttatg    110640
     ggtgaaaaca aaagttgaca tttggtccat ctttttatat gatcatttat tattaaatat    110700
     gttgcagtga gagaaagaag tacttgcgtt tacctcatga aagcgacctt agggcggtgt    110760
     aagctaagga tgagcacgca acgaaaggca ttcttgagca attttaaaaa agaggctggg    110820
     attttgttct cagcaactag ggtggaaccg cgggagaact ctcgtcccta tgtttgcggc    110880
     tggcaagcat agagacggga gttttttggt tgctgccgca gtcaacttat gaaagaaaag    110940
     tggaggtgct tgaaatgaat attcaagaca tgattctaac cttgcaaaag cattggtcca    111000
     gtcagggctg tgtgcttatg caggcttacg atgtagaaaa aggagccggc acgatgagcc    111060
     cgtatacatt tttgcgcagt atcggtcctg agccgtggaa agtggcttat gtagagcctt    111120
     ccagacgtcc ggcagacggc cgctacgggg agaacccgaa cagactgtat cagcatcatc    111180
     agttccaggt cattattaaa ccgtcacctg ataacattca agagctgtat ttggattcct    111240
     tgcgtgctct tggaattgat ccgcttgagc acgatattcg ctttgttgaa gacaactggg    111300
     agaatccgtc tttaggctgc gcgggtctag gctgggaagt ttggcttgac ggaatggaaa    111360
     taacacaatt tacgtatttc cagcaggtcg ggggattaga gtgtaaaccc gtttctgtag    111420
     agattacgta tggaattgag cgtctcgcgt cttatatcca ggataaagaa aacgtgtttg    111480
     acttggaatg gacgtcaggg tttacagtaa aagatttatt catgatggct gaatatgagc    111540
     attctgttta tacgtttgaa acatcagacg tcgatatgct gttccaattg ttcagcacat    111600
     atgaaaaaga agcgatcaag caaatggaca acggacttgt tcatccagca tatgactatg    111660
     tgctgaaatg ctcgcacact ttcaacctgc ttgatgccaa aggtgcgatc tctgttaccg    111720
     agcggacggg ctatatcgca agagtgcgga atttagctag aaaagtagca aaaacctact    111780
     atgaggaacg agaaaaacta gggttcccaa tgcttaaagg ggagggttct tctcatgagt    111840
     aaacaggatt tacttttaga gatcggatta gaggaaatgc cggcgcgctt tttgaatgaa    111900
     agcatggttc agcttggcga caagctgaca ggctggctta aagaaaaaaa tattactcac    111960
     ggtgaagtga aactcttcaa tacaccgaga cgtcttgctg tgttcgttaa ggatgtcgca    112020
     gaaaagcagg atgatataaa agaagaagca aaagggcctg cgaaaaaaat tgcccttgat    112080
     gcggacggga actggacaaa agcggcaatc ggcttttcaa aaggccaagg cgcaaatgtg    112140
     gaagacctgt acatcaaaga agtaaaaggc atagagtatg tattcgtgca aaaattccaa    112200
     gccggccaag aaacgaagtc gcttctgcca gaattgagcg gtttaattac aagcttgcat    112260
     ttcccgaaaa acatgcgctg gggaaatgaa gatttgcgtt atatccgacc gatcaaatgg    112320
     attgtcgcat tatttggaca ggatgtcatt ccattttcga tcacaaacgt tgagtctgga    112380
     cggacaacac agggacaccg tttcctcgga catgaagtgt caattgaatc accttcagct    112440
     tatgaagagc agctcaaagg acagcatgtt attgctgatc ctagcgtccg aaagcaaatg    112500
     attcaatctc agctggaaac aatggctgct gaaaacaatt ggagcattcc agttgacgaa    112560
     gaccttcttg atgaagtgaa tcatttagta gaatacccga cagctcttta cggttcattt    112620
     gaatccgagt ttctgtcaat tcctgaagaa gtgcttgtca cgacaatgaa agagcatcag    112680
     cgctacttcc ctgtcaaaga caaaaacggt gacctgctgc ctcactttat cacagtccga    112740
     aacggcaaca gccacgcgat tgaaaatgtg gcccgaggca atgaaaaagt gctgcgcgca    112800
     cgtttatctg atgcttcatt cttctacaaa gaagatcaga aactaaacat tgatgcaaat    112860
     gtgaagaagc ttgaaaatat cgttttccat gaagagcttg gttctcttgc tgataaggtt    112920
     aggagagtca catcaatcgc agagaaactt gccgttcgtc ttcaggctga tgaagataca    112980
     ttaaaacatg tgaagcgggc tgctgaaatt tctaaattcg accttgtgac gcatatgata    113040
     tatgaattcc ctgaacttca aggaattatg ggcgaaaagt atgcgagaat gcttggcgaa    113100
     gatgaagctg tggctgcggc agttaatgaa cattatatgc ctagatcagc gggcggagaa    113160
     acgccttcta ctttcaccgg agctgttgta gcaatggcgg ataagcttga cacaatcgct    113220
     tcattcttct ctatcggcgt aattccgacc ggttcccagg acccttacgg actgccccgc    113280
     caagcaagcg gtattgttgc gattctcctt gaccgcaact ggggaatttc atttgaagag    113340
     ctgcttactt tcgttcaaac cgataaagaa aatgaactgc tggatttctt cactcagcgc    113400
     ttgaaatatg tcttgaatgc tgaacaaatc agacatgatg tcattgacgc cgtgctggaa    113460
     agctctgagc ttgagccgta ctctgcgctg cataaagcac aagtactgga gcaaaagctt    113520
     ggtgcacctg gctttaagga aacagccgaa gcgttaggcc gagtgatctc tatcagcaaa    113580
     aaaggagtcc gcggagacat tcagcctgat ctgtttgaaa atgaatacga agcaaaactg    113640
     tttgatgcct accaaacagc gaaggaaaat ctgcaggaaa acttcagcaa aaaagattat    113700
     gaggcggcgc ttgcttcact tgcagcctta aaagaaccga tcgatgctta cttcgatcat    113760
     acaatggtta tagcggataa tgagtcatta aaggcaaatc gtttagcgca aatggtaagc    113820
     ttggcggatg agatcaagtc ctttgcgaat atgaatgccc ttattgtaaa ataaagagag    113880
     aaaaggcggt tgctgtgtga tcggtaatcg tcttttcccc atttataagt tttttgtttg    113940
     attacaagat atttacgtta taatatggat tgttatttct ttacatagct atgaagtgaa    114000
     aaggtggtga gtacgatcga actaaataaa cggcaagaac atattttgca gattgtaaaa    114060
     gaaaacgggc cgattacagg ggagcatatt gcagaaaagc tgaacctaac cagggcgaca    114120
     ttgcgcccgg atttagccat actcaccatg tcaggattcc tcgaggcgcg cccgagagtc    114180
     ggttatttct atacgggaaa aaccggcaca cagcttttgg cggataaact caaaaagctt    114240
     caggtgaaag actttcaatc tatccccgta gtgattcacg aaaacgtttc tgtgtacgat    114300
     gcgatttgca ccatgttttt agaagatgta ggtactctgt ttgtggtgga ccgcgatgct    114360
     gttttagtcg gggtgctttc acgaaaagac ttgctcagag cgagcattgg ccagcaggag    114420
     cttacatcgg tccctgttca catcatcatg acaaggatgc cgaacattac ggtgtgcaga    114480
     cgcgaggatt atgtgatgga cattgcaaag cacttaatag aaaaacaaat tgatgcactg    114540
     cctgtcatca aagacaccga taaaggcttt gaagtgatcg gcagagtgac aaaaacaaat    114600
     atgaccaaaa tacttgtcag tttatctgaa aatgaaatcc tataagattg caaactaacg    114660
     gggggataat atgaataacc gcatcatcta tgttgtatcg gattccgtcg gtgaaacggc    114720
     tgaattggta gtaaaagcag cactcagcca atttaacgga tcggcggatg atactcatgt    114780
     aagaagaatt ccttatgttg aagatatagg cactatcaat gaagtgattt cacttgcaaa    114840
     ggcagacggc ggcattatct gttttacact cgtggtgccg gaaatcagag aatatttgat    114900
     agccgaagcg gaaaaagcaa atgttttata ttatgatatt atcggcccgt tgattgataa    114960
     aatggaaaca gcctacggtt taacagcgaa atacgaaccg gggcgggtgc gccagcttga    115020
     tgaagattat ttcaaaaaag tggaggccat cgagtttgca gttaaatacg atgatggacg    115080
     tgatccaaga gggattttaa aagctgatat cgttttgatc ggcgtgtcaa gaacgtctaa    115140
     aacaccgctg tctcaatatc tcgcacacaa acgcctgaag gttgccaatg ttccgattgt    115200
     accggaggtt gatccgccgg aagaactctt taacgttgat ccgaaaaaat gcatcggttt    115260
     aaagattagc cctgataaac tgaatcatat cagaaaagaa cgtttaaaat cactcgggct    115320
     taatgataaa gcgatttatg caaatatcaa cagaatcaaa gaggaactcg agtatttcga    115380
     aaagattgtg gatcggatcg gctgccaggt tgttgatgtt tcaaataaag cggttgagga    115440
     aacagcaaat attatccatc atctcaaaac aaaaaacata taactcagga cgctctatcc    115500
     tgggtttttg gctgtgccaa aagggaataa tgaaaaacaa tagcatcttt gtgaagtttg    115560
     tattataata aaaaattgtg ataaaatgat taattttagg tttaaggatc gtgtgatacg    115620
     aataaactat tatgggtaag atgtcaagaa tttctcccgg aaatttttcg acaaattcat    115680
     atacatccac aataataaag gatgtgcgat tttgcttgct tttatgcagg agtttaatgg    115740
     agggatggag aattactctt cttaatgaac aagaaaagac gatttttgtc gatgctgatg    115800
     cttgtccggt aaaagatgaa attttacaaa cagcatccga gtatgaagtt caagttcttt    115860
     ttgtcgcttc atttgaacat tatcagcttt ccagaagcaa tgaagaaaaa tggaagtatg    115920
     ttgatcctca taaagaagct gctgatttat atatcgcaaa tcacgtgaaa ccgggagata    115980
     ttgttgtgac gcaggacatc ggattagcat ctctgctgtt gaacagaaat gtctctgtta    116040
     tgtcggaaag aggtcgtctt tacaaggaag acacgattga ttttgcccta gagggccgtc    116100
     atttttccgg caaacaaaga agaaaaggcg tatatgccaa agggcctaaa aaattgaata    116160
     aagaagatcg agaacgattt attacactgc tgcaaaaaat cctgtcgaac gatgaaggga    116220
     ttttgcacta aagcatcgaa taatgtacga cggagtgtta taagatggga aatcggatac    116280
     cagatgaaat tgtggatcag gtgcaaaagt cggcagatat cgttgaagtc ataggtgatt    116340
     atgttcaatt aaagaagcaa ggccgaaact actttggact ctgtcctttt catggagaaa    116400
     gcacaccttc gttttccgta tcgcccgaca aacagatttt tcattgcttt ggctgcggag    116460
     cgggcggcaa tgttttctct tttttaaggc agatggaagg ctattctttt gccgagtcgg    116520
     tttctcacct tgctgacaaa taccaaattg attttccaga tgatataaca gtccattccg    116580
     gagcccggcc agagtcttct ggagaacaaa aaatggctga ggcacatgag ctcctgaaga    116640
     aattttacca tcatttgtta ataaatacaa aagaaggtca agaggcactg gattatctgc    116700
     tttctagggg ctttacgaaa gagctgatta atgaatttca gattggctat gctcttgatt    116760
     cttgggactt tatcacgaaa ttccttgtaa agaggggatt tagtgaggcg caaatggaaa    116820
     aagcgggtct cctgatcaga cgcgaagacg gaagcggata tttcgaccgc ttcagaaacc    116880
     gtgtcatgtt tccgatccat gatcatcacg gggctgttgt tgctttctca ggcagggctc    116940
     ttggcagcca gcagcctaag tatatgaaca gtcctgaaac cccgctcttt cataaaagca    117000
     aactgcttta caatttttat aaggcccgcc ttcatatcag aaagcaggaa agagcagtct    117060
     tatttgaagg gtttgctgat gtctatacgg ccgtaagctc ggatgtaaag gaaagcatag    117120
     ccacgatggg aacgtctctt acagatgatc atgtcaagat cctgagaaga aacgtcgaag    117180
     aaatcattct ttgctatgac tctgataaag ccggttatga agccacctta aaagcttcgg    117240
     agcttctgca aaaaaaaggc tgcaaagtca gagttgcaat gattcctgac ggattggacc    117300
     ctgatgatta catcaaaaaa ttcggcgggg aaaaatttaa aaacgacatt attgacgcaa    117360
     gtgtcaccgt aatggcgttc aaaatgcaat atttccgaaa aggaaagaac ctgtccgatg    117420
     aaggcgaccg cctagcttac attaaagacg tactgaaaga aatcagcacg ctttcagggt    117480
     ctctagagca ggaagtctat gtaaagcagc ttgcttcaga gttttcgctt tcacaggagt    117540
     ctttaactga gcagctgtct gttttcagca agcaaaacaa acctgctgac aatagcggtg    117600
     aaactaaaac gcggcgagcg catctgacga caaaagcaag gcaaaaacgt ttgcgtccgg    117660
     cgtatgaaaa tgcagaaagg ctgttactcg ctcacatgct tcgagatcgg agcgtcatca    117720
     aaaaagtgat tgaccgggta gggtttcaat ttaatattga tgagcaccgg gcattagccg    117780
     cttatcttta tgctttttat gaagagggag ccgagctgac gcctcagcat ctgatggcca    117840
     gggtgacgga tgatcatata agccagctct tgtccgatat attaatgctt caggttaatc    117900
     aagagcttag cgaagccgag ttatcagatt atgtaaaaaa agtgttgaat caaagaaatt    117960
     ggtcaatgat aaaagaaaaa gaggcggaaa gagccgaagc agaaaggcaa aaagattttt    118020
     taagagctgc ttctttggct caagaaatcg ttacattgaa ccgatcttta aaataactgg    118080
     agaactgatg aggagcattt attggcaatg attccttgcg gaggagcaaa tagatcgctt    118140
     aacctcatca tgaattgtca tttcattatt cgcacattgt taaaggcagt tcacatagaa    118200
     aacgcctgaa tggaccgaat aagaatcata ccgcttatag aattcgttgc aagctttgga    118260
     aggagggatc cataatggct gataaacaaa cccacgagac agaattaaca ttcgaccaag    118320
     taaaagagca attaacagag tctggtaaaa aacgtggcgt tttgacatat gaagaaattg    118380
     ctgagcgtat gtccagcttt gaaattgaat cagaccaaat ggatgagtat tatgaatttt    118440
     taggtgaaca aggtgttgaa ttaattagtg agaatgaaga aacagaagat cctaatattc    118500
     agcagcttgc caaagccgaa gaagaatttg accttaatga cctaagtgta ccgcctggcg    118560
     ttaaaatcaa tgacccagtt cgtatgtatt taaaggaaat cggtcgggtt aaccttcttt    118620
     ctgcaaaaga agaaatcgcc tacgctcaaa agattgaaga aggtgacgaa gaatctaaac    118680
     gcagattggc tgaagcgaac ctgcggcttg ttgtcagtat cgcaaaacgg tatgtcggac    118740
     gcggtatgct gttccttgat ctgatccatg aaggaaacat gggcctgatg aaagccgttg    118800
     aaaaatttga ttatcgcaaa ggttataaat tcagtacgta tgctacgtgg tggatcagac    118860
     aggcgattac acgcgccatt gccgatcagg cgagaacgat ccggattccc gttcatatgg    118920
     ttgaaaccat taataaatta atccgtgtgc agcgtcaatt actgcaagac ttaggcagag    118980
     aaccaacacc tgaagaaatt gcggaagata tggatttaac gcctgaaaaa gtacgcgaaa    119040
     tcttaaagat tgctcaagag ccggtatctc tggaaacacc gatcggtgaa gaggatgact    119100
     cgcaccttgg tgatttcatt gaagaccaag aagcaacttc accttctgac cacgccgcat    119160
     acgagctatt gaaagagcag ctggaagatg tgcttgatac gttaactgat cgtgaagaaa    119220
     atgtattgcg tcttcgattc ggtcttgatg acggccgtac aagaacatta gaagaggtcg    119280
     gcaaagtatt tggagtaacg agagagcgta ttcgacaaat cgaagccaaa gcgttgcgga    119340
     aactaagaca tcctagcaga agtaaacgtt tgaaagattt ccttgaataa gatggaacgg    119400
     gtcttgaaga tccgttcttc tttttttaaa aagatatatg gataatatgc ctttatttta    119460
     ctgaaaaatg atgtcatttg caaatgaaca ttgtggtgaa aaatttcaaa atctaattcc    119520
     atattttcta ttgtaagcgt atacaataca ttatacaata gaataaaaag gatattagag    119580
     atttaggcat gtttctattc aattttgtat aaagtgtgaa taaaaaactt ttgtatagca    119640
     atccatttac tttttgtaaa aataagttag aattagaagt gtttacatag ggggaaggat    119700
     caaaaagggg gaagggaaat gaaatggaac ccgcttattc catttttgct gatcgctgtt    119760
     ttaggaattg gtctaacttt ctttttatca gtaaaaggac ttgatgactc tcgggagatt    119820
     gcgagcggag gagaaagcaa atctgctgaa aagaaagatg caaacgcttc accagaagaa    119880
     atttacaagg caaactgcat cgcatgccac ggtgaaaatt atgaaggtgt ttcgggtcct    119940
     agcttaaaag gtgtagggga taagaaagat gtcgctgaaa ttaaaacaaa gatcgaaaaa    120000
     ggcggtaatg gaatgccttc cggtcttgtt ccggccgata agctggatga tatggcagag    120060
     tgggtgtcaa aaattaaata aaagaactat ttttctcttt atacattcac aggccgccga    120120
     gatgttctcg acagcctttt atttttgact gctgcgtgca gacccgcatc aaaagaaata    120180
     atttcaaaat catttgcttc agcttggatt ccgggctgat tttttatatg atagtaaagg    120240
     aaaaaatgat tgagaaaagt tgtgatgaca agtgaacgaa ttaaaattat ctaaacgatt    120300
     gcaaacagta gcggagtaca taccgaatgg agcggtgatg gccgatatcg gctctgacca    120360
     cgcctacctt ccttgttatg cggtgctgaa tcataaagcc agcggggcga ttgccggaga    120420
     aataacagac ggcccatttt tgtctgcaaa gcggcaggtt gaaaaatcag gcttaaactc    120480
     gcacatttct gtaaggcagg gagacggact ggaagtgatt aaaaaaggtg aagctgatgc    120540
     cattacgatt gccggaatgg gcggggcttt gatcgctcac attttagaag cgggcaaaga    120600
     caaattaacg gggaaggaac ggctcatttt acagccgaat attcatgctg ttcatatcag    120660
     ggagtggctt tataaagaaa gatatgcgct gatagatgag gtaatccttg aagaggacgg    120720
     aaagtgctat gaggtgctgg tggcagaagc gggagacagg gatgcggctt atgacggtat    120780
     ttctttatca gccgggatgc tcgttggccc tttcttggca aaagaaaaaa atgctgtctt    120840
     tttgaaaaag tggacacaag agcttcagca cactcaaagc atttatgaac agatcagcca    120900
     agcggcggat acagagcaaa acaaacaaaa attaaaggag ctcgccgatc gaatggagct    120960
     gttaaaggag gtaatcgatc atggctaaaa gtgtaaatgg gcagcagatc atccagctgt    121020
     ttgaacaatt ttccccgaaa gcctatgcgg ttgaaggaga taaaatcggc ctgcaaatcg    121080
     gcaccttaaa caaaccaatt aaaaatgtga tggttacact tgatgtgtta gagagcgtta    121140
     tcgatgaagc gattgaaaaa gaggttgact tgattattgc acaccatcca ccaattttcc    121200
     ggtcgctaaa gcatatttca acagatcagc ctgccggaag gttaattgaa aagtgtttga    121260
     agcatgatat tgctgtttat gcagctcata caaatttaga cgttgcggac ggcggtgtga    121320
     atgatttgct tgctgaagca ttagagctga gtgagacgga agtgctggca cctacttata    121380
     cggatcctct gaaaaagctg gcagtttacg tgccgaagga atatgaagag caggtcagag    121440
     ccgcgctcgg aaatgcgggg gccggccata tcggtgaata cagccattgc gcgttttcat    121500
     ctgaaggaat cggcagcttt aagccattgg acggagctaa gccttttatc ggtgaagtgg    121560
     gagagcttga gcttgttcat gaagtaaggc ttgagactgt atttcctaaa agcgtcgaaa    121620
     aggctgttat caatgcaatg ataaaaagcc atccatatga agaagtcgct tacgatatct    121680
     atcctgtcga acagactccc gccgaaaaag ggctcggccg tgtcggaacc cttaaaaatg    121740
     agatgacgct caaggaattc gctttatttg tgttttgcaa gcttgaccgt caatggtgtc    121800
     agaatggttg gggatgctga cagcatggtg aaaaaagtag ctgttcttgg cggagatgga    121860
     aacaagtata ttcatcatgc aaaacgaaag ggagccgatg tttacgtcac aggagattta    121920
     tacttccatg tggcccatga tgcgatgatg cttggcctaa atgtggttga tccgggccat    121980
     tacgcggaaa aaatcatgaa agaaggcgtc acgagaaaac ttacatcaat gtgtaatgat    122040
     aaaaagtttg gcgtgaatat ctttgtttct gaaacagata caaatccatt tacatttcta    122100
     taaaaaaact gaggctttta cagcctcagt tttttgcttt tacttttgga agtatttttt    122160
     tgagcggtat attatgttca gttgtccaag ttgatggatc ttcgtgatca aactgctcta    122220
     aaaagcgaat gacttctttt gtgatcggcg tcggtgttga agctcccgct gtaactgcaa    122280
     cggtattaac gcctttcagc cattcgagct tcaattcgct taagtcgccg atccggtatg    122340
     cttttgtccc ggctatttcc tctgacactt gagcaagcct atttgaattg ttgcttttcg    122400
     ggtctccgac aacgattgtt aagtccgctt tttttgcctg ctctgataca gcttcctgcc    122460
     gcacttgagt agcgaggcaa atctcttggt gatattcgac atgaggatat ttttctttga    122520
     caagctccat aatgtcgtga acatcccatt gagacattgt tgtttgattc gtcacgatta    122580
     acttctcaga ttggatatca aggttcttta catcttcttc tgtttcaact aagtgaacga    122640
     tctccggcgc tacgccaacg gctccctcag gctctggatg cccttttttg ccgatataga    122700
     tcacgtgata tcctttttct ttcatctcta agattagatt atgagttttt gtcacatccg    122760
     gacatgtagc atcaattgcg actaaccctt tttcttctgc gattcttctg acttcgggag    122820
     aaacaccgtg cgcagtgaaa atgacagttc ctttgtcaac ctgctttaag atgtccagac    122880
     ggttagagcc gtccaatgtt aaaatccctt cctcttcaaa cgcatcagtg acgtgtttat    122940
     tatgaacaat catcccgagt atatagatgg gtcttggcaa gcttttatct agcgacgcat    123000
     ttttggcaat gaccatagca tcaacaacac catagcaata gccgcgcggt gaaattttaa    123060
     ttacgtccat tttcggttgt cctccaatac tgaagtgagt aaaggcaata taaaaagccg    123120
     taatcaaacg gctctattct tgcattcttc tgatctcatt atagccaatc tcacttaaga    123180
     tatcaaagaa tgttaaatat ataatctcgg ttttgaactg cctgatgttc ttttcggagc    123240
     aggagaggca gcttcctttt tcttcggggc agatgttttt aattcttgtt ctttattgtc    123300
     agttgtttta gatttctttg ggagagaaga actttttggt tttgattttt tgttcccatc    123360
     tgaggttttt gtttcagtct ctttttcttt ttctgatgat tcttctgaaa cggattgttt    123420
     ttcactttcc tcattggcct ctgtctcagt atcatcactt ttacttaatt ggctgtacag    123480
     cttcatcatt gctggcagat tgcggactaa tgggccgtac tgctggatca taggggtgac    123540
     ttgctgcgcc atgccgagta ctttttgcac atttccaagc atactggata atgatgcagg    123600
     attggcaata ttttgaatgc cttgcaggcc agcacctccg ctcgctgctg cacctgctcc    123660
     tggaattccg ggaaccccgg cgctgccagc gcctcctccg ccggggagga accttgacag    123720
     cattcctttt aagcctccgc ctgcacctgc accatttctc gctccggcat ttgcctgagg    123780
     aagaaattgt ccggcttgct gaaaaccttg ctgctgtgct ccaaatgaag gtcctcgcat    123840
     attaggcggt cttctgccca tcattcgctg atttggcatg gggcggggcg gtccgggctg    123900
     tgggtaattt ctcattggct gctgcggtga aaacatactt gtacctcctt tcagctctct    123960
     ctgctattag aatatgcatg ggctgcggta tttgctttac ataactgaat aaaacaaacg    124020
     ccttgcaaac gtggtgtttt taagcaaaat cgggtataat gtgatgatgg acacataatg    124080
     tgccgcttta aggagctggg aaaaatgaaa gaaacgaaat ttgaacttta tgaattgaaa    124140
     ccatttatta tagatgcagt acatcgcctt ggtttttacg aaccgactga tatccagaaa    124200
     aggctgattc ctgcagtgtt aaaaaaagaa agcgtcatcg gccagtctca gacgggtact    124260
     ggaaagactc acgcttattt actgccttta ttaaacaaaa tcgatcctgc taaggatgtc    124320
     gttcaggtag tcattacggc tccgacaaga gagcttgcca accagattta tcaggaagcg    124380
     cttaaaatca cgcagggtga agaaggaagt cagattcgct cgaaatgttt tatcggaggc    124440
     actgataaac aaaaatcaat tgataaattg aaaatacagc cgcatcttgt tgtcggtaca    124500
     cctggacgga ttgctgactt aatcaaagaa caggcgttaa gtgttcataa agcggaatct    124560
     cttgttattg atgaagcgga tttaatgctg gacatgggat tccttgcaga tgtagattac    124620
     atcggttccc gcatgcctga ggatctgcaa atgcttgtgt tctcagcgac cataccggaa    124680
     aagctgaaac cattcttgaa gaaatacatg gaaaatccga aatacgccca tgtggagcca    124740
     aaacaggtga ctgctgcgaa aatcgagcat atcctcattc cttcgaaaca tcgtgacaag    124800
     gacaagctcc tttttgacat catgtcgcat ctgaatccat acctggggat tgtgtttgcc    124860
     aacacgaaaa atacggctga ccatattgcc cagtatctga ctggcaaagg catgaaaatc    124920
     ggcttgctgc acggcggatt aacaccacgt gagcggaaaa aagtcatgaa gcagatcaat    124980
     gatttggaat tcacatatat cattgcaact gaccttgccg caagaggtat tgatattaaa    125040
     ggtgtcagcc atgttatcaa ctatgagctg ccggatgatc tcgatttcta tgttcaccgt    125100
     gtgggcagaa cggctcgtgc cggctcatca ggacaagcga tgaccattta tgagcttact    125160
     gatgaggatg cattagtaag acttgaaaaa atgggcatcg aatttgagta cttagagctt    125220
     gaaaagggcg aatggaaaaa aggcgatgac cgtcagcgcc gcaaaaaacg taaaaaaacg    125280
     ccgaatgaag cggatgaaat tgctcatcgt ctcgtgaaaa agccgaagaa ggttaagcct    125340
     gggtataaaa agaaaatgag ctatgagatg gagaaaatca agaaaaaaca gagaagaaac    125400
     caatctaaga aaagaaagta ggggaacctg ttgctgagaa taggctcaca cgtctctatg    125460
     agcggaaaac atatgcttct ggctgcaagc caggaagcag tctcttatgg ggcgaatacg    125520
     tttatgatct atacaggcgc accgcaaaat acgcgccgaa agaaaattga agacttaaat    125580
     atagaagcgg gccgggcaca tatgcaagaa aacggcattg acgagattat cgtacacgcg    125640
     ccttatatta ttaatattgg caacacgaca aatccgtcca cttttgagct gggtgttgat    125700
     tttcttcgtt cagaaattga acggacagcg gccatcggag cgaagcaaat tgtccttcat    125760
     cctggcgctc acgtaggggc aggagctgaa gccggcatca aaaaaattat tgaaggctta    125820
     aatgaagtga ttgatccgaa tcaaaatgtc cagattgcat tagaaacaat ggctggaaaa    125880
     ggatcagaat gcggcagaag ctttgaggag cttgcgcaga ttatcgaagg cgttacacac    125940
     aatgagcagc tgtcagtgtg ctttgacacg tgccatacac atgatgccgg gtataacatt    126000
     gtcgaagact ttgacggagt gctaaatgag ttcgataaaa tcattggcat tgaccgtatt    126060
     aaagtgcttc atatcaatga cagcaaaaat gtcaaaggtg cgagaaaaga ccgccatgaa    126120
     aatattggct ttggtgaaat aggttttgac gcactgcaat atgttgttca ccatgagcag    126180
     ttaaaagaca ttccaaaaat tcttgaaaca ccatacgtcg gtgaagataa aaagaacaaa    126240
     aaaccgccat accgttttga gattgaaatg ctgaaagaaa aacaatttga tgatacattg    126300
     cttgaaaaga ttttacagca ataaaaaatg ggggataaca cccccatttt ttagcttgta    126360
     aattgtttga atagttcatt aactgtttga gctgtttctt tcgatgtaat cgtctctact    126420
     tgtttcagca gccgcattcg ttcactctca ttaaagatgt ttacattttt cccgtataac    126480
     aggttcgcta cttcaacggc ctgcgatctt gttaagctga ttccgtattg ttttgagtac    126540
     ttcagcaaat catcagcagt agcctgatta agccgctgca aaataattct ttgaaataaa    126600
     atcatcggtc attccacctc cagacttaat gtatgggcaa atcagtaaaa tgtgtcagtg    126660
     tttaatggta aaatagattt ataatgtatt taaaatagtt attgcaggaa aggagatttt    126720
     atgaccccaa caaaacaaca taagaaagaa acatttaccc attttatttt cagggtcttt    126780
     atgattctgg taggagctgc atctgcggct gtaagtattg aattattttt aatccccaat    126840
     gattttattg atggcgggat tatcggtgta tctcttattt tagaccacct ctttatgtca    126900
     aacccctttc tgaatttcgc tttttccgtt gtcatattaa atattccttt tatgatcttc    126960
     ggatataaat atatcggtaa gacctttcta gtctctacgt ttatagggat tgtcgggctt    127020
     gccgttattg aatcctcact tcaccatgta gaagccatta caacccagcc tattttggct    127080
     actgtgttcg gaggtctttt actcggcttt ggcgtcgggc ttgttattcg aaatggaggt    127140
     tcaatggatg gtacagaaat tctcggtatt ttgctgacca aaaaactccc gttttctgta    127200
     ggtgagttcg ttatgttcat caatgtgttc attttcattt gggcagtttt tgtgttcggt    127260
     cctgagcaag cgatgtactc attcatgact tattatattg cgatgaaaac gattgatgcc    127320
     gtgatccaag ggcttgatga aacaaaagct gtcattattg tgtctgagca gtatgatgag    127380
     atttccgacg cgattttgca ccgtctcggt cggggcacaa cgaagctgaa ggggaaaggc    127440
     gggtatacgg acgaagaaaa agacgtaatt tacgcggttg tcacaaggct ggaagtgaca    127500
     aagctcaaat cgatcgtgtt tgaagttgat caaaatgcat tcataacaat tatgaatact    127560
     catgaaacga gaggcggaaa attcaaaaac gcaatccact aggctttcat ttacttttat    127620
     tcattttatg ggtataattt tatctgcagt aaagaaaatg gcttgctgga cagacagctg    127680
     ccattttctt tttcatacat gtgatacgtt cttaagcaaa gcgaaaaggg ggacccttca    127740
     tgaacgtcca agaagcgctg aacctattaa aaggaaacgg atataaatat acaaacaaac    127800
     gggaggatat gctgcagctt tttgctgatt cagacagata tcttaccgct aaaaacgtac    127860
     tgtctgcact gaatgatgat tatccaggct taagctttga tacaatctac agaaatcttt    127920
     ctttatatga agaacttggg attttggaaa caactgagct gtccggtgaa aagctcttcc    127980
     gatttaagtg ttcattcacc catcaccacc atcattttat ttgtcttgcc tgcggcaaaa    128040
     caaaggaaat tgaatcatgt ccgatggaca agctttgtga tgatttggat ggctatcagg    128100
     tcagcgggca taaatttgag atttatggca catgccctga ttgtacagcg gaaaaccaag    128160
     aaaacactac tgcgtaaaat gcgtatatat gaaaaagggg cccggtttgg gctccttttt    128220
     cagttattga cgcgtattaa gtgatgcttg ttgttgttca tccattgaac ggcttctagc    128280
     cagttgttta ctctgatgat gtttgaatca atcggaagct gattataagg ggaattgaac    128340
     aaaatcaccg gtatcccggc ttctttcgca atcatcatgg cgttcccgtg atgatcctca    128400
     aaaaacaggt cgatgttatg attcttgacc gcttcaactt tgtgatgacc cccaacaagt    128460
     tcgatgtggt cataatgaat gttttgtctg tcaaaccatt cataagtaat atcagttaaa    128520
     tgagtccgtc tcgctgtaat ataaataagc ttgtgctcct ctttgagaag atcgagagac    128580
     tgtttcgcat gctgtgcaag caatgcttcc ttatatatga tcgcttcatt ttgattcatc    128640
     caatcccaaa attcttcctg ggtaatgttt aacagctttg ttaaatcata atccgtcata    128700
     tcgtttaatg aaatggaaag attaaacgaa cggttcaaat aagggacgaa tgtatcctga    128760
     gccgtgattg tgccgtcaat atctattcct aagcgtaaca tgcccacact ccttcagttt    128820
     catcccttca agtgtaacat aaacaattga cattaacaga aaagtttagc aaacatgaat    128880
     caggcaaaat ggatcaaact ataaaagctc ctttaataaa acagaagggg gaattgaagg    128940
     tggcaaacga ttacgaaaag cgtgataaca acagttacta tgttgatcat ggatctgaag    129000
     ggacaaatat tacccgcgac aatgacggtt tttttgagga aacagctgct gaaatcgcag    129060
     agccttatcg tgctgctgac cgcagcaatg accaagacaa tgatcgcagc ggcggcaatg    129120
     tcaatgaagg acggggaata gggtacatcg ctttagcctt gtccatcatt tcattgtttg    129180
     tactgcctgt tttattggga gctgctggta ttattgtcgg ctatatcgca agaaggagag    129240
     gtgctcaagg ccttggagcc tgggcaatgg gtatcggtgt cgtttcatta gtgcttggga    129300
     tatttattat tccatttttc taacacaaaa aagcttgacg ggttcccgtc aagctttttg    129360
     tgtttcttct tttaattttg ctttttcagc ttcaagtttt gcgtagtgtt cctcagcaag    129420
     aatgtcaatt tcttttttga gttcttctac catcgtttcc tctggaacct tacggacaat    129480
     tttccctttc cggaacagca gcccttcacc gcgtgcgccg gcgattccga tatcagcttc    129540
     tctcgcttca ccaggtccgt ttacagcgca gccgagaaca gcaactttaa tcggcgcttt    129600
     tatcttagaa atatactctt ccacttcatt ggcaatgctg attagatcaa tctcaatacg    129660
     gccgcaagtc gggcatgaga tgagcgtggc agcattggag gctaagccga aagatttcag    129720
     aagctccctt gctactttta cctcttctac agggtctgcg cttagtgaaa tgcgcatggt    129780
     gttcccgatg cctttgctta aaatggcgcc gagtcctgct gcgctcttta ctgtgccggc    129840
     aaacagtgtt cctgactcgg tgatcccgag gtgaagcggg tagtcaaacg ctttcgctgc    129900
     tttttcataa gcctcgattg caaggttcac gtcagaggcc ttcatgctga caataatatc    129960
     gtgaaaatca agatcctcaa gaattttaat gtgatgaagt gcgctttcta ccattccatc    130020
     ggcagtcgga taaccgtatt tttctaaaat ccgtttttcc aatgaaccgg cgtttactcc    130080
     gattctgatc ggaatgcctt tgtctttggc cgctttaaca accgcttcaa ctttttcgcg    130140
     ccggccgata ttgccggggt tgattcggat tttatctgcg ccgccttcaa tggctttcaa    130200
     cgcaagttta taatcgaaat gtatgtcaac aacgagagga atggaaatgc gctttttaat    130260
     atccgcaatg gcgtttgccg cccgttcatc cggacatgct acccgaacga tttggcatcc    130320
     ggcttcagcc aaacggttaa tttccgcaac cgttgcttct acatcatgtg tttttgttgt    130380
     tgtcatgctt tggatgacaa cttcattgtt gccgcctatt gttaaaggtc ccactttgac    130440
     gggacgcgtt tttgtacgat gtgtgatttc actcacttgc aatcgctcct taattgtagt    130500
     tgccgcttct agatataaca attctagtat ggtttatgtg aatttatttt acaaattaca    130560
     ttgtaacagt gtcttcgccg aactgacaag aaattaacgt taaattaagg gtagaccggg    130620
     aatttatacg ctgttccggc ttgaatggcg ttagctttca catttggatt cagtgcttca    130680
     aaatccttta caatgtcatc cggagaacct gctgatccga ctatcgacat aaccgtatca    130740
     cccggcttta ccttcaccgt tttataagcc ggttcttgta cagccgtttt tgctgatgct    130800
     tcatagacag ggaggtcctg aatgggtatg gttccaattt taaggtcata aaaaagaata    130860
     aaaagtataa aaacaatgct gcatactaag gtgagacgct tcatcgcttt tcctcccgca    130920
     tacgaaattt tataccatag tatgcttgtc catttcgatt catgacaaaa gaaaagagac    130980
     tgcgaatgct cggtttttat acaggcgctt ttttgacagg atttcttcga ctaaacatta    131040
     acttcagata gaaaatagaa aatagtgcaa aattagatca aaaagaggct tttataatat    131100
     aaaactcgta ttccattatt tacaatgaac aatggatctg ttaggataat tatgtaatag    131160
     tttaaaggag gatctacaaa atgaagcaag gaaaattttc tgtgttttta attttgctac    131220
     taatgttaac tttggtagtt gcacctaaag gaaaagcaga ggctgcaagc agtggttggc    131280
     aaccggtaag tggtatttct ggttgtaaaa taagagttat tacagatgct tatacatata    131340
     ctaagagtgc aacatctatt gatgcttacg ccgaaacaaa tggaaaatgc ggtaaactaa    131400
     attataagag ctttggtgta tctatagttg agggtgggga cattggcccg caatattcag    131460
     ggtacttttc aagtagaact ccaaccaaaa agttttactt cagtaaatta ccaaaaccga    131520
     caggaacacc ttgggcagta ggtttatcag tatataaggg gaaagctaag ggagctgcat    131580
     ttgtatacat aaacccacaa aaaagataac agttcaataa tgagaataga aggaaagaag    131640
     ataattctaa cttgttgatg atttaattct gaatgctagg tgccctattg gtacctggct    131700
     ttttaaatag caactatctt atgtaaatat gttgtgaaag gatgcaaaat attttgccat    131760
     atgattttaa ctagtctatt agttaaaatt taacattatt cttattttgt taaaaacata    131820
     tgtcaaatgc tgttaagaac ttctttcatg ttacatctta ctacttctga tattattgtc    131880
     cagagcttgt tcttgagtaa ttgtagagct ttttttataa atgtatctgt ttaagctcta    131940
     tacattttat taaatatccc ttaagtaaaa agttaatgca aatgctttca cactctctac    132000
     ttaaaggata aaaataaata taatttaact tttattaatt acttttttgg acgggaatct    132060
     cttttaaaac gagaaacagg atgacaaaat tgacaaacca gttcagcaaa aattcacttg    132120
     gtacggttgc ttctagtgcc cgcatgattg taaagaatac agttgaaagt gtgatggaat    132180
     aagcagaaag cttccagagc tgatgatagg ataaatgttt tttctgcgaa ttcttaatga    132240
     ttaacccgat aagcgctaaa aacgatactt caataaattt tcccgctgct gttacgagaa    132300
     aaataagagc tgagagaaca gttacaatca tcgctttatt ttggtttaaa cctgcaatga    132360
     catctttttt ctgtaactct gacggcatca ttgagtaaga catttcttgg gcttgtccgt    132420
     caatggccaa aacaaatttg ttctgaagga tgccgattgc gttttgcttt gcttcaattt    132480
     gttcagtgcc ataggagtct gtcggatcga acacgataac gaaaccattt gcctgagatt    132540
     ccgtggcttt tttctcatcc gtttgaagtt tgccgtttga aattgtgaaa tcagggaaat    132600
     ctttgtttaa aacagtttta aagccgttca ttgattttac ggtccctgta cttacataat    132660
     aagcggtagg gattgcaaac aggacagaga gcaaaaatac ataaagaatc gcttttccga    132720
     ttccttgaaa tcttgttttt gcaatatcac ggggagagta tgtactttta atgaaaagct    132780
     gaaacacatt cactatcttc acttcctagc taaactaata tatgttgctt attgtatcgt    132840
     tgcatgcgtg tgaatacaag gaagacatga agaagacaga gtaaaatggg aggatggaag    132900
     ctatggatat gttgtattgg ctgttgattg cagcggtttt tatcattgcc tttatcgggc    132960
     tggtgtatcc tgttattcct agcgtagtat ttattgttgc cggatttgta ttgtacggat    133020
     ttttattttc attcagtccg tattcttata tgttctggct tgttgaggca gtttttgccg    133080
     cagtattatt cgcagcagat tacgtgtcga atctgcttgg agtaaaaagg ttcggaggaa    133140
     gcaaagctgc catatgggga agcacgatcg gtttattaat cgggcctttt gtcattccgg    133200
     ttgcagggat catattgggg ccgtttatcg gggctgtttg cgcagaactt atcgtccatc    133260
     agaaggactt aaagtcagcg tttaaaattg gcctcggctc actcattggt tttttaacag    133320
     gggttattgc aaagggcatc atacagcttt tgatgatcgg ttacttttta tggacggtcc    133380
     tataagaaat gctggcggca ggtttaatgg ggcagattat cggttaaagt gaaatatgtc    133440
     cgctgaaatg agccaaatcg tgagcttttt cattgattac aaagcattct tttgttacat    133500
     tgaatgaaga aaggctcgct gtgaagcgtc atttcagtac atatatacta aggaggaatt    133560
     atcatggctt acgaacttcc agaattacct tatgcgtacg atgctttaga accgcatatc    133620
     gacaaggaaa ctatgactat tcaccatacg aaacaccaca acacatacgt gacaaattta    133680
     aacaaagcgg ttgaaggaaa cactgctctt gccaacaaat cagttgaaga gcttgttgca    133740
     gatcttgatt ctgttcctga aaacatccgc actgcagtcc gcaacaacgg cggcggacac    133800
     gcgaaccaca aattattctg gacactttta tctccaaacg gcggaggcga accgactggc    133860
     gcgcttgctg aagagattaa cagtgtattt ggaagctttg acaaattcaa agagcaattc    133920
     gcagcagcag cagctggacg cttcggttct ggctgggcat ggcttgttgt gaacaacggt    133980
     aaacttgaaa tcacaagcac gccaaaccaa gattctccgc tttcagaagg caaaacgcct    134040
     atcttaggtc ttgacgtttg ggagcatgct tactacctta actatcaaaa ccgccgtcct    134100
     gattacattt cagctttctg gaatgttgta aactgggacg aagtggctcg tctatacagc    134160
     gacgaaaata atggcacaaa caaggtcctc attatgggac cttgtttttt tatgtcttct    134220
     ttttacatat ctcggtttga gtgagacaga ctaagggata gtaaagggga gtcagtaatg    134280
     agcaaactaa aaaaagtgat aggcgatgta gacgtaaaca aaggcttact ctttctgctg    134340
     accattggcg ggctttactc gctgggaatt gcactgtcca atacatttgt taatgtgtat    134400
     ctttggaagc agtcagggaa atttattgat ttggcgatat ataatttatc cattgtgaca    134460
     atgcagccga taacctttta tttggctgga cggttagcca aaaaaataga cagggtattc    134520
     attttaaggt tcggcgtcat ttttttagct gccttttatt taagtgtgct tttagccgga    134580
     gaaacggcgg ccagccgcct cgtgctaatc ggcgcggtgc tcggagttgg ctatggcttt    134640
     tattggctag cgtttaacgt gctgaccttt gaaataacag agccggatac acgagacttt    134700
     ttcaacgggt ttatgggcat tctgtcttcc tctgcaggaa tgatcggccc gattgtagcc    134760
     ggattcgtga tctcaaggct tgaaaataat acgggttata cagtgatttt cagtctctcc    134820
     ctcagtttat ttgccctggc tgtcgtgatg agctttttct taaaacggag agaatcaaag    134880
     ggccgtttta tgctgagcaa agtatttgga gagcgccata gcaatatgaa ttggcggaga    134940
     atcacgaatg cgcatttttt tcagggtttg agagaaggga tttttgtctt tttaatcagt    135000
     gtgtttgtat ttattgagac aaacagcgag cttgctctcg gtacattcgg tcttgtcaat    135060
     tcagctgttt ccttccttgc ctactacttt gcatccaggc tgattaagaa aaaggcgaga    135120
     aaaaaatcga ttttgctggg cggacttatt ttgtatggcg cgctgttttt gattctgttc    135180
     catatgagct tttcgacatt attaacgtac ggcgttttta ttgccatcgg ctatcctctg    135240
     ttgcttgtgc catatgtatc acttacatat gatgtgatag ggcgcgcgag gcatgccaga    135300
     aaagcaagaa ttgaatatat cgtgcttaga gaaatgttct tgaacgccgg cagaattgtt    135360
     tccattttgt gctttctcct gattgtggcc cttctgaaag aggatgtggg aattcctttg    135420
     tcacttgcga tattgggtat aggacatcct ttgatttatt actttgtcaa ggatattcgt    135480
     tttaaggaga aagaagggga aaatgaaacc atggaagaag acggccaaaa acgggtaaca    135540
     gaaccgaccc ttttaaaagg cgagagataa tttttttgcc aaaaaggggt tatctgtaga    135600
     aaaaagtcga aaaaaccttt aaaatgaaaa ctggcactct tacttgagtg tcttttcttt    135660
     ctgtaaatag aaaaggtgat gttatgagga gaaataaacc aaaaaagcaa aatcataaag    135720
     agaaaaagaa gtcgcttccg atccggctga atattttatt tttagctgcc tttgttatat    135780
     ttacctggat tattgtggaa ctgggcatca agcagatcgt gcaaggtgat gattacaaaa    135840
     accaagcgaa taagcaggaa caaagtgaag tcagctcagc ggtaccacgc gggaaaattt    135900
     atgatcgaaa ctttaatgcc attgtgacaa ataaggcttt aaatgcaatc acatacacga    135960
     gatctaaatc gaccacgcaa gaacagcgct taaagatcgc aaaaaagctg tctgacatga    136020
     tcaaagtcga tacaaaaaaa gtaacagaac gggataaaaa agattattgg attttgacta    136080
     gaccgaaaga agcgaaaaag ctcattagct ctaaagaaag acagcaggtt gaagacaaaa    136140
     aaatatccga tgacgattta taccagcttc agctaaaacg gattactgat aagcagctga    136200
     atgaattgac ggataaagat atgcagatcc ttgctatcaa aagacagatg gattcgggct    136260
     atgcattgac ccctcaatat atcaaaaacg aagatgtatc agcgaaggaa atggcagtgg    136320
     taagtgaaca tttagacgaa ctgccaggtg ttgatgtcac gtccgattgg gaacgtgaat    136380
     atccttataa aaaccttctt cgctcagtgc tcggaagtgt ttccagctct aatgaaggat    136440
     tgccgtccaa cttgctcgac cattatctgt cgcttggcta cagccgaaat gacagggtcg    136500
     gaaaaagcta tctggaatac caatatgaaa gccttctgca gggccaaaaa gcaaaagtcg    136560
     aaaatatcac agattcaaaa ggcaatgtca cgggaacaaa aacggtatct gaaggcaaag    136620
     ccgggaaaga tcttgtacta acaattgata ttgatttgca aaaatcagtg gaaaaaatta    136680
     ttgagaaaaa acttaaagct gctaaagcaa gacctagtac cgaattgttg gatcgtgcat    136740
     tcgttgtcat gatggaccct agaaacggcg aagtgctgac aatggcaggg aagcagatta    136800
     aacgagaaaa tggagcctat aagtttgatg attatgcatt aggagccatg acttcatcct    136860
     acgctatggg atcagctgta aaaggtgcaa ccgttttgac cggtcttcaa actggagcga    136920
     ttaatttgaa tactgtattt aaggatgaac cattgtatat cggccaggat aaaagaggga    136980
     aaaaatcttg gcaaaactta gggccggttg gtattcaaac tgcattagag aagtcatcaa    137040
     acgtttttat gtttaaaaca gcaattgcag ttggtaaagg tgaatataaa cctcaccaag    137100
     cattgccttt ggatacttct gcatttgata ccttcagaaa ttatttcagt caatttggat    137160
     taggagtaaa aacaggaatt gatctaccaa atgaaatgac gggatataaa ggtacaagca    137220
     gattatctgg tttcttgctt gatttcgcca ttggacagta tgatacttat acaccgctgg    137280
     aattggctca atatgtctcc accatagcaa atggtggcta ccgcatgaag cctcagcttg    137340
     taaaggaagt cagagattca aatgcgaaaa aagggatcgg cgcagtcgtt gattctgttc    137400
     agcctgaagt attgaataaa gtcgatatga agagtagcta tattgaagag gtccaagccg    137460
     gttttagacg ggttgccact aaagggacag ctgcaggtca actggcttca gcatcgtata    137520
     aaccagctgc aaaaacagga acagcccaat cattttacga cggaccggat aaatcaaaaa    137580
     caggaacaga cacttataat acgacgcttg tggcttatgc accagctgac aatcctgaga    137640
     ttgctatttc tgtcgtagtt ccttggactt acattgatta caatcaaaga tactcaatta    137700
     caaacgaaat cggcagggaa gtaatggata aatattttga gctgaaatcg aagcaggaca    137760
     aagaaggtac tcagcaaaag aataaagaca aaattgaaga aaatgcagaa aacacaacgt    137820
     cttctgataa ctaaaaaaaa cgctcacatg atgtgggcgt tttttttata caaaaaaacg    137880
     cactgattta caaaacctta acattcggtt caaacccttt ttacatagaa cctttactct    137940
     atacgtgtag gacaaattac acattatacg cagggggaat tcaggaaatg aaaaaaaaca    138000
     aattggtgct tatgcttctg atggctgctt ttatgatgat tgcagctgca tgcggaaatg    138060
     caggagaaag taaaaaatcg aatagcgatt ctgcaaaagg agaagaaaag gcatcaggtt    138120
     ctttaaccat ttctggttca tcggcaatgc agccactagt acttgcagcc gcggaaaaat    138180
     ttatggaaga aaaccctgat gctgatatac aggtacaagc tggcggttct ggaacagggc    138240
     tttctcaagt ctctgaagga gctgttcaga tcgggaattc agacgttttt gctgaagaaa    138300
     aagaaggcat cgatgcaaaa gcgcttgtcg atcatcaagt cgctgtagtt ggtatggcag    138360
     cagctgtaaa ccctgatgct ggtgtaaagg atatttcaaa agatgaattg aaaaaaatct    138420
     tcactggcaa aatcaaaaac tggaaagagc tcggcggcaa agaccaaaag attacacttg    138480
     taaaccgccc tgattcttcc ggcacacgtg ctacatttgt gaaatatgcg cttgacggag    138540
     cggagcctgc agaaggcatt actgaagatt cctccaacac ggtgaaaaag atcattgctg    138600
     atactccggg agcgattgga tatcttgcat tctcatattt aacagatgac aaagtaactg    138660
     ctctatctat tgacggtgtt aaacctgaag cgaaaaatgt agcaactggc gagtatccga    138720
     tctgggctta tcaacattct tatacaaaag gtgaagcgac aggtttagct aaagaatttc    138780
     ttgattatct aaagagtgaa gacattcaaa aaagcattgt tactgaccaa ggctacattc    138840
     cggttactga tatgaaagtg acacgtgatg ccaacgggaa gcaaagctga tcttaataaa    138900
     aagaggagtg cggggacaac cgtttctcct cttaacacat tcataggagt gtaaaacaat    138960
     gataaacaat agagaaaata tgtctgtgag cgagcgctta atcagctcta ggcaaaatcg    139020
     gcaattggat gaagttcggg gaagaatgat agtcacagct tgtgcactga ttatgattgc    139080
     ggcatctgtt gcgattacca ttttcctcgg cgttaagggg ctgcaatctt ttcttgtaaa    139140
     tggtgtaagc ccaattgaat tcttaacgag cttaaattgg aatcctacag atagtgatcc    139200
     gaaatacgga gtgctgccat ttatttttgg ctcatttgca gtaacgattc tttctgctct    139260
     aatcgctgcg ccgcttggca ttgcaggtcc gatttttatg acagagattg ccccgaattg    139320
     gggaaagaaa gtgctgcagc cggtgattga gcttttagtc ggtattccat ctgttgttta    139380
     tggattcata ggtcttacag tattggtgcc gtttatcgcc cagttcaaat cgagcggaac    139440
     agggcacagt ttattggcgg gaacgattgt cctttccgtc atgattctgc cgacgatcac    139500
     atcgatttct gctgatgcaa tggcttctct tccgaagagt ttacgagagg gttcttacgc    139560
     gcttggtgcc acaagatggc agacgatcag aaaagtactt gtgcctgcag cttttccaac    139620
     attgatgaca gctgttgtgt taggcatggc tcgggcgttc ggtgaagctt tggctgttca    139680
     gatggtcatt ggaaatacaa gagtattgcc ggaaagcccg tttgacactg cgggaacgct    139740
     gacaacgatc atcacgctga atatgggcca caccacatac ggaagtgttg aaaacaatac    139800
     gctgtggtca atggggcttg tgcttctggt gatgtcattc ttgttcatcc tgcttattcg    139860
     ctacttgtca tctaggagga aagtgtaatg aaccgcaaaa taacagataa actggcgacc    139920
     ggaatgtttg gtttgtgtgc agccattatc gctgccattt tagtaggttt gttttcctat    139980
     attattataa acggtgtttc tcagctcagt tttcaattta ttacaacaaa gtcgagcgcc    140040
     attgcagctg gaggaggcat acgagatcag ctgtttaact ccttttatat tttgtttatt    140100
     acaatgctga ttacaatccc gctcggtgtg ggcggcggag tcttcatggc tgaatacgcg    140160
     cctaataaca aagtaactga cttcattaga acatgtatag aggtgctttc atctcttccg    140220
     tctattgtca ttgggatgtt tggattattg atgtttgtca acttaacagg ctggggttat    140280
     acgatcatag gcggagcgct tgcgttaact gtttttaacc ttcctgtcat ggtgcgtgtg    140340
     acagaagacg cgatccgttc agtccctaaa gatctgaagg aagcctctct cgctttaggt    140400
     gtatcacgct ggcataccgt aaaaacagtt ttaattccaa gtgcgattcc ttctatcatc    140460
     acaggagcaa ttttagcgtc aggaagggtg ttcggggaag cggccgcatt attatttacg    140520
     gcaggcctga caacaccgcg tcttaatttt acggagtgga acccgttttc ggaaacatca    140580
     ccgcttaata ttttcaggcc cgctgaaaca cttgcggtcc acatttggaa cgtcaataca    140640
     caaggaatga ttccggatgc tgaagcgatt gccaacggtg gttctcccgt gctggtgatt    140700
     tctgttcttg tgtttaatct cgcggcgaga tggcttggca cgatgatcta caaaaagctt    140760
     acggcaaatt agaacggaaa gaggcgaaaa acatgtctga acaaatggta aaagaaaaac    140820
     ctgagcgagc tgttattgtt ccgaagcaga accacgtgct tgaggtcaaa gatctgtcca    140880
     tttattacgg aaataaacaa gccgttcatc atgtaaacat ggatattgaa aaaaatgcgg    140940
     tgactgcttt aattgggccg tcgggatgcg gaaaatctac ttttttgaga aatattaacc    141000
     gaatgaacga tttaattcca tctgcaagag cggaaggtga aatcctttat gagggattaa    141060
     atatattggg cggcaatatt aacgttgtca gcttgagaag agaaatcgga atggttttcc    141120
     aaaaaccaaa tccatttccg aaatcgatct atgcgaatat cacacatgca ttgaaatatg    141180
     ccggagagcg gaataaagct gttttagatg aaattgtgga agaaagttta acaaaagcag    141240
     cgctctggga tgaggtgaag gatcgtttac attcatccgc actctcgtta tccggcggcc    141300
     agcagcagcg tttatgcatc gcgagaacgc ttgcgatgaa gccggctgtt cttctgcttg    141360
     atgaaccagc ttcagcgctt gatccgattt caaatgcaaa aatagaggaa ttaattacag    141420
     gattgaaaag agaatactca attattattg tcacgcacaa tatgcagcag gctctgcggg    141480
     tttctgaccg gacggcattc tttttaaacg gcgagcttgt agaatacgga cagaccgaac    141540
     agattttcac gagtccgaaa aagcaaaaga cagaggatta tattaacggg aaattcggat    141600
     aggagggcgg caatgagtat tgctaccgaa gctgtaatga aacaggaagt atatcaagtc    141660
     aatggaatga acttatggta tgggcagcat catgctttaa aaaatatcaa tttgagcatt    141720
     tatgaaaatg aggttacggc gattatcgga ccatccggat gcgggaaatc gacctttatc    141780
     aagacattga atttaatgat tcaaatgacg ccgaatgtaa agcttgcagg tgagctgaac    141840
     tataatggca gcaacatttt aaaggataaa gtggacatcg tggatttgcg aaaaaatatc    141900
     ggcatggtat tccaaaaagg gaatccgttt ccgcaatcta tttttgataa tgtggcttac    141960
     ggaccgagag tccacggcac caaaaataag aagaagcttc aggaaattgt ggaaaagtca    142020
     ttaaaagacg tggcgttatg ggatgaggtg aaggatcgat tgcatacgtc cgctctttcg    142080
     ctgtcagggg gccagcagca gcgtctttgc atcgccagag cacttgcgac caatcctgat    142140
     attttgctga tggatgaacc gacatctgca ctagatccaa tctcaacgag aaaaattgaa    142200
     gaactcattc tagagctgaa agataaatat acaattgtca ttgtcacgca taacatgcag    142260
     caggcagcaa gggtttctga tcaaaccgcc tttttctaca tgggcgagct tgttgaatgc    142320
     gacaatacga ataaaatgtt ctctaacccg aaggaccaaa gaacgctcga ttacatttca    142380
     ggaaagtttg gatgaaaaaa acaggctgag tcagcctgtt tttttatcgt gttaacgttt    142440
     ttacgatctt tttgaaactc atgtctgatt ttactttaaa cttgccggca cgaatttctt    142500
     tgtgatagcc ggcatcaatg acatagtcat taaagtcttg agccgaagag ataatgccct    142560
     ctttttcaag aatagcagat acatccgccg tgctcatgcc gtctttaatg gtgagcttgt    142620
     aggttttgac tttgtctgat ttcgtgtctg agccgctgtc attgtttaag gatttctctt    142680
     ttgaatcgag aagtttttga tattcatcac ggttgacaga aaccaatttt ttagaatcaa    142740
     gataattgtt cacgtcttgt tcggttactg ttttattatc ttttacagca gcggcctggt    142800
     cttcgtcagt cagataaaaa acagctgcaa gaacggctgt cgctaaaatg atgccgccag    142860
     caaatgcctg aatgccccgt tttgtcatac gagcaccttc tcattatctt tgataatcgt    142920
     attcacgtct tccactgata catgttcagc tttagcaatc gcttcagctg acataccgtt    142980
     attatattta gaaagtattt gtttagcgat tttttgattg atgtcgttct gctttgattt    143040
     gcgaatgaca aggtttgttt ccagtaattc ttcctcaagc actgtcattt tctttttgag    143100
     cttgtaaatt tcctgcatcg cagaaagctg cagtgtttcg agctcctgtt ctacatcttt    143160
     catcgggtct ctttgagaat atgagaatgc aattagcgct atactgacga taaacaacgc    143220
     aataatagca atttccacgt ttcatcacct tctattcttt ttgtatcctt ctttttcata    143280
     ccataaaacc aatagtttct aaaggaattc gcgaaaaaaa cgagattttg tcgagaaatc    143340
     tttcttcgct tcttcttcat gtaatggttt aataggaaca cgaagtgaac gattggaaag    143400
     gagaatgtta ggagtccatg gataaacacc catttcccta taatatacga cataagcttt    143460
     ccttttttag ggacacattc gacataatca ttcaaaacgc tcacaccttg accgtaagct    143520
     gggaaatctc agaagaaaca atgcggctgg ctgaagcggt ccttttcgaa aaaacgcagg    143580
     atatgataaa agaattgcgc attgtcatca aaagaaaaga cattgaagct gtcaggacaa    143640
     aacgcacaac gtatgataaa ggagaatgga cgattagaca ggcggctggt gatgctgtat    143700
     atcgggctga atacagaatt gtgaattcaa tgaatgtctc tctcaagctt gccggtacag    143760
     acgacatcta tcttgatgaa aatgggattc gtcatataaa cagttttcag attgaagaag    143820
     cgcacaccag gtgggaggcg caattttctg catacacctg ttatgggaga ggggaaaaag    143880
     aacggtgaac attctcatgc tttcacccga acatcccgat gagccgaaaa gcgggctcgg    143940
     tgtccattta aaccgcctca tttcctattt aaaccctcat atcaacatta cggtttttac    144000
     tccgagcggg cagctgtttt cgtatgcgaa gtttgaagat tacatagctg atgctaactt    144060
     tacaatggtt cgccatgtgt tatcacacaa taaacgcttt gatctgattc atgcccatga    144120
     tgacacaact gcccctgccg cccagtattt gaaacaacgg cttggccttc cgcttgctgc    144180
     gacaatccac ggtcttgaaa gcgaaaggaa gaaggtgtgc cgagaagccc cacacccata    144240
     caggctcatg accgaacggc tccttataga atccgctgat gcattgatcg tattaagcac    144300
     atttatgaag cggtctcttg ataaggcggc acataagaaa ataaccgtta tcccaagccc    144360
     tgcatctatg gaggaagaga aggggaaaat cccgagaagc atgaatagaa gattcctctt    144420
     ttcatatgga aggtttgtcc cggaaaaagg attatcgcag ctgttaaagg tgtttgccat    144480
     cttgaagcag cgtcagcctg acctctatct agtgctggct ggggaggggc cgtctctgtc    144540
     ctgctatgag aaattggctg cggcatataa cctgaaggat cgcatcatgt ttctgccgtt    144600
     tctaaatagg aaagatatca gaacgttact gtctcactgt gaaatggctg ttttccctag    144660
     ttcttatgaa ccgtttgggc ttgccgcgca agaaagcatg gaacaaggtg tgctgactgt    144720
     cgtttctcag tcaggtggtt tttgtgatta tgcggttcat gacaaaacgg caatcatcgc    144780
     tgattttacg ctcgtacagg aagctgctga tctgctggac agttttttaa aagaccggga    144840
     aaaagcccgc cggataaaag aagctggcag acaacaagtg ttcaagctcc accacccccg    144900
     actcattatg tcatcatatt tgcagcttta tgagcgtatc ttcaataatt cagcaattca    144960
     ttgaaaaaca gcctagcatt ccgtccatta tagtggtatt atatataagt ctgaataagt    145020
     aaatgatttt agtttggagg gaaaataatg cgcgttaata ttactttggc ttgcactgaa    145080
     tgtcgtgagc gtaactatat ttctaaaaag accaaacgca acaatccaga ccgcgttgaa    145140
     tttaaaaaat attgcccacg tgataaaaaa tctacgttac accgtgaaac aaaataacag    145200
     ctttgctgtt tgaggtgtaa gaaaaaagcc agagctttga aaaaggttct ggcttttttt    145260
     ctattccgag ggggatgaga gatgaaatca caattaagaa aaaagacgct ggaggcactg    145320
     tctgctttat caaatgaaga tattcttcaa aaaacggaac gtatgtataa gtacttgttt    145380
     tctctgccgg agtggcaaaa tgccggcacc attgccgtca ctatttccag aggattagag    145440
     ataccgacgc gtcctgtcat tgagcaggct tgggaagaag ggaaacaagt ttgcatccca    145500
     aaatgccatc cggacacgaa gaaaatgcaa tttcgcacat atcagactga tgatcagctc    145560
     gaaaccgtgt acgccggact gctcgagccg gtaattgaaa aaacaaaaga agtaaaccca    145620
     tcacaaattg acttgatgat cgttccgggt gtttgttttg atgttaacgg gtttagggtc    145680
     ggctttggag gcggctatta tgatcgctat ttaagtgaat atgaagggaa gacagtctct    145740
     ttgcttttgg agtgccagtt gtttgcgcac gtaccccgtc tgccgcatga catcccggta    145800
     cataagctga taacagagga tcggattatt tcttgttttt cataactttc ctgtccctta    145860
     ttcgagaata aataaggtag aataacaaac cctattggca ggagggatat catgaaaaaa    145920
     cttttgatat atgccatttt cgcggtttct gccgtcatgt tttatcaaaa tcgctaccgt    145980
     cttatgaata ctgtactcag ccagccagga atcaggcggt cttttatcca tttgttttta    146040
     agaattccat ttatccgcaa taagtttata cagcaagctt tctaaaatcc cgtgaaaaac    146100
     gggatttttt gctttcagta ggcgtttcgg agcgccagct gttataatga aaaaaaacta    146160
     ttggagcggt aaacatgttt ttgctggagt atacatattg gaaaattgcg gcgcacctgg    146220
     tgaatagcgg gtatggcgtc atacaagccg gtgagtcaga tgaaatatgg ctggaagcgc    146280
     cggacaagtc ctctcatgat ctagttcgtc tttataagca cgatcttgat ttccgtcaag    146340
     aaatggttag agacatcgaa gagcaggccg aacgagtaga acgagtcaga catcaattgg    146400
     gcagacgaag gatgaagctg ctgaacgtgt ttttttcaac ggaagcccca gttgatgact    146460
     gggaagagat tgcaaaaaaa acttttgaga agggaactgt gtcagttgag ccggcgatcg    146520
     ttagaggaac gatgcttcga gatgatcttc aagcggtttt tccatcattt cgtacagaag    146580
     attgttcaga ggaacacgct tcgtttgaaa acgcgcaaat ggcgcgagaa cgcttccttt    146640
     cgctagtgct gaaacaagaa gaacagagaa aaactgaagc ggcggttttt caaaacggaa    146700
     aaccgacttt tacatattta tttattgcgc ttcagatcct gatgttttcc ttgctcgaaa    146760
     taaacggagg cagcactaat acggagacac tggtggcttt tggagcaaaa gaaaacagcc    146820
     tgattgcaca aggagaatgg tggcggcttc tgacaccgat cgtgcttcac atcggcatag    146880
     cgcatttagc ttttaatacg ctggctttat ggtcggttgg tacagcggtt gagcggatgt    146940
     atggatcggg gagatttttg ctgatttatc tggctgctgg cattacgggt tcgattgcga    147000
     gttttgtgtt cagcccgtat ccttcggcag gggcatcagg agccatattc ggatgcttag    147060
     gtgcattact gtatgttgct ttgtctaatc gaaaaatgtt tttaagaact ataggaacca    147120
     atattattgt cattattatc atcaatctgg gctttggttt tgcggtttcg aatattgata    147180
     attcaggaca tatcggcggc ttgattggcg gctttttcgc tgcagcagca ctggggttgc    147240
     ctaaagccgg agcctttgga aaaagattgt tgtcagcggt tttcctgatt gctttggctg    147300
     ttggattttc atattacgga ttgcattcgc cttcacacca ggagtcagcg ctgattcagc    147360
     aggcaagcga gctgtatcag gaaggaaagt atgaagaagt aacagaattg ctgaacggag    147420
     aagcagcgca aaaagatgcc tctgccgatc ttttgaaaat tcttgctgtt tctgatattc    147480
     aaatcggcga atatgatcag gcggtttccc ttttggaacg agcagtgaaa aaagaaccta    147540
     aagaccatgc ttcctattac aatttagcgt tattgtatgc ggaaaaaaat gagcttgcac    147600
     aagcagaaaa ggccatccag acggctgtga aactgaagcc gaaggagcag cgctacaagg    147660
     agctgcagtg gcaaattgaa aacaataaag aatcatagag gtggaatatg gaaaggaagc    147720
     tggctttttt gtcagcgttt tcttcttgac tgaccgcttc cttatgaata cgcttatgat    147780
     agttaagttc aagaaatggt gaggaaaatg aatacatttt atgatgtgca gcagctgtta    147840
     aaaacgtttg gccacattgt ttattttgga gacagagagc ttgaaattga gtttatgctg    147900
     gatgaattaa aggaattata catgaaccac atgattgaaa aggagcagtg ggccagagcg    147960
     gcagctgtcc ttcgaaaaga attggaacaa acaaaaaacg gaagagattt ttataaaggc    148020
     taaggtgata aaaatggacg agatatggtt tgcgggcatt gacctgggag gaacgacgat    148080
     taaactcgct tttattaatc aatatggcga aattcagcat aagtgggaag ttccgacaga    148140
     taaaaccggc gacacgatta ctgtcacaat tgcaaaaaca atcgacagca agctggatga    148200
     gctgcaaaaa ccgaagcaca tcatcaaata catcggaatg ggtgcaccag gccctgtaga    148260
     tatggcggca ggagtggttt atgaaacagt aaatctaggg tggaaaaatt atgctttgaa    148320
     aaaccatctg gagacagaaa ccggcatccc agctgttata gaaaatgacg cgaatattgc    148380
     tgcgctcggg gaaatgtgga agggagcggg tgatggcgca aaagacgtca ttctcgtgac    148440
     gcttggcaca ggagttggcg gcggcatcat tgcaaatggt gaaattttac atggtataaa    148500
     tggcgccggc ggagaaatcg gccatatttg cagcatccct gaaggcggag cgccctgcaa    148560
     ctgcggcaaa acgggctgta tcgaaacaat tgcgtcagca accggaattg taagaattgc    148620
     aaaaggaaaa atagcaaatg ctaaaaagac gacacgttta aaagcaaccg aacaattgtc    148680
     agcgcgagat gtgtttgaag cggcgggtga aaatgatgaa attgcccttg aggtggttga    148740
     ttatgtagcc aagcatcttg gtttggtgct cggaaatttg gcaagctcgc ttaatccatc    148800
     caaaatcgtt cttggcggcg gcgtatcgag agccggagaa ctgctgagat caaaagtcga    148860
     gaaaacattc cgcaaatgcg cgtttccgcg ggcagcccaa gctgctgata tttcaatcgc    148920
     agcacttgga aatgatgccg gcgttatcgg aggcgcttgg atcgctaaaa atgaatggct    148980
     gaaacatcaa aattgttaaa attgtgtaaa tgaaattgat ttttgttgtg ctcaggttaa    149040
     gatttaattt gatgtgttaa tgagaatgtt gggaatagac tgattttttt gagcgtgctg    149100
     cataggaggt tgaaatgcga aaaacgtttt ttccgaagat ttcatttacg ctgattgcca    149160
     ttttattgat gtggctgaaa acgtatgctg tttacaaaac cagttttcat attaaaatcg    149220
     acaatctaac acaggaattt attctgttta tcaacccatt gagttttttg ttgcttattt    149280
     ttggcctcag cctgttttta aaaggcaaaa acagaaatcg ctacattatc gcgatgagct    149340
     gtcttgtcac gtttgtattg ctggcaaata tggtttttta ccgtttttac aatgatttct    149400
     taacaatccc tgttcttttt caaacgagca atatgggtga tctcggaagc agcatcggaa    149460
     cacttcttga gccgacagac ctcctattag ctgtagatat tgcggtttta atatggcttc    149520
     acatccggca aaaagctttt caatcggaca ttccctcaac gaaaaatgaa cgggcggctt    149580
     attttttgtt cgttgcttct gtttatttct tcaacctggg cttgtctgag gcggaaagac    149640
     ctcagctatt gacacgctca tttgacagag aaatgcttgt taaaaacatt agcctgttta    149700
     attttcatat ttacgatggc gttcttcagt caaagcaatc cgcacagaga gcgttggcag    149760
     acagcaacag cctgacggag attgaaaact acgtaaccgc taatgcgaag gatgccaaca    149820
     aacgcttatt cggcgctgca aaaggaagga acgtcattct cgtatcctta gagtcgacgc    149880
     aaagcttcgt gattaatgaa aaattgaatg gagaagaaat cacgcctttt ctgaatgact    149940
     ttataaaaca gagctacaac tttaataatg tttaccacca aacaggccag gggaaaacct    150000
     cggattctga atttaacgtg gacaattcac tgtatccgct tggacgaggt gccgtatttt    150060
     ttacgaatgc gggcaatcaa tatatggccg ctcctgaaat tttgaaaaac agcggatact    150120
     attcagcggt gctccacgct aataataaga gcttttggaa tcgtgattta atgtacgact    150180
     catttggata tgattcgttt tttgatatta actcgtatga tgtaactgac gaaaatacag    150240
     tcggctgggg acttaaggat aaagaatttt ttgagcagtc ctcagagctg atgaaaaatc    150300
     tgcctcagcc gttttactcg aggctgatta cactgacgaa ccacttcccg tttgatcttg    150360
     atgaagagga tcaattgatt gatgaatatg attcaaacag ccagacgcta aataaatatt    150420
     ttccgacagt gcgttatcag gatgaggcgc tgaaacggtt tatcgaaaag ctgaaggaag    150480
     acgggttata cgacaactct gttattgtat tatatggtga ccattatggt atatcagaaa    150540
     accataatga agcgatgggg cagtttttag gaaaagaaat aaccccattt gaagaggtac    150600
     agctccaaaa agtgccgctg gtcattcata ttccgggtat tactgataaa aagccgcaaa    150660
     ccattgaaac agtaggcggg cagattgata tcaggccgac gctgatgaat cttttaggga    150720
     ttgatacgaa agatcaaatt caattcggca acgatctgct ttcagacgaa aaactggact    150780
     tcacggtgct ccgggacggg agctttatca cagatcaggt tgtttataca gacggtgcgt    150840
     gttatgacaa agagacggga aaaccgttag aagagacaaa acaatgtgaa gcatttgctg    150900
     ataaagcaaa acaggagcta tcactttctg atgaaatcat ttatggggat ttgttgcgat    150960
     tttatgacca gaaaaggctg gacaattcgt caaagcggaa agaaaaacaa atgcttgatc    151020
     aggcatcata atcacaatgt ctcccgcatc gaagtgagcg ggaggctttc tttttttaaa    151080
     tacgctgtca tatagtaaca aaaaaggggg atgatgatgg cgtttattac ggtgaaacct    151140
     gagatcaaga acaatttggc caatgtggcg aaagaactga agatagacga ggaattgctt    151200
     aaaagtgcaa atcgctccgc acaaaaacat caattgtatt gccctggtta tgtgatagag    151260
     gagcatagcg gcaaagagct tcaaaccatt caggacataa agcgcttttt acagcctcgg    151320
     cagctgaaac tttcagatag ctggattgag caagagaaaa tctatgatga ttcagctgtt    151380
     gaaaaggaaa taaagaagat tattgatgtt tttccgtttg tttcatgccg ggaaattggc    151440
     cgttctgtac tcggcaggcc tatctgggag ctgaaggctg gtggggagca tgccgtaaaa    151500
     aaggtccata tgaacgcgtc atttcatgcg aatgagtgga ttacaacgtc tgtcctgcta    151560
     aaatggttta aggaatactg tatgtcatta tgctgcaatt cgcctttctt tggcttttct    151620
     cccataaagc tgtttaacag cacatcctta tccctcgttc ctcttgtcaa tccggatggc    151680
     gttgatcttg ttttaaacgg atcagaagtc atgggagcca gaagagatga actcgaaagg    151740
     ctaaatgaac atcgtccaaa ttttaatgaa tggaaggcga atataaacgg ggttgattta    151800
     aataaacaat ttccatcatt atgggaaatt gaaaaatacc gaaaaccgac agcacccagc    151860
     taccgcgatt ttccgggaat ctctccgctt acggagccgg aatctattgc gatgtaccgg    151920
     ctgatcacgg agaatccgcc tgacagactg ctggctcttc atactcaagg agaagaaatt    151980
     tattggggct ataaaggcct tgagcctgag gaatctgctg ccgtcataaa ggagtttgag    152040
     gagttaagcg ggaacattta taagggagta agggatatag acagctatgc tggatttcgt    152100
     gattggttta ttcaccatta ttttaaggaa gggtatacgg tggaacttgg aaaaggccaa    152160
     aatcctttgc cgtttcagca gttttcacac atatataacg ccacaagcgg tatcttgtgg    152220
     agggcgttat tttttcatga gtaactgaaa ctttttcttt tttctgccga agcaaatatg    152280
     agagaataaa gatgatcgga ggggaatgct gatgagatca gtttgtttta ttctgctggc    152340
     ggtattgctg tttagtttat cggcatgcaa accatctcat cagcagcaaa aacaggcatc    152400
     ggcggcaaaa gatgagaaaa aagacatcat accgctttcc gcggaaaaag cggatggggc    152460
     ggaaggctgg ctgaataaca gcacaatatt atatactgcg tctaatccga cgaaaacaga    152520
     gctttttccg taccgcatct ttacaggcaa agcgaaaaag ctctatcaaa cggatggtca    152580
     aatcgttgat gttcaaatca atgcgaggga gcagatgatt ctgctgcaaa tcacacatag    152640
     ccaaaagacg gcagtggttt tgcttaatgc agaaggagag acgctttacg aaaaagatta    152700
     cgaaacgtat gagcttgaag ctgcttggaa tcagtatgat ccttatcaaa tgatggtgac    152760
     ggaattcaat gaaaactggg atttccatac atatcaggtg aatgctaaaa aagacgaatc    152820
     tttcttaagc ccagtacagg ttccgttcat tcattggaca tccaaaaata catttgatta    152880
     tgtaaaagag ggtagagacg ataaaacagg gcctttatat acgttcgata cagcttctaa    152940
     gacggaacag aagcttgagg ataacgttct attcttcgat tctttccatc aaatgagttt    153000
     tactgtcaaa tcagcttccg gaggaaaagg gacgtatcag tttaaaacgc cgcaatcaac    153060
     atcacctgtt acagcgaaat ggccgctcca agcgaaatat acaagtttgg ctccaatgga    153120
     gtatgactat gatgaagcag gaagcctgtt ttatacattc aaacaaagcg gcgatgcata    153180
     taagctcgca gcaatcaatg tagcatcggg agagacaaaa gatcttgtgt ctctgcggga    153240
     aatggagccg attcaaatat ctccgaacgg gaaatatgcg ttatacggct ttcattttga    153300
     gcaaattatt ttattgaaat cacatgaaac gaagcaactc atcattgatc aaaaggagat    153360
     ggaataacga tggctatcgc agatgtaacc attatcccaa tcggtacgga aacacccagt    153420
     gtcagtgctt acgtagccga tgtgcaaaag atattagaag gatatcaagc agaagggaaa    153480
     atcaaatatc agctgacacc gatgaatacg ctgatcgagg gagaactcag tgaccttttt    153540
     gcagttattc aggcaattca cgaagcgcca tttcaaaagg attgcacaga gtggcaacga    153600
     atatccgtat cgatgacagg cgtgacaaaa aaacgacgct tgagagcaaa atagaaagtg    153660
     tcaataaaca tttacagcca taaaaataaa cctgtatccg atcggataca ggttttaatg    153720
     tgcggttgga tacccgctgt ttattacggt catcacggta aaccatccaa agacaaataa    153780
     ggtggcaccg gctaataaaa acccgagtat atttttattt ctaacagaac gcaagactcc    153840
     ccataaagcg aaaagagcga caaggccgaa aatcacgaca agtaacataa cacagccccc    153900
     tttacattga aaaacctgca attgtttcca gttttattct acctgttttt tataggtttg    153960
     tcgatagcgg ttttcattgc gattgtttga atcttttttc aaaaaccctc ataataagag    154020
     cataaaaaag aaagaggtga taatagtgaa atggagacga atgccagtag ggccgattca    154080
     agcgaacgca tattttctca tcagtgatga tcaatgtctg atttttgatc cgggcggcga    154140
     gggacataaa atcaatcaat acataaaaga aaaagggctg acgcctttag ccattttgct    154200
     tacacatgcc cattttgacc atattggggc gcttgatgaa gtgagagaaa aatgggatat    154260
     ccctgtttac ctgcatcaaa atgaaaaaaa ttggcttgcg gacgcttctt taaacggctc    154320
     cggcatgctg cgagggatag aagtcacagc taagcctgca gatcatctaa ttgaaggcga    154380
     cggtgagttg aatatcgggc cgtttcattt ggaaacatta tttacgccgg gacattcacc    154440
     aggcagtgtg tcttactacg tgaaagatgc agacttggtc atttccggag atgtcttgtt    154500
     ccaaggcggt ataggacgta cggatttaat aggcggcaat caagagacgc tgctgacgtc    154560
     cattcatgaa aaactgctta cgcttccgga acacacgctg gtgttaagcg gccatggacc    154620
     tgaaacagac gtactgactg agcaggatca aaatccgttt ttaaatgggt tttcattgta    154680
     aaaaaagaga caaaccgata aggtttgtct ctttctgcat ttaatggcct ccgccgccgg    154740
     gcaccataat aaaaattgag taatatgtaa agccggcgaa gaaaattgtt aaataagcgc    154800
     caaaaatata aatatacatg cgttcggtta agttcaaata cgatagaaac acaaataaga    154860
     tcgtctgtcc aaaaaataaa agggaagcat ctttcatatc acctaaataa aacatgactg    154920
     caaaaattcc cgtccaaaat cctaacaccc ggaacatgcg attcattttt atcccctccc    154980
     gagagtccct ctgactgtta ttataataga tcacacctag aaatgtaaac attttcatta    155040
     ttaatataca aatggaattt gtccctttga ttgtgttttc tattgtatga atgtttttta    155100
     aaaaataatc cgaaaaaagt tctgtaaatg gtttaaatga aaaatgatcc gggtagttat    155160
     tctacaaaga gatggttaac tgaggaggaa aaaacgaatg gaacaacaat taacttttta    155220
     ctcatatcca agctgcacgt catgccgaaa aacaaaacat tggcttaaag cacatcaaat    155280
     tgaatttaac gaacggcact tattcagaga aaccccgaca agagaagaat taaagtacat    155340
     tttatcgtta acgacagaag gaattgatga aattttggcg acaagaagcc agactttcaa    155400
     aaatttaaat ttaaacattg aagaaatcac ggtaaatgag gtgctggaac ttttaatcga    155460
     gaagccgaag cttttgcgac gcccgattct agtagacaac aaaaagctgg tgattggtta    155520
     taacccggga gaactgttga agttatcgaa gaagaaaacg gttcatcaat ctgcatgatg    155580
     aaaaaccgaa gatccgctga tttatacgaa tcagcttatc ttcggttttt cacctgtcca    155640
     gaaactgggc tagctggatt cgaaccaacg atcacggagt caaagtccat tgccttaccg    155700
     cttggctata gcccattgaa tctaaacata gtatgtgtaa aggcagacgc gttatacata    155760
     tatagcgtac atttttcaaa aacaggaggt aactcattaa gatgatagct cttgatcagc    155820
     acttaacaga gcacaaaaaa gatattacgc aacaatggct ggaagtttgt acgtcaaacg    155880
     gcagctggct gtattcagcg aaagatcagc aaaaactagg acaaaagtta aaagaccagc    155940
     atgaattatt ggtgaccatc gtagcaaaat cccttagaaa agaagacgta gaggatgagc    156000
     tcaaccggtg gtctcttcaa tgcgccagag accgtgccgt tcatgaagtg acggttacac    156060
     aaagtttcgg ccagtttaac actttcaggc acatcatgtt tgaatggatt cataaattca    156120
     gcgaagcttc ttctcaagac atcagcattc aggaatttta tgagtggagc cggatcttga    156180
     atcaaaacat tgatgagatc atcgaagtgt ttacggaaga atatcaccag gtgaccatga    156240
     tacaattaaa cgcgcaaaaa gaaatgatta atgaattgag tgcgccgatt atgccgatta    156300
     ctgatggaat tgggattctt ccgcttgtcg gtgaaattga tacgcacaga gcgaggacga    156360
     ttttggagtc tgtgctggag cagtgctcag cgttaaagct ctcgtattta tttttagata    156420
     tttcgggcgt tcctatcgtt gataccatgg tagcctatca aatttttaaa gtgattgaca    156480
     gcaccaaatt gctcggcatt gagactatta tttcaggaat caggccggaa attgcccaaa    156540
     ctgtcgtgaa gctgggtctg gatttttcga atgtgaaaac agagcaaagt cttgctaaag    156600
     ccctggccaa taaagggttt aaaataaaag agtgttgatg cctttgccat gtttatcttg    156660
     aaagatagca gctgaacagc ctttcacggg ctattcagct tttttaactt ctataaataa    156720
     aatgtgatgg ctgttgatgt cttttacctt aaaagagtag ccatcatatt ctatggcact    156780
     ttcaggctca gcgtctatgt tttgtgttaa aaaccagccg cccaaggtgt ctacttcagc    156840
     ctctgataaa tcggttccaa gcaggctgtt aacatcgctg attaataatt ttgcatttaa    156900
     caagtaatga tcctttccaa gttcgcggat atgaggcact tcatccgcat caaattcatc    156960
     acggatttct cctacaattt cttcgataat atcctcgaca gtgaccaaac cggacgtccc    157020
     gccatattca tctatgagga tcgccatatg agtgcgttcc ttttgcattt tcagcaatag    157080
     tttataaata ggaatcgtct caattacatg gataacgggc tgtacgaaag gttcaatttg    157140
     atgcttcttg attgaaaaat ctttcgtcag catggaaaac agcacttctt tcatattaat    157200
     cacgccaatg acgttatctt tatcctctct tacaaccggg taccgtgtat attttgtttg    157260
     cttgactgtt tcctgaagat ttgaaatgga gtcttcatct agtgacaaac taaccatttc    157320
     atttcgcggc accataattt cctttgccat tcgtttatca aaggtgaaga tattattcat    157380
     gtactttaat tcactttttc tgatctcgcc gcttttatag ctttcagcca ataggacccg    157440
     aagttcttcc tctgtataag ccagctcatg ctctgatgcc ggcttcagcc caaacactcc    157500
     tgtaatcaat cgggcagagt ggttcaacag ccaaatgaat ggaaacatga tcttataaaa    157560
     ccaaataagc ggtttagcga acaacaaggt aatgctttct gctttttgaa tggcgaaact    157620
     ctttggcgcc agctccccaa taacgacatt taaatacgta accactaaaa atgcgatgac    157680
     gagtgaaagc aggtgggtaa gcgattcatt taagcctgct ttatgaaaaa gcggtcgaag    157740
     cagagtttgc acagtcggtt ccccaagcca tcccagtcct aaagctgcga ctgtgatgcc    157800
     cagctgacag gctgataaat attcatcaag gtgagtgatg acatgctttg ccgctttagc    157860
     acctttcttt ccttttgcga caagctgatc aattttggat cgccgcactt ttacgattga    157920
     aaattctacg gcaacgaaaa atcctgttaa caaaatgaga atagcgactg ctagtaaatt    157980
     gataaattcc aaaacaactg ccttctccaa ggaaggcatg cacctccctt ttccgatgtc    158040
     tttctacatt ccataccacc tgaaaatgct cataaaacat gtgttgaagc ggcagactgg    158100
     tttagtgacg cggttattgg gcaattaaag aataaagaac aaaagtttgg aggagcttga    158160
     catgaaggca catacgggaa aggattggtt ttggtaccaa atggggcctc aagaaagaag    158220
     taaggcaaga gatctaatcc atttttctca ctggcctcag tgtgaaaagt ggtttgaaaa    158280
     taaccatcac gttaattttt tgcgagtaga tacaactgaa acggaaaatg aagcagtatt    158340
     tgggtcgatt gtttatgatc aggggcttgg tgaagaaaaa gaccatactg tttttcactt    158400
     ttatatcacc agacaatatt tttttacaat caactttgac ttttcaattt tgagagagat    158460
     taaaggcaaa gaagttgttc ggcaaatgga aagagcggac aatgcgatag aggggttttt    158520
     aattcttctc ggcgaactaa tgaatgcgta tttaatcggt gttgatgaat ttgaagtcaa    158580
     gctgagaaag ctcagatggc aaattaaaga cgacaatagc aaaagcattt taaaccgcgt    158640
     ccatctcctg cgccatgaac tgatgatttg gaaaaatttg atattaagcg ctaaaaaaat    158700
     tgaaatggcg ttgaaagaaa cctttttacc tcaaaatgaa gggaaaaagg attatcagcg    158760
     gacacaactg aagattgaca ggggatttac atacatcagc gaatttgaag gggagcttaa    158820
     caatctgctg cattcagagg aagtcattac ctcacatagg gggaatgaaa ttgtaaaagc    158880
     gctgaccatt ttcacgacgc tttttactcc gattacagct ctgggtgcct tatgggggat    158940
     gaacttttca gtgatgccgg aactgaattg gaaatacgga tatctctttt ccctcttatt    159000
     gattgtcaca tctacagttc tgatctatct ctatttgaga aaaaaaggct ggacgggaga    159060
     tatgctgcag gagcggaaga agaaaaagaa acctcgaaaa aggcggactc tataggatgt    159120
     ttcatatttt gtgcagcgtg ccccgctttt tcaccagaca tatcagggtg accggatacg    159180
     atgtcaaggg gcttatgaca gagcattaaa tccgcagttt atcgattctt gaaaatgacc    159240
     aaatgaccgg tattgttgca ttaggcgatc tttccgttga gaaagatact ggtcaataag    159300
     cgaaaacagc ataatgaaaa tggaatctag caggcatggt gaccatgtct gcttttttat    159360
     ttatagggaa aattataatg acaggggtac attcagttga aagtcttttt tcttgccaga    159420
     aagaattggt ttttcagcat ataacatctc acaaaatcac gttttccctg tttgattacc    159480
     ttttcttctt tttctacaat atgcgttgaa aggagaggga atcaaattgg attcaataga    159540
     aaaggtaagc aaaaacttga ttgaagaggc atatctaaca aaggcttctg atattcacat    159600
     tgtgccgagg gagcgggacg ctatcattca ttttcgggtc gatcatgcct tgctgaaaaa    159660
     aagggacatg aaaaaagaag agtgcgtaag actgatttca cattttaaat ttctttcagc    159720
     aatggatata ggtgaaaggc gaaagccgca aaacggttcg cttacgttaa agttgaaaga    159780
     gggaaatgtt catttaagaa tgtcaacgct gcccacaatt aatgaagaaa gcctcgtgat    159840
     cagagtgatg ccccaataca atatcccttc gattgataaa ttgtcgctat ttccgaagac    159900
     aggagccaca ttactctcgt ttttaaaaca ttcccatggc atgctcattt ttaccgggcc    159960
     gactggttca gggaagacta ccacattata ctctctcgtt caatatgcaa aaaaacactt    160020
     taatcgaaat attgtcacat tagaggaccc tgttgaaaca agggacgaag atgttcttca    160080
     ggttcaggtg aatgaaaaag ccggtgtaac ttattccgca ggtctgaaag caattttgcg    160140
     ccatgacccc gatatgatta ttttaggtga gatcagagac gcggaaacag ctgaaattgc    160200
     ggtgcgggca gcgatgacgg gacatctggt actaacgagc cttcatacga gagacgcaaa    160260
     gggcgcaatt tacagactgc ttgaattcgg tatcaatatg aatgaaatcg aacagactgt    160320
     cattgcaata gcggctcagc gcttggttga tttggcttgc ccgttttgtg aaaacggatg    160380
     ttcatcagtg tattgccgac agtcacgaaa tactaggaga gctagcgttt atgagcttct    160440
     atacgggaaa aatcttcagc aatgtatcca ggaggcaaaa ggaaatcatg caaattacca    160500
     atatcaaacg cttcgtcaaa ttatcagaaa aggaattgcg ctcggctatt taacgacaaa    160560
     caactatgac cggtgggttt atcatgaaaa agattagaaa agtctggttg ttaaaggatc    160620
     aagccaggtt attaaagagg ctcggtgaaa tgactgcggg cggatataca cttctggatg    160680
     gattacgcct gatggaactt cagatgaata agaggcaggc ggctgacttg actgattcgg    160740
     tcacttgttt gagggaaggg gctccgtttt atcaagtact aaagagtttg tcatttcata    160800
     aggaagccgt aggtatttgt tattttgctg aaacacatgg tgaactgcct gcttcaatga    160860
     tccagagcgg agagctgctg gaacgaaaaa ttgcacaggc agaccagctg aaaagagtgc    160920
     tgcgctatcc gcttttcctc atctttacgg tcgctgtcat gttttatatg ttacagtcca    160980
     tcatcattcc tcagttttcc ggtatctatc aatcgatgaa tatggaaacc tcacgttcaa    161040
     ccgatatgct ttttgctttt tttcagcata ttgatcttgt gatcattttg cttgttcttt    161100
     ttacagcagg tatcgggatt tattattggc ttgtgtttaa gaaaaaatca cctgcccggc    161160
     aaatgctgat ttgtatcagg attcctttgg ttggaaagct tgtaaagctg tttaacagct    161220
     actttttttc tttgcagcta agcagccttt taaaatcagg cctctcaatt tatgacagcc    161280
     ttaatgcatt taaacatcaa acgtttctcc ctttctaccg ctgcgaggct gaacaattga    161340
     ttgaacggct aaaagccggt gagtcaattg aatccgctat ttgtggaagc cttttttatg    161400
     aaactgattt atcaaaagtc atatctcacg gccagctgag cggccgattg gatcgggagc    161460
     ttttcacata cagccaattc atattacagc ggctggaaca caaagcgcaa aaatggacag    161520
     gcatccttca gccaatgatt tatggatttg ttgcagcgat gatcttactt gtgtatttat    161580
     ctatgcttgt gcctatgtat cagatgatga atcaaatgtg aaaggaagag gctgatgaat    161640
     gagaaaggat ttacacttgt tgaaatgtta atcgtgctct ttattatttc gattttgctt    161700
     ttaattacga taccgaacgt cacgaaacat aatcaaacca ttcaaaaaaa gggctgtgaa    161760
     ggcttacaaa acatggttaa ggcacaaatg actgcatttg agcttgatca tgaaggacaa    161820
     actccgagcc ttgccgattt acagtcagag ggctatgtga aaaaggatgc tgtctgtcca    161880
     aatggtaagc gcattatcat caccggcgga gaagttaagg ttgaacatta aattaaacga    161940
     ggagaagggg tttacccttt tagaaagttt gcttgtgtta agccttgcct ctatcctcct    162000
     ggtggccgtc ttcactacac ttcctcctgc ttatgacaat acagctgtcc gacaggcagc    162060
     aagtcagctg aaaaatgata ttatgctcac acagcagact gctatttccc gtcaacaaag    162120
     aacaaaaatt ctctttcata aaaaagaata tcaattagtc attggtgata cggttattga    162180
     acgtccgtat gcaacgggac tttctataga actgctgaca ttaaaagacc gtttggaatt    162240
     taatgagaaa gggcacccga atgcaggcgg aaaaatacga gtaaaaggcc atgccgttta    162300
     tgacataaca gtttatctag ggagcgggag agtcaatgtg gagagaaaat aaaggttttt    162360
     ctacaataga aacaatgtct gcgctaagcc tgtggctgtt tgtgctgctg acagtcgtcc    162420
     ccttgtggga caagctgatg gctgatgaaa aaatggcgga atcacgagaa attggctatc    162480
     agatgatgaa tgagagcatt agcaaatatg tcatgagtgg tgaaggagcc gcgtcaaaaa    162540
     cgattacaaa gaacaatcat atctatgcaa tgaagtggga ggaggagggc gaatatcaaa    162600
     acgtatgtat caaagccgca gcttataaag aaaaatcatt ttgcctcagc attttgcaga    162660
     cagaatggct acacgcttct taacgtatta ttttcgctct cagtcttttt gctcatatca    162720
     ggatcgttag ctgcgattat ccatctgttt ttgtctcgac agcaggaaca tgacggtttc    162780
     acacagcagg aatggatgat ttcgatagaa cagatgatga atgaatgcaa ggaatcacag    162840
     gcagttaaga cagccgagca tgggagcgtg ttaatctgca ccaatctttc cggacaagac    162900
     atccgttttg acatttatca ttcaatgata agaaaaagag tggatggcaa agggcatgtt    162960
     ccgattttag atcatattac tgccatgaaa gctgatattg aaaatggtgt tgttttgctg    163020
     aaaattgaga gtgaagacca aaaagtgtat caaactgctt ttccagtcta ttcgtattta    163080
     ggaggggggt gaatgtatcg tacaagaggg tttatttatc cagctgttct ttttgtgtca    163140
     gcgcttgtgc tgttaatcgt gaactttgtt gctgctcaat atatttcacg ctgcatgttt    163200
     gagaaggaaa caaaagagtt atacatagga gagaatttgc ttcaaaatgg ggtgcttctt    163260
     tcgattcggc atgttctaga ggaacggaaa ggccaggagg gtacgcagca atttctatat    163320
     ggacgggttt cttattacat tcatgataca tcgataaaag aacaaaaaga aatcaactta    163380
     agagtgtcaa cggattcggg aacagaaaga actgcacaga tcgtgtttga ccaaaaacag    163440
     aaaaaactgc tgagatggac agaataaaac agtgtaaagg gtataaaaaa agtcatgtga    163500
     gacaacactc ataataattg aatgatgagg tgatcacgtg aaaacgaatg attatgttaa    163560
     atatatgacg cagcaatttg tcaaatatat agatactccg agagatgagc gaaaagaccg    163620
     aaaagaagtg cggaaagaaa caaaaacgcc tgtttcccag cagtggttcg gtattttacc    163680
     ctatggcttc cgacttttgg ctgaaacgga aaaaataacc gcaaataaac gaataaggtc    163740
     cttcaaaaaa tggaggacct tattgatatt cttctaatat ggcaatttta ttgacctttt    163800
     ggctataagg atcaaatgaa atcgtcacaa aaacgccgaa ttcttttgac ccttccctca    163860
     gagttaaatg gtattgcttc actgcttcat cttttctttt acggtcccat actttttgtt    163920
     tgaacagtac ctgtgcgagc gggtaccttt tttttgcttc ttttacagca atctcttccc    163980
     atttggacat gtggcgggcg gttacaagcg gtgtttcttc tgcgtgagcg gctgtggtgc    164040
     caaagacgag aagagataga caaatcacac attgtttgat catcatgctg tcaccctttc    164100
     tttgtttatt attaccaaat aataatggga tatgcattta aattctcaca taacaatccc    164160
     aaaaatttct aaaaaattga aaaaatgagc aatactgagc aagactttgt aatatgatga    164220
     aaacattctt ttaaacgaac aaaatgagcg atttcggtgt ttttaaatct ataaatcgtt    164280
     gattatactc tatttgtgaa gttctttaaa gagaacgatt gtcatatcaa gttacagtgt    164340
     tttacaggag gtaagatatg tttcgattgt ttcacaatca gcaaaaggcg aagacgaaac    164400
     tgaaagttct gcttatcttt cagctttcag tcattttcag tctgactgcc gcaatatgct    164460
     tacaattttc cgatgataca agcgctgctt ttcatgatat tgaaacattt gatgtctcac    164520
     ttcaaacgtg taaagacttt cagcatacag ataaaaactg ccattatgat aaacgctggg    164580
     atcaaagtga tttgcacata tcagatcaaa cggatacgaa aggcactgta tgctcacctt    164640
     tcgccttatt tgctgtgctc gaaaatacag gtgagaaact taagaaatca aagtggaagt    164700
     gggagcttca taagcttgaa aatgcccgca aaccgttaaa ggatgggaac gtgatcgaaa    164760
     aaggatttgt ctccaatcaa atcggcgatt cactttataa aattgagacc aagaaaaaaa    164820
     tgaaacccgg catttatgca tttaaagtat ataaaccggc aggctacccg gcaaacggca    164880
     gtacatttga gtggtcggag cctatgaggc ttgcaaaatg cgatgaaaaa ccgacagtcc    164940
     ctaaaaaaga aacaaagtcg gacgtcaaaa aggagaatga aacaacacaa aaagatatac    165000
     cggaaaaaac aatgaaagaa gaaacatctc aagaagctgt aaccaaagaa aaagaaactc    165060
     aatcagacca gaaggaaagc ggggaagagg atgaaaaaag caatgaagct gatcagtaat    165120
     attttatacg tgatcatctt tactcttatt attgtgctga cacttgtcgt gatttcaaca    165180
     cgttcatccg ggggagagcc ggcagtgttt gggtatacgc tgaaatcagt tctgtcaggt    165240
     tcgatggagc cggagttcaa tacaggttcc ttaatattgg tcaaagaaat cactgatgtg    165300
     aaagagctcc aaaaaggtga cgttattaca tttatgcagg atgcaaatac ggcggtcacc    165360
     cacagaattg ttgacataac aaagcaagga gaccatttgt tatttaaaac aaaaggtgat    165420
     aataatgcag cagctgattc agcgcctgta tcggacgaaa atgttcgcgc gcaatacaca    165480
     ggttttcagc ttccatatgc cggctatatg cttcattttg ccagccagcc gattggaacg    165540
     gctgtattat tgattgttcc cggcgtgatg ctgttagttt acgcttttgt gacgatcagc    165600
     agcgccatta gagaaattga aagaaagaca aaagccttgg aaacagatac aaaggacagc    165660
     accatgtcta cttaacttca gttgtaaacc tggcaacagg tttcgatata aaatcattca    165720
     ataaaagggg agcttaccat gggtatgaaa aagaaattga gtttaggagt tgcttctgca    165780
     gcactaggat tagctttagt tggaggagga acatgggcag catttaacga cattaaatca    165840
     aaggatgcta cttttgcatc aggtacgctt gatttatctg ctaaagagaa ttcagcgagt    165900
     gtgaacttat caaatctaaa gccgggagat aagttgacaa aggatttcca atttgaaaat    165960
     aacggatcac ttgcgatcaa agaagttcta atggcgctta attatggaga ttttaaagca    166020
     aacggcggca gcaatacatc tccagaagat ttcctcagcc agtttgaagt gacattgttg    166080
     acagttggaa aagagggcgg caatggctac ccgaaaaaca ttattttaga tgatgcgaac    166140
     cttaaagact tgtatttgat gtctgctaaa aatgatgcag cggctgctga aaaaatcaaa    166200
     aaacaaattg accctaaatt cttaaatgca agcggtaaag tcaatgtagc aacaattgat    166260
     ggtaaaaccg ctcctgaata tgatggtgtt ccaaaaacac caactgactt cgatcaggtt    166320
     caaatggaaa tccaattcaa ggatgataaa acaaaagatg aaaaagggct tatggttcaa    166380
     aataaatatc aaggcaactc cattaagctt caattctcat tcgaagctac acagtggaac    166440
     ggcttgacaa tcaaaaagga ccatactgat aaagatggtt acgtgaaaga aaatgaaaaa    166500
     gcgcatagcg aggataaaaa ttaataacag caaaaaaaag agacggccca gtattcatat    166560
     actgggccgt ctcgatggtt attgacaaaa gaggagttag tgcctctgct caggcactac    166620
     tcctcttttt gggattttct ccatttttga taatctaaaa attcacgaaa ttgttttttc    166680
     gataccccgg atgtcatcgc atcgcgaacc aatttctccc attcactatc taattgacca    166740
     tcgtattcgg tttcatgttt ctcatcgagc aaagtatgaa ccgagacgtc cagaacagcg    166800
     gagacttttt cgagaaattg aatggagggg ttcgtttgta gatttcgttc tattgagctt    166860
     aaataagact tcgctacccc agctttttca gctagttctg atagtgagta gcctttttct    166920
     ttacggtatt gtttaatacg ctggccaatc aatgtcatca ccttccttgt gatattatag    166980
     cacattcaga aaggatttac ggtatgactt ctggctgccg gaccaggatg agcagacttt    167040
     ttgtttaaaa gtaaatattt tcgtatttct tccgggctga tatttgcctc tttggcttcc    167100
     accattaatt caacccattc ttgatccaat tcaaagtgct cttgttttgc attcttcatg    167160
     cagtttctcc tcctaaaata cttgtttatg tatttcagcc agtccggcca tgacttattg    167220
     tatgcttcat tagtctctgg aagtcatttg ccattaaatc accagaattt ttttccaata    167280
     tacctttatt ataatcgtat tttctcaaaa aaaacgagaa tgatgtcgaa tggtaaaaaa    167340
     gttagcttga aatattattt tgcagataaa acaatccgcc attttcaatt tcaactgata    167400
     tctttggttg atacaaggtt ttcagcgcct gtttttctag atggtattct tctggttttt    167460
     cttctatatg ctcgtaaaac ttatcaagca atgtcatatc attcttccac ctgttaaccg    167520
     cctgttccgc ccagtcggac ggctcctgca tagcggattt ggaaatatag ttttccatac    167580
     gcttaagtcc gctttctggt ttgatcatag gtgaaatggt gaagcaatag tcacatattt    167640
     gagacgtcag tgaaaactgg gtcagcttgc tttgaaaatc ttcaattatc gttccagaga    167700
     ctaggtgaag acctagtgac aataacttat cctttttcat gtcggactgg tatgaaatcg    167760
     tgacatttat accaagccaa ggctgaagtg ggactttagc tccggctgat tcaattttct    167820
     catacattct ggtaaatctc ccattttgtt taacagcttt gaatatttga aaaagacgcg    167880
     gggccccaaa atatataaat tcaccatcta ggtcttttgg cgcattttct ttatctgtaa    167940
     taaaagtgat tttcattgga ttcggatcac cgcctgtctt ctcgcgccaa tgccagtaga    168000
     aagggcggtt catgatttgt ttgtccattt caactgtaag ctgcactgtc atatagccta    168060
     agccttgatc gacgatttgg cagctgtttg cttgaaaaaa acgcagcaga aaatcgtgaa    168120
     cctcttgctg tctcactaat aaaacctcct tacaggctaa gatcctcttt tttcagcagg    168180
     cagctgtttt ttataagaca aaaatgaggt taagttatcc atttttattt tcatttcttc    168240
     ttctgttgct gagtgataca aaatgtcatg aaggtgctct tcaaaattgt tcacttgaat    168300
     tttcgttaaa atatcatcaa gttcaccgac cactttttca aacaaatgaa ttttttcata    168360
     taaaagcttt agaatatgct cttccaccgt atgttttgtc gccatgttat aaatatgcac    168420
     gtcacgctcc tgcccgagtc tgtgaattct tccgattctt tgctcaagcc gcatcgggtt    168480
     ccatggcagg tcatagttga tcatgtgatt gcaaaattgc aggttaattc cctcaccgcc    168540
     tgcttcagtt gcaataagga cttggatttt tccgcggaaa agatccttca tccagtcttt    168600
     ttttccacgt ttaaatccgc ctctaaacgg cacagaactg atgccgtttt gctgaagaaa    168660
     ccactgcaga taaatctggg ttgcgcggta ttctgtaaaa atgatgacct tatcgtcgat    168720
     ctttttgatc aagtcaacaa cttgaagcgc tttagagttt tgtgtcactt gattgatgcg    168780
     atctatcaaa actgaaatcg tatcctcatc aatggcaggt gcttgtttct ctttttgatc    168840
     aagcatcttt ttcagcgtca tatataccgc ttctctgctc gaacagcatt ctctttgcaa    168900
     ggtcataatc gagaacatgc tggctggttt attgatactg tccttcaaac gagaaatttc    168960
     atcataaagc gcctgctctg atggagaaaa ttgaatcggc actgtttcaa catggcgctg    169020
     tttccaattc agccctgtat catgccgcct gttacggatc atgactttat tcacaagatc    169080
     ttttaaatgt tcatgcgctt ctaaactgga tttcttcttg gcgaactcct cctgaaagtg    169140
     attctgactg cctaaatggc cgggttttaa taaggacacc aaattgaaaa tctcttcgat    169200
     acggttctgg attggcgtcg cggtaagaag caggcaatat ttttttacga gattccggac    169260
     aaattcatag ttcttcgttt tgctattttt cagtttgtgt gcctcatcaa taatgacaag    169320
     atcatatggg atagacagaa cgatttctcg atggggcgag cgcttcgcgg tgtctattga    169380
     tgagacgaca atatcgcatt gctcccacac atagcttttc ttttgttcaa cagccggaat    169440
     caaaaatttt tcctgaagct ctttgaccca ctgtgacaca agggaagcgg gcacaaggat    169500
     caaaattttt tttgctaacc cgcgaatcat atattctttt agaatcagtc cagcttcaac    169560
     cgtttttccg agaccaacct catctgctaa aatcgctttc ccgttcattt tttcaaccac    169620
     tttttgcgcc acttcaagct ggtgggggag cggcgtaaag gaaggcagat ataaaggagc    169680
     ccgtaagcct tcaaactctg gaattgctaa tgttttctgg atttctgcag agagcttgta    169740
     cagttcccag tttgcccaag ggccatcgtt tttcagtctt tcagcaaatt cttcaggcca    169800
     ttttgcatcg tagatcattt ctgtattcat tgctttgaaa ccgcctttct tattcttcga    169860
     ttcttaagat gaataatata agaaaaatct gcccaaattg ctgttgccca gcatatagtg    169920
     atgatggtag gatatgagta tgtatttgat gtaagatatt gctatagtat gtccataaca    169980
     gcatgaaaat atgagcgaat gacagcaagg ggagagacct gaccgaaaac ctcgggatac    170040
     aggcgccgaa ggagcaaact gcggagtgaa tctctcaggc aaaagaactc ttgctcgacg    170100
     caactctgga gagtgtttgt gcggatgcgc aaaccacctt tggggacgtc tttgcgtatg    170160
     caaagtaaac tttcaggtgc caggacagag aaccttcatt ttacatgagg tgtttctctg    170220
     tccttttttg tatgtttttt agctgcgccg ttgataaagg ggaggaatta gatgctgaaa    170280
     agaacgccgt tatttgacct gtataaggaa tatggaggaa aaacgattga tttcggaggc    170340
     tgggagcttc ctgttcaatt ttcttctata aaaaaagaac acgaggctgt ccgaactgca    170400
     gccggtttgt ttgatgtatc tcatatggga gaagtcgaag tgtcagggaa cgacagtctg    170460
     tcttttttgc aaagattgat gacaaatgat gtttccgcgt taacgccagg ccgtgctcaa    170520
     tatacagcga tgtgttaccc ggatggcgga accgtcgatg atttgcttat ctatcaaaaa    170580
     ggagagaacc gctatctgct tgtcattaat gcttctaata tagataaaga cttggcttgg    170640
     atgaaagaac atgcagcagg tgatgtgcag attgacaatc agtcagatca aatcgcgctc    170700
     ttggctgtac agggaccgaa agcagaagcg atcttaaaaa atctgacaga tgcggatgtg    170760
     tctgcattaa agccgtttgc gtttattgat gaagccgata tcagcggccg caaagcactt    170820
     atttcacgca ctggctatac gggagaagac gggtatgaaa tttactgccg cagtgatgat    170880
     gctatgcata tttggaaaaa aatcatcgat gcaggggatg catacggatt gattccatgc    170940
     ggtctcggtg cacgtgatac actccggttt gaagcgaacg tcccgctcta cggtcaggag    171000
     ctgacccggg atattacacc gattgaagca ggtataggct ttgctgtaaa gcacaaaaag    171060
     gagtctgact ttttcggtaa gtcagtattg agtgaacaaa aagaaaacgg agcgaagcgc    171120
     aaacttgtcg gtctcgaaat gattgaaaaa gggataccgc ggcacggata tgaggttttc    171180
     caaaatggca agtctgtcgg aaaggtgaca accggcacgc agtcaccgac attaggaaaa    171240
     aacgtcggcc ttgccttaat tgattcggaa acgagtgaga tcgggactgt tgtagatgta    171300
     gagatacgca aaaaattagt gaaagcaaag gttgtcaaaa caccatttta taaacgctaa    171360
     tattttttct tggagagagg agacaacaca tgaagcaccg ttatttgccc gcaacagaaa    171420
     aggataaaca ggagatgctt gctactatcg gcgtaagcag catcgatgat ttatttgctg    171480
     atataccgga aaacgtcaaa tataaaaaag agcatcaaat caaaaaagcg aaatcagaga    171540
     cagaattaac aagagaactg acaaagctgg cctctaaaaa tcgtgatacc gtacaatacg    171600
     cttctttctt aggagcgggt gtatatgacc actatcagcc tgtcattgtg gatcatgtca    171660
     tttcgcgctc tgagttttat accgcatata cgccttatca gccagagatt tcacaaggag    171720
     agctccaggc tatttttgaa ttccaaacga tgatctgtga actgacaggc atggatatcg    171780
     ccaactcctc gatgtatgac ggcggaacag ccttggcaga agcagcaatg cttgcttcag    171840
     gccacacgaa aaagaaaaaa attgttgtgt caaaaaccgt gcatcctgaa tcgcgagagg    171900
     tgctgaaaac ttacgcaaaa ggtcagtata ttgatgttgt tgaagtaccc gctgcggatg    171960
     gcgttacgga tcttgatgca ttgcgccaaa ccgtttgcga gaacacagcc gcagtgatcg    172020
     ttcagtaccc gaattttttc ggcaggatcg agccgctaaa ggatattgag cctatcgctc    172080
     atcaagggaa atccatgttt attgtttcag ccaacccgct ggcgctaggt cttctcactc    172140
     cgccgggcaa gtttcagtct gatatcgtcg tcggtgatgc gcaccgtttc ggcattcctt    172200
     cagcatacgg cggcccgcat tgcggctttt ttgccgttac taaaaaatta atgagaaagg    172260
     tgccgggccg tctcgtcgga caaacggaag acgaaaacgg aaaaagaggc tttgtgctta    172320
     ccctgcaagc cagggagcag catatccgcc gggataaagc aacatcaaat atatgctcga    172380
     accaagcttt aaatgcgctg gcagcatcag tggccatgac tgctctcgga aaaaacggcg    172440
     taaaagatat agcccgccaa aatctcttaa aagccaacta tgcaaagcaa gaagcaaaaa    172500
     aagcaggcct tactgttatg tttgacgggc cgatgtttaa tgaatttgtc atcaaactgg    172560
     atgagccggt gagagctgtg aacaagcgtt tgctggcaaa aggcatgatt ggcggatatg    172620
     atcttgggtt gacgtatcca gagctggact gccatatgct gattgctgta acagagctga    172680
     gaacaaaaga agaaattgac gcactcattc aggaattggg ggatcgccat gagtaatcag    172740
     gaccaggcac ttatttttga actttcaaga gaaggccgaa tcggctatag tctgccggag    172800
     ctcgatgtac cggaaatcga attgggggac ctcttgtcag acacctatat tcgtgacgaa    172860
     gacgcagcgc tgccggaggt ttcagagctg gacatcatgc gccattatac agcgctgtcc    172920
     aaacgcaatc acggggtgga ttccggtttt tatcctctcg gttcttgcac gatgaaatat    172980
     aatccgaaaa tcaatgaaaa aatcgcacgt attcctggtt ttgctgcgat tcatcctctt    173040
     caggatgaag acacggtgca aggcgcatta gagcttttat atgatttaag caaacacctt    173100
     gaagaaataa cgggaatgga tgaggttacg cttcagcctg ctgccggagc gcacggcgaa    173160
     tggacggggc tgatgatgat ccgtgcctat catgaagctc gcggggattt caagcggacg    173220
     aaggtcattg tccctgattc cgcgcatggg acgaatcctg catcagcaac agtagcaggc    173280
     tttgaaaccg ttacggtgaa atcgaatgaa aaagggcttg ttgatttaga ggatttaaaa    173340
     agagcagtga atgaagaaac tgcagctctt atgctgacga atccgaacac gctcggcttg    173400
     tttgaggagc agattacaga gatggcggaa attgtacacc aagcgggggg gaaactgtat    173460
     tatgacggcg ctaatttaaa tgccgtttta agcaaggcga gacctggtga tatgggattt    173520
     gacgtggtgc acctcaacct gcataaaaca ttcacaggcc ctcatggcgg cggaggcccc    173580
     ggctcaggcc ctgtcggcgt aaaacaagat ctgattcctt atttgccaaa gccagtttta    173640
     gtcaaaaaag aagggcgctt tacgtttgat tatgaccgcc ctcatgcgat cggccgtgtg    173700
     aagccgtatt acggcaactt tggcattaat gtgagagcgt atacgtatat tcgctccatg    173760
     gggcctgacg gattaaaggc tgttactgag aacgcagtgt taaacgccaa ttatatgatg    173820
     agaaaactcg cgccttatta cgatcttccg tttgaccgcc attgcaagca tgaatttgta    173880
     ttatcaggga agcggcagaa aaagctggga gtgcgtacgc ttgatattgc aaaacggctc    173940
     cttgatttcg gctatcatcc gccgacgatt tatttcccgc ttaatgttga agaatgcatc    174000
     atgatcgagc cgacagagac cgaatcaaag gaaacactgg acgcgtttat tgatgctatg    174060
     attcaaatcg caaaagaagc ggaggagaat ccggagcttg ttcaggaggc cccgcataca    174120
     acgattgtaa aaagaatgga tgaaacaaaa gcggcgagac acccagtgct cagatacgag    174180
     gcggaagaaa gataaataaa aacagctgtc taccagacag ctgtttgctt tatttcttcg    174240
     ctttaatctt tccgccccat tttttaaagc cgccttttag gttgtaaatc tcagtgcagc    174300
     cgtttttgcg cagggtttgt gccgcgcgtc cgctgcggac actgttttgg cagtacaggt    174360
     aaacaggctt gtccgtacgg atctcatttt ttctctgttt cagctgggaa agcgggatgt    174420
     tgcgggcgcc taaaatatgt ccgccctcaa actcatttgg ctcacgaaca tcaataagct    174480
     gcgctttgcg gtaacccgcg cggaattctt cttcggtaag tgttttcata attcgctgct    174540
     gatagacata tgaagcaatc atatagatga taaatgcagg aaaaataatc aaaacgatca    174600
     tattagacaa tgtgattcta ctcctttagc atataaaatc aaaaccctgc ttcataaaac    174660
     aaggtcatag agccgttttc gacaaatact attatagtaa agcacagcgt gattgtcatc    174720
     tataatggaa ctaaaatatt ttccattttc ccgacagttt gataaactga ttctattaaa    174780
     acggtaagga aggtcttaaa atgcaaaaag aaacttggcg gtttatagac tcaggcaatg    174840
     caagtcctgc attcaatatg gcgcttgatg aagcgctttt atattggcac agcgaaaaga    174900
     aaatcccccc ggttatccgt ttttacggct ggaatccggc gacactttct gtagggtatt    174960
     ttcaaaatat taaaaaggaa atcaattttg aagcagtaca taaatataat ctcggattcg    175020
     tcagacgccc gaccggcggg agaggtgtgc tgcacgatca ggaactgaca tacagcgtaa    175080
     ttgtttcgga agagcacccc gagatgccgg cgactgttac tgaggcttac cgggttattt    175140
     cagaaggcat acttcaaggc tttagaaatc tcggtctgga cgcttacttt gccatcccga    175200
     gaactgaaaa agaaaaagaa agcttaaaaa atccgcggtc atctgtttgt tttgacgcgc    175260
     cttcgtggta tgaactagtg gttgaggggc gcaaggtggc gggaagcgcg caaacgagac    175320
     aaaaaggtgt gattcttcag catggctcca ttcttcttga tttagatgag gacaagctgt    175380
     tcgatctgtt cttatatcca agtgaaagag taagagagcg gatgcagcgc aatttcaaaa    175440
     ataaagcggt tgccattaat gaactcatcg aaaagcgggt gacgatggat gaggctcgta    175500
     aagcctttaa agaaggattt gaaacaggtc ttaacattca tttggagcca tatgaacttt    175560
     ctcaggaaga gcttgatttt gttcatcact tggctgaaac aaagtacgct tcagatgaat    175620
     ggaattataa gcggtaaaca gggcttttga cccgcggagc atccttgttt tttcaagttc    175680
     attagtgtaa acttgtaatg gtttataaag ttaaggtgct ttttgggagg gtttcgatga    175740
     caacaccaag tatggaagat tatattgaac agatttatat gctgattgaa gaaaaaggat    175800
     atgcacgagt ttccgatatc gcggaagcat tggcagtcca tccctcctct gtaacaaaaa    175860
     tggttcaaaa actagataaa gacgaatatt taatttatga aaaatatcgc ggtctcgtgt    175920
     taacgtctaa agggaaaaaa ataggcaaac ggctggtata cagacatgaa ttgcttgacc    175980
     agtttttaag aatcattggt gttgatgaag agaaaatata taacgatgtc gaaggaatcg    176040
     aacatcattt aagctggaac agtattgatc gcatcgggga tcttgttcaa tattttgaag    176100
     aagatgatgc ccgtaaaaaa gatctgaaat caatccaaaa gaaaacagaa catcataatc    176160
     agtaaaaagg cggtctcgaa ggaggccgtc ttttttaata cgctgacgcc acccgtcatt    176220
     cgttggtcta tttcttcgcg tgttttctta aaatggtaat aaacgatcgg atggaggggg    176280
     agggaatgag atgtatattg acggtgtgtt ttccggcgga ggagtaaaag gcattgcgct    176340
     cgcaggcgct tatgaagtgc ttgaggaaaa aggcttccgc tttaaaagag ttgcgggtac    176400
     aagcgccggc gccattattg ccgctttcat tgcgtcaggt tacaccagta aggaaatcca    176460
     cgctttaatt gaagaagtgg acggagagaa attgctggat cagaggtact catttctccc    176520
     cttaaagatg ctccagtggg tgtccatcta ctggcgtctt ggcttataca aaggcgatac    176580
     gatagaaaaa tggattgctg atctgttaag agcgaaaggc ataagggttt tcggcgattt    176640
     gcagaaaggg tctctgcgcc ttattgcttc tgatctgaca aacggcacca tgattgtttt    176700
     gccggacgat ttggcccgtt acgggttaaa tccagatatg ttcccggttg ccagagcggt    176760
     cagaatgagc tgcagcattc cgtatttctt tgaaccgata aaattaaaaa cggacacagg    176820
     caccgccacg gttgtcgacg gaggcgtgtt aagcaatttt ccaatctggc tgttttcaaa    176880
     ggaaagaaag cgccctgtga tcggtgtcac gcttgcgccg cgtgaaagag agcgtccgaa    176940
     aaaaaatatc cgcaacgctt ttgaactgtt cggcgccctg tttgaaacga tgaaggatgc    177000
     tcatgacgca aggcacattg cgtcacgcta tgaacaaaat atcatttttc tccctgttga    177060
     tgacgtaatg gccactgatt ttcatttaac acaacaaaaa aaactagccc tgattgagct    177120
     aggtaaaaga cggacagagc tgtttttaaa gcagtggacc tattaaaaaa gcgctctgtt    177180
     tttcttttta ttttttttcc cttctataac agtcagctga gtctggcttt ttttcttgag    177240
     aatcatcggc ttaggcttgc tggcgctcgg aacgcttcgc aggtggctga cacgtccctt    177300
     atgtccggcg cggtgttttg ctttttgttc tttcatccgg cgccgtgatt gtttcgccgc    177360
     ttttttgaag gctgctcctt cgctgcccgc atttcgattc attacatatt tcacaataaa    177420
     ataaataatg atacctgcca cgatgacggt taccgccatt tttgccattt ctccgggatt    177480
     ggttaccagc acatagagga aaccgaacgc tcccagcgca attaatacag caataatagg    177540
     ttgtacacga tgattcataa ctgtccacct ccgaaagtaa tagcagggca acggatttta    177600
     gatgacgttg tgagaaggct tctgattttg ctcagacaat gcttcgagtc tgagaagttc    177660
     gttaaagctt tcgatggcaa cttcaacctg ttcatcctta ggttcctttg tggttaacag    177720
     ctgaagccaa agtcccgggt acccaagtaa tttcagaccg cgaatgtcac gcactttgtt    177780
     tgtcagctgc agaacttcaa aggatatacc aagcacgacc ggtatcagtg cgacacgatc    177840
     tataacacgc agccaaagcg gatctgtcgg aacgagtaaa taaacaaaca tgccgacaat    177900
     aatcgtaaat aaaataaagc ttgatccgca gcggtaatga agccgagatt ggttttggac    177960
     attctccaca gtaattggca aattctgttc ataacagttt atgactttat gttcggctcc    178020
     atgatattga aacactcttt taataagcgg tgtcatggac aaaaaataga tgtaaccgag    178080
     cagcaaaatc aacttaaaca ggctttcaat cgcgatttgc gctgtgttca aggaaaaaat    178140
     cggccttgtc agttccgcta agaaaactgg aaccaatgta aatacgaatt tactgaacaa    178200
     aaatgatagg acgcctataa ctgcgaggct gagatacata gacagcccag aggatttttt    178260
     ttcttcctgc tcaagtgtct cgtcttcaga tggatcgagc ccgtaacgtt cgcttgaaaa    178320
     attcaaatgc tttgtgccgt ttgcactcgc ttcgataatg gccgcgatcc cccgtaaaaa    178380
     cggtatcttt ttcacgatgt tcagtttcgg gttgtgtttg cgtggaagct taaaaaagtc    178440
     aatgcttcca tccgttcttc tgatggctgt aacgtaatga tgctttccgc caaacataac    178500
     gccttccaca acagcctgcc cgccgtaagc gggcggaact ttatgttttg acatattatc    178560
     aacctgccta tttctttagg attgctaacc atttcctttc actctattgt acaggaaaca    178620
     ccgctaaacc tctagattga caggctgaaa aaattgccat agccttgctt ttcctacatg    178680
     cattataccc gttattttca aattttactc gcagctgcca aaaagtgtga gcttttttat    178740
     tgacatttca ttttttgggc acactttaac tggaggtgcc atgatgacaa gcgaaaaaga    178800
     tacagaacaa aatgaagaat tgaatgagaa gcaaaagccg cctgtttcaa tggccggcag    178860
     ggtggcggca acaggttttt gcggaggcgt actttggagt ttcgttgctt atatcgcata    178920
     tttgtttcat ttttccgaaa tcagcccgaa tatgatattg cagccgtttg tactcggaga    178980
     gtggaaaaaa catgggctgg gaacggtaat cagcatcatt ttgattggag taatttcaat    179040
     tggcgcagca tttctttatt ttcttctatt gaaacgttta aaaacaatgt ggccgggtat    179100
     tttatacggc ttggtgcttt ggctgctcgt gttttttgtt tttaatccga tttttccaga    179160
     tgtgcgcacg gtgaccgaac tgacatcaga tacaattatt acgaccattt gcatttattt    179220
     gctttacggg ctgtttgtcg ggtattctat ttcatttgaa tacaatgagc tgaattcgga    179280
     aaagcttgca cgtgcgctgg gaatgcatag agaatagtgt ataatccttt tccagtatga    179340
     taaaatgttc acgagaagtg aacatttttt acatgagaaa ccctcgcgaa aaggagagat    179400
     tgtgtgcctc attttttgat tttgaacgga ccgaatgtta accggcttgg gagtcgtgag    179460
     cctgaagtat tcggccgcca gacactgacc gatattgaaa cagatctttt tcagtttgct    179520
     gaagccttac atatccagct cactttcttc cagtctaatc acgaaggtga tttgatagat    179580
     gcgatacatg aggctgagga gcaatacagc gggattgtcc tgaaccccgg cgccctgagt    179640
     cattacagct atgcgatcag ggatgctgtt tcaagcatca gtcttcctgt ggtagaggtg    179700
     catttatcaa acttatacgc cagggaagaa ttcaggcatc agtcggttat cgctcctgtt    179760
     gcgaaagggc agattgtcgg tcttggagct gaaggctaca agcttgctgt tcgctactta    179820
     ttaagccagc aagggggaga atcaagatga agctagagaa attaagaaac ctgtttggac    179880
     agctgggaat tgacggcatg ctgattacaa gcaacactaa tgtacgctat atgacagggt    179940
     ttacaggttc ggcgggtttg gctgttatat cgggtgacaa agcagcgttt attacggatt    180000
     ttcgttatac tgagcaggcg aaggttcagg taaagggttt tgagatcatt gaacatggcg    180060
     gcagcttgat tcagaccact gccgacactg ttgaatcgtt tggcatcaag cgtctcggct    180120
     ttgaacagaa cagcatgaca tatggcactt acgcttcata cagcgccgtt atcagtgatg    180180
     ccgaattagt gcctgtggct gaatccgtgg aaaagttgcg cttgattaag tctagtgaag    180240
     agattaagat attagaggaa gctgcgaaga ttgcagatga tgccttcaga catatcttga    180300
     cgtttatgaa acccggcatt tctgaaatcg ctgttgccaa tgagctggag ttttatatga    180360
     gaagccaggg agcagacagc tcttcttttg atatgattgt cgcctcaggc cttcgttcaa    180420
     gccttccgca cggtgtggcc agtgacaaac tgattgaaag cggagacctt gttacgcttg    180480
     attttggcgc ttattataaa ggatattgtt ctgatattac ccggacggtc gctgtaggtc    180540
     agcccagtga tcaattgaag gagatctatc aggttgtatt tgatgctcag gcgcttggcg    180600
     tcgcacatat taagccggga atgacaggaa aagaggctga cgccctcaca agggatcata    180660
     ttgctgcaaa aggctacggt gactatttcg gccattcaac cgggcacggg ctcggcatgg    180720
     aagttcatga atcgccggga ttatccgtca gatcttcagc tatccttgaa ccgggtatgg    180780
     tggtcacagt ggagccgggc atttacatac cagaaacagg cggtgtccgc attgaagatg    180840
     acatcgtgat tacagaaaac ggcaaccgga caatcaccca ttccccaaaa gaacttatta    180900
     ttttgtgatt ggaatatagg aggacattaa acatgatttc agttaacgat ttccgtacag    180960
     gattaacaat tgatgtagat ggcggcattt ggcgcgtcgt tgacttccag cacgtaaaac    181020
     ctggaaaagg tgcggcattt gtccgctcta aactccgcaa ccttcgcact ggcgcgattc    181080
     aggaaaaaac attccgcgct ggtgaaaaag tagcgaaagc gcaaatcgaa accaaaacaa    181140
     tgcaatatct atatgcaaac ggagatcagc acgtatttat ggatacttct tcttatgagc    181200
     agcttgaact gagcgcaact caaatcgaag aagaattaaa atacctgcta gaaaacatgt    181260
     ctgtgcatat catgatgtac caggatgaaa cacttggtat cgaacttcca aacacagttg    181320
     agctgaaagt tgttgaaact gaacctggta ttaaaggtga tacagcgtca ggcggtacaa    181380
     aacctgcgaa aactgaaacc gggcttgttg taaacgtgcc gttctttgtg aatgaaggcg    181440
     acacacttgt tgtcaataca tcagacggtt cttacgtttc aagagcatag aaaggaaaaa    181500
     agaagtctgt tcccaaatgg gagcaggctt tttttgtgcc caaaaacaga atctttcttt    181560
     tatacggaaa tgacaagact acttcagcaa gctagagcat atcatataaa aaaatgggag    181620
     gttgggagag tgctatgaaa tttttacttg gaaatatcaa ttctactgtt ttaacaatgg    181680
     cgggattacg agttttatcc tctatgattg agctgacggc agcaattgtc atgcttgtga    181740
     ccaacgatgt ccggaaggcg gttgtggtta acagcattct cgctattgtc ggtccgttga    181800
     tttttatcat tacaatgact gtcggaatct accaaattgc cgggcagctt tcgtatgcaa    181860
     agctgattct gatttttacg ggtgttgtct tgattttggc gggtgttcat aaataaagag    181920
     aggcttgtca taaagtctgc ctcacatcat acattttaaa gaagccaatc ggtagaaagg    181980
     aggaggctct gttgaatgaa atcgctgagg ttctccctga atccatgaaa aacgcccttt    182040
     ctgaaatacc ggaacaacaa tggctggaaa tcgaagaagt cagaattcgg atcaaccgcc    182100
     ctgttgaatt gattcgaaga ggacaacctg tttatttgtc ctatgcgggc acggccgagg    182160
     atgcccatct gatcctgagc cggctcagca actatagtat gtatacactt gaagaagagc    182220
     tgaagaaagg gtatgtcacg atcagaggcg gccacagagt cggactggcg ggcagagtca    182280
     ttacggaaaa cggaggtgtg aaaggcctcc gtgacatcgc atcttttaat atacgaattg    182340
     cccggcaaaa gctggggatt gcggagccgc tgcttccata cttatatcaa aacagctggc    182400
     tgaatacgct gattatcgga ccgccccaaa ccggcaaaac aacacttctc cgggaccttg    182460
     cgaggctctc aagcaccggc aaaaaaaaca tgctgcccgt aaagacaggg atcgtcgatg    182520
     aacggtcaga gattgccgga tgtcttcgcg gtattccgca gcatcaattt ggtcagagaa    182580
     ttgacgtgtt agacgcctgt ccaaaagctg aagggctgat gatgatgatt cgatccatga    182640
     gccctgaggt gatgattgtc gatgaaatcg ggcgtatgga agatacagat gcacttctgg    182700
     aggcgctgca tgccggtgtt tcagtaatcg tatcggcgca tggctggagt atatccgacc    182760
     tgatgaagcg gccttcattg aagcgtttgt gggaagaaag agcctttgac cgctatttgg    182820
     aattatcaag agcaaaaggg ccgggcacag tgagccaaat ttatgacaaa gacggaaatg    182880
     tgctgtctag gacgacgggc gtgaaaacat gctgaagctg ctgggcgctg tattcattgt    182940
     ggtagcgaca acatggacag gttttgagat ggcgaagatt tatacagaac ggccgcggca    183000
     aatccgccag ctgcgtgcgg cgcttcaatc cctcgaggct gaaatcatgt acggccatac    183060
     accgcttcat actgcttcac agcagattgc caaacagctc gcacagcctg tttcaactct    183120
     tttttccgca ttcagtgatc agctggacaa gggaagtgat tccgcgaaaa cggcgtggga    183180
     gcaaagctta aagaaggtat gggacaccct gtctttgaaa aaaagcgaat acgaagtgct    183240
     gaagcagttt ggcgagacgc ttgggattca tgatcgaatc tctcagcaaa agcacatcaa    183300
     gctggcgctg acacatttgg aagcctcaga agcggatgct gagcaggcgc aagcgaaaaa    183360
     cgaaaagatg ataaaaagtt tgggcttttt agcgggcttg ttactcattc ttctattgat    183420
     gtaaacgtga ggggagcaaa aataaaatgg gagtagacgt gaatgtcata tttcaaatcg    183480
     ccggagtggg aatcgtggtc gcttttttac acacgatatt ggatcagatg ggcaagaaag    183540
     aatatgctca gtgggtgacg ctgttaggtt ttatctatat tttatttatg gtcgccacga    183600
     ttgtagatga cctatttaaa aagataaaag ctgtgttttt attccaagga taggggggct    183660
     tgcagattga cattgttcaa attgtaggtt tagggctgat cgccaccttc ctttctttaa    183720
     ttgtaaaaga acaaaagccg acttttgcgt ttttaatcgt cgtttttgcc ggatgtgcca    183780
     tttttcttta tttggtagac caaatctacg acattattcg aatgatagaa aaaattgcga    183840
     ttaatgcaaa tgtcaacatg gtctatgttg aaaccatttt aaagattatc ggaatcgcct    183900
     atattgctga attcggggca cagctcacaa aagatgccgg tcaaggagcc atcgcctcga    183960
     aaatagaatt ggcggggaaa attttaatac tcgtaatggc tgtgcctatt ttaaccgtca    184020
     ttatcgaaac gattctcgga cttatacctt ctatgtcata accgaaagga ggcggtagat    184080
     tgaagcgctt tcaatgggtt ttgcttttgg ccgtgctgat catagcaggc cgtgcagaaa    184140
     ttgtacaagc agctggtaat gcaggacaaa cggaagacca tgctgaaaca gccgagcaat    184200
     tagcggaaag gacagcagcc tcgcttgaaa cagataagat cggggaattt tggaatgaca    184260
     ttatgacaga atacggcgga ctgctgccgg aaagccaaaa aggcagctta atggagttta    184320
     tcaatggcga taaatcattc tcaccgcaag aatggctgaa agctctcttt tcttatttgt    184380
     ttcatgaagt gcttgccaac ggaaagctgc tgggcacatt gattttgctc acgatttttt    184440
     gcgtcattct gcagcttttg caaaatgctt ttcagcaaag caccgtcagt aaggtcgctt    184500
     actcaattgt gtacatggtg ctgattatcc ttgcgcttaa tagctttcat gtggcaatta    184560
     actatgcaac tgaggcgatt cagacgatga ccagctttat cctggcgctc attccgctcc    184620
     tcttggcgct tttggcttcc tcaggcggag ctgtatctgc tgccttcttt catcctgtta    184680
     tcctcttcct gatgaacacg agcggtctct tgattcagaa tatcgtcatg ccgctgattt    184740
     ttttatcagc gattctgagc attgtcagca cgatgactga acaatacaaa gtaacgcagc    184800
     tggctaacct gctcagaaat atcgccatcg gagcactggc tgtttttctt accatctttc    184860
     tcggcgtcat ctctgttcag ggagcgtcag ctgcagtgac agacggcatt acgctcagga    184920
     cggctaaatt tataaccgga aattttattc ctgtgcttgg ccgaatgttt acagacgcaa    184980
     cagatacagt aatcagcgcc tctttactgc tgaaaaatac ggtagggatt ctcggtgtcg    185040
     ctattttgat ctgtattgcg gcatttccgg caatcaaagt gctttccctc gcttttattt    185100
     ataagctggc agccgcgatt cttcagccgc taggaggcgg gcccgtcatc acctgcctcg    185160
     acgtcatcag caaaagcggt catttatatt tttgcagctc tcgccattgt gtctctcatg    185220
     ttttttttaa gccttactgt cataatcaca gccggaaacc tcacgatgat gatgaaatga    185280
     aggaggcagg caaatgagtt ttttaacgga atggcttacc accatcgtgt tgtttatcct    185340
     atttgcaatt gtgattgata tgctgctgcc gagctccagc atgcaaaagt acgcaaaaat    185400
     ggtagtcagc ctgctcttga ttgtcgtcat gcttacgccg atttttaaac ttttcaagac    185460
     agaccccgaa gtcatctttg aatacctcac aaaaaacggg cagtcagagt ctgccgacat    185520
     aaaaaatcaa atcaattcaa aaaaaataga aatacaagct tcccagcgcg catatattct    185580
     agaagaaatg gctgtccaac taaaaaagaa agcggaggag agattcagtc atgatgaata    185640
     taaagtaggc cgcatcaaac tcacggcagg agaaaaggta gattcagaag aggatattaa    185700
     aacaatcagc gtgtatatgg ccccgtcttc tgaaaaaacg gtccaaacgg tcgcgccggt    185760
     ccacattgat acagatcatg catacgtaac aaaagaagca gccgaacaaa aagaagccaa    185820
     acagatacaa acgcagctcg cggacatttg ggaaatcgga agtgagaaaa ttacggttca    185880
     tatggaaggc ggggagagtg tcggcaatga ataaaaacgg attatggaat gtattgaaaa    185940
     agcagtctct tccgggacaa acgaaggacg gcgaaaagcc gaagctgacc aaatatcatt    186000
     actttctatt cgtttttgtt ctcggagttt cctttatgct tgtcagccag ctgttttctt    186060
     cacctgagaa aactgaaaac gccaaaacga taacggccgt atcatcacaa cattccgcag    186120
     acagcaaaga gaaaacagcc gaagtgttta aagcctcaaa atctgataaa cctaaagact    186180
     cgatcgatga ctatgaaaaa gaatacgaaa atcaactgaa agaaattctt gaaacaatca    186240
     ttggtgtgga cgatgtctcg gttgtcgtga atgtagatgc aacgtcgctg aaagtatacg    186300
     aaaaaaacaa atcaaacaaa aatacaacca ctgaagaaac tgacaaagaa ggcggaaaaa    186360
     gaagcgttac agaccaatca tcggaggaag aaatcgtcat gatcaaaaac ggcgataaag    186420
     aaacacctgt cgtcgtccaa acgaaaaaac ctgatatacg cggtgtactc gttgttgctc    186480
     aaggagtgga caacgttcaa ataaaacaaa ccattatcga agcggtgaca cgggtcctgg    186540
     atgttccaag ccaccgggtt gcggttgccc ctaaaaaaat aaaggaggat tcataaatgc    186600
     ttaaaaaaca aaccgtttgg ctattaacaa tgctcagtct tgtcgtggtg ttaagcgtct    186660
     actatatcat gtcgccggaa agcaaaaacg ccgtgcagat gcaaagtgaa aaaagcgcgt    186720
     ctgacagcgg agaggtcgca actgaaaaag cgcctgccaa gcaagacacg aaggaaaaaa    186780
     gcggtacaga aactgaaaaa ggaaaagaag atggaacaaa gggaacgaaa gattcatcag    186840
     cagacaagga aacatccgct gaagccagtg aaaaaggaac tgttgttacg gaaacagccg    186900
     atgatgattt gtttacaacg taccgtcttg atttagaaga tgccagaagc aaagaaagag    186960
     aagagctgaa tgccattgtg tcaagcgatg atgcaacagc caaggagaaa agcgaagcat    187020
     acgataaaat gacggctctc agtgaagtgg aaggaacagg aaaacagctg gaaacgctga    187080
     ttaaaacaca aggttacgag gatgcgcttg ttaatgctga aggagataaa atcaatatta    187140
     cagtcaaatc agacaaacac tctaaatcga aggcgacagc cattatagac cttgtggcaa    187200
     aagaaatcaa aacaatgaaa gatgtcgctg tcacatttga accctctaaa taagaatgag    187260
     ggaaaaaagc ccgctaaaca agcgggcttt ttgcgttgct gtcatattag agttgaattc    187320
     acaagtccgc tcctgtaaga tgaacatagt atgtactttt agtagtaacc tataaaaaaa    187380
     gaaatttcat acataggagt gcgattgtat gttaaatatc aaagaaatcc acgagctgat    187440
     taaagcaatt gacgagtcta caattgacga attcgtatat gaaaatgaag gtgtatcctt    187500
     aaaactgaaa aaacacgaag caggcacggt tcaagtcatg cagcaggcac cggcagcacc    187560
     tgtacaagca caggctccgc aggcagttca gccgcaagcg cagcaagcag cggcacctgc    187620
     ccaagaagca ccaaagcaag atgagaatct gcataaaatc acttcaccaa tggtaggaac    187680
     attttatgct tcttcatcac cggaagctgg cccgtatgta acagccggtt caaaagtaaa    187740
     tgaaaacaca gttgtctgca ttgtagaagc gatgaagctt ttcaacgaaa tcgaagcaga    187800
     agtgaaaggc gaaatcgttg aagtattagt agaaaacggc cagctggtcg aatacggaca    187860
     acctctattt cttgtaaaag cggagtaagg agactgaaca tgattaaaaa gctattgatc    187920
     gccaacagag gagaaattgc tgtcagaatc atcagagcct gcagagagct cggaattgag    187980
     actgtcgctg tttattcaga agctgataaa gatgcccttc atgttcaaat ggccgatgaa    188040
     gctttttgta tcggaccgaa agcatcaaaa gacagctatt taaacgttac aaatattgtg    188100
     agtgttgcaa agctgactgg cacggacgcc attcatccgg gatacggatt tttagctgaa    188160
     aatgctgatt tcgctgaatt atgtgaagaa gtgaatgtca cgtttgtcgg cccgagccct    188220
     gacgccattt caaaaatggg aacaaaagac gttgcgcggg aaacgatgaa acaggccggc    188280
     gtgccaatcg taccgggttc acagggaatt atagaaaatg tggaagaagc ggtttcgctt    188340
     gctaatgaaa ttgggtatcc tgtaattata aaagccaccg caggcggagg cggaaaagga    188400
     attagggttg cccgcactga agaggaactg attaatggca ttaagattac acagcaggaa    188460
     gcggcaactg catttcggaa tccaggtgta tacatcgaaa aatacataga agattttcgc    188520
     cacgttgaga tccaagtgct tgctgataac tacggaaata cgatccattt gggcgaacgc    188580
     gactgctcga tccaaagacg cctgcaaaag cttttggaag aatcaccatc tcctgccctt    188640
     gattcagaaa tcagggagca aatgggagat gcagcggtaa aggctgccaa agcggttggc    188700
     tatacaggtg ctggaacagt tgaatttatc tatgactaca atgaacagcg ctattacttc    188760
     atggaaatga acacgagaat ccaggtggag cacccagtca cagaaatggt gacgggaact    188820
     gacctgatca aggaacaaat caaagtggct tcaggaatgg aactgagcct caagcaagaa    188880
     gatgttgaat ttgaaggctg ggccatcgaa tgccgaatca acgcagaaaa cccaagcaaa    188940
     aatttcatgc cgtcacctgg tgaaattaaa atgtacctgc ctcctggcgg tcttggtgtc    189000
     cgtgtcgatt cagctgcgta ccctggctat tccatcccac cgtactatga cagcatgatt    189060
     gcaaaggtaa tcacatacgg aaaaacgaga gatgaagcga ttgcccgcat gaagcgcgca    189120
     ttgagcgaat tcgtcatcga aggcattgag acaacaatcc ctttccattt aaaactgctt    189180
     gaacacgaaa catttgtgag cggagagttt aataccaaat ttttagaaac atatgatgta    189240
     atgggctcat aatttttacg gaggtgaatt gaatgaaaga caacagcttg cttaaaatgg    189300
     atcacgaaga tacgcatttg ggtaaggttg agattgcacc ggaggtcatt gaggtcattg    189360
     ccggcattgc agcatcagaa gttgatggag ttcccgaaat gcgcggaaac tttccgacag    189420
     gcgtcgttga gcgctttggc aaagtgaatc atggcaaagg tgtcaaagtc gacctggcgg    189480
     atgacggaat tacgatcgat gtatactgtg tcgttacatt tggcgtttcg attccgaaag    189540
     ttgcagcatc cgttcaggaa aacattcgtc aaaccttatt aaatatgacg tctctttcga    189600
     ttaacgagat caatattcac atcgtcggca ttcaatttga cacaaaagcc caagaagtcc    189660
     aaatcgacga agaaatgtaa atggcttaac acgaaaccaa ggggagggcg gccctttggt    189720
     ttttttacac gttacccttt atttcaaagc atgaagaaag ccggcttaca tagccgagtt    189780
     tcttcatgaa cgtgaaatcc gaataatcat attaaggtgt gtgaaaatat tcggtaatag    189840
     ggtaaaaaaa ccttgatttc aatatgcgga tacgaaaaaa atatgttatg atctctttgt    189900
     ggcttaacga caagcggata aagaggatca aaggagaaag aaaatgaaaa gaagaacagc    189960
     aagagaaaaa gctttgcagg cactatttca aattgatgtc agcgatattg cagtgaatga    190020
     agccatagaa cacgcactgg atgaagaaaa aacagatcct ttctttgaac agcttgtaca    190080
     cggggtattg gaacaccaag accagctgga tgaaatgatc tccaagcatc tggtgaattg    190140
     gaagctcgat cggattgcca atgttgaccg tgcgattttg cgcctggcag catatgaaat    190200
     ggcatatgcc gaagacattc cggtgaatgt ctccatgaac gaagcgattg agctggcaaa    190260
     acggtttggt gatgacaaag cgacaaagtt tgtaaacggg gttctttcta acattaaatc    190320
     tgatattgga caatcatagg aggaaagaaa atgactgcaa caatcatcga cggaaaagaa    190380
     acggctagag aaaaacgcga acaattggca aaagaggtag aagagcttaa aaagcaaggc    190440
     gtcactcccg gactggcggt tattttgatt ggagatgatc ctgcttctca ctcttacgtg    190500
     cgaggaaaga aaaaagcggc agaaacaatg ggaatgaatt tcaagctcga tcaatttgac    190560
     agcagcctca cagaagctga actgctttcc attattgatc aatataacca agaccctgag    190620
     tttcatggca ttctcgttca gcttccgctc ccagaccata tttctgaaaa agcggtgatc    190680
     gaacgtatct cccctgataa agatgtagac ggttttcatc cgttaaacgt agggaaaatg    190740
     ctgcttggcg aagatacgtt tcttccttgc acgcctcatg gaattgttga gcttttgaag    190800
     aaaaccaata ttgacctttc cggtaaagag gttgttgtag tcggccgaag caacattgtc    190860
     ggcaaacctg tcggccagct tttattaaat gaaaacgcga cggttactta ctgtcattca    190920
     agaacagaaa atattactga acatacgaaa aaagcggaca tcctggtggt ggcagtcggc    190980
     agagccaact tcatcagtgc agaccagatc aaagagggcg ctgttgtcat tgacgtcggc    191040
     gttaaccgtc tggaaaacgg aaagctttgc ggagacgttg aatttgaagg ggcaaaggaa    191100
     aaagcgtcct tcataacgcc ggttccgggc ggagtaggtc cgatgaccat cacgatgctt    191160
     gcgcataata ctgttaaatc tgcgaaacgt acgttatcat agataattgg agatattcac    191220
     aggcgaaatg tttacccgcc ttgaatatga gcacgatacc cgcttcttca ggctcctaaa    191280
     gccagggcgg gttttcttta gttatggtgc aggaatgctt aggagaggag tttttagaca    191340
     tgggtgaagc agcgtatgtg accgtctcag cgctgacaaa gtatataaaa cggaaattcg    191400
     atgtagatcc tcaccttgaa aatatttgga ttaaaggcga attgtcgaat gtaaagatac    191460
     acacacgagg gcatatttat ttcactttaa aagaacgaaa aggcagaatg cagtcggtga    191520
     tgttcgcgag acaaagcgag cgtctgcctt ttaaacctga aaacggaatg aaagtgctgg    191580
     tcagaggcgg aatttccgta tatgaaccga gcggaaacta tcaattatat gccaaagaaa    191640
     tgcagcctga cggggttgga gcgctttatt tagcgtacga agaattaaaa aagaagcttg    191700
     ccggagaagg tttatttgac gaccgctaca aaaaacaaat ccccgcattt ccagccacaa    191760
     tcggggttgt gacatctcca acgggtgccg ctgtcagaga cgttattaca actctaaaaa    191820
     gaagatatcc ccttgtaaaa gtcattgttc ttccagcgct cgtacaaggt gaaaatgcga    191880
     gcagatccat cgttacgcgc attgaagagg caaatgaaaa agagatttgc gacgtattaa    191940
     ttgtcgggag aggcggcggt tcgatagaag aactgtgggc attcaatgaa gaaattgtag    192000
     cacgcgccat ctttgcttcc aatattccga ttatatcggc agtcggacat gagacggatt    192060
     ttacgattag tgattttgtc gccgatatca gagctgcgac gccgacagga gcagctgaga    192120
     ttgctgtgcc tcataccact gatttaatcg aacggacaaa aacagcggaa gtcagaatga    192180
     caagagcaat gcagcagcat ctcggccagg aaaaaggacg gatacaaacg ctgcaatcgt    192240
     cctatgcctt tcgttttcca aagcgtttgt atgcgcaaaa agagcagcag tttgacctcg    192300
     cgtaccagca gtttcaagca cagctgaccg ctcttttaga tcggaaaagc agacagctgg    192360
     agcgtgaaac gtacagatta gaggcattgc atcctcatga acagctgaaa caagcgagaa    192420
     cacgatacca ggaacaaaca aatcagctga gaaaaaatat gaatatccaa atgaagcagc    192480
     tgcattccca atttcaaacc gttcttggca agctgaatgc actaagtcct cttcaagtga    192540
     tggaaagagg atacagcttg gcttataaag aagataaact cattaaaagt gtcagtcaaa    192600
     tagaagagca ggaccgcctt gaaatcaagc tgaaggatgg cgtgctgacc tgtgaagtat    192660
     tagaaaagag aggggaagaa aaatgacaga cgtgaaaaaa aatgaaacat gacatttgaa    192720
     gaagcgatga aagggcttga gagcattgta tcaaagcttg aagagggaga tgtgcctcta    192780
     gagcaagcca ttaactattt ccaagaaggc atggctctgt caaaaatgtg ccatgaaaag    192840
     ctgcaaaaag tcgaaaagca aatggacttc attttaaaag aagacggcga actggcacct    192900
     ttcagtgttc aggaggaaga cgaaggtgac aaataaatta acgagctttc tggcggaccg    192960
     gaaaaaaaca attgaaaatc agctttctgt ctatacagaa aagcttgata tgccggactc    193020
     attaaagaaa tctatgctat attctctaca ggccggcgga aagcggttgc ggcctctgat    193080
     tgtactggct gttttaaatg catatggaaa aagcgaaaaa gacggcattc cggtgggctg    193140
     tgctgtcgaa atgattcaca cgtattcgtt aattcatgat gatcttccat gcatggatga    193200
     tgacgatttg cgccgcggga agccgacaaa ccataaagtg tttggtgaag cgacggcagt    193260
     attagcgggt gacgggctgc tcacagaaag ctttaagctg attacctccc acgtgtcaga    193320
     cgaggtgtca gcagaaaagc gcctgcggct tgtgaatgaa ctgatttcag cggcaggcac    193380
     cgaaggcatg gtcggtgggc aagtagctga tatggaagcg ggaaaccgac aagtcacgct    193440
     tgaagagctc gaatccattc atgaacggaa aacttccaag ctccttggct tttgtgtaat    193500
     cgccggtgct attttggctg atgcgcctga ggaagacatt gaaacactgc gtaccttcag    193560
     cagccacatt ggaatcggat ttcaaatcag agacgatatt ttagatttag aaggcagtga    193620
     agagaaaatc ggcaaacgtg tcggctcgga taccacaaat gacaaatcga catacccgtc    193680
     gcttctttca ttggaagggg ccaaacataa attggatgtt catataaaag aggcgaacga    193740
     ttgatcggcg gactctctct tcaaaaagac cttttatatg agctttgtga tttaattgcg    193800
     gcaagagatc actaaaacga tcctaatttg aagcggctgc acgagggtat ggtaaaatgt    193860
     aagcagttta tatgaaaaat gaaaaggaaa agcgcgtttg tcttttttta tgtctgagat    193920
     tattgtcagc tcggcatgca aaagacatgt atcattgcag aaattcatgc tgaaagtgag    193980
     ttgatccgct ttggatcttt tatcaataca ggacccgtcg tttttaaaaa acatgtccat    194040
     tgatgaatta gagaaattaa gtgatgaaat ccgtcagttt ttaattacaa gtttatccgc    194100
     ttccggcggc cacatcggcc caaacttagg tgtcgtagag cttactgttg ccctgcataa    194160
     ggaatttaac agcccgaaag acaaattttt atgggatgta ggccatcagt cgtatgtcca    194220
     taagctgctg acaggacgcg gaaaagaatt tgcgacgctt cgccagtaca aagggctttg    194280
     cggatttcca aagcggagtg aaagcgagca cgatgtttgg gaaaccgggc acagctcgac    194340
     ttctctttca ggcgcgatgg gaatggcagc tgcccgtgat attaaaggaa cggatgaata    194400
     tattattccg atcattggtg acggcgcgct gaccggcggt atggcgctcg aagcccttaa    194460
     ccacatcggc gacgagaaaa aagacatgat tgtcatcctt aatgataatg aaatgagtat    194520
     tgcgccaaac gtcggtgcca ttcactctat gctcggacgg ctccgcactg cggggaaata    194580
     ccagtgggtc aaagatgagc ttgaatactt atttaaaaag attccggcag ttgggggcaa    194640
     gcttgccgcc acggcggaac gggtcaaaga cagcctgaaa tacatgctcg tctccggaat    194700
     gtttttcgag gagctcggtt ttacgtattt gggcccagtg gacggacatt cttatcatga    194760
     gctgattgag aatcttcaat acgccaaaaa aacgaaaggc cctgttcttc tgcacgtcat    194820
     tacgaaaaaa gggaaggggt acaaaccggc tgagaccgat acgattggga catggcatgg    194880
     taccggacca tataaaatta ataccggtga ctttgtaaag ccgaaagccg cagctccttc    194940
     gtggagcggt cttgtcagcg gaactgtgca gcgaatggcg cgcgaggacg gacgcattgt    195000
     agccattacg ccggctatgc ctgtcggttc aaagcttgaa ggcttcgcaa aggaattccc    195060
     tgaccggatg ttcgacgtag gaatcgcaga acagcatgcc gcaacaatgg ctgcagctat    195120
     ggcaatgcag ggtatgaagc cgtttttggc gatttactca accttcctgc aaagggcata    195180
     tgaccaagtt gttcatgaca tctgccgcca aaacgctaat gtgtttattg gaattgaccg    195240
     tgctggactc gttggcgctg atggagagac acatcaaggc gtgtttgata ttgcgtttat    195300
     gcgccacatt ccaaacatgg tcttaatgat gccgaaagac gaaaatgaag gccagcacat    195360
     ggttcataca gcacttagct atgacgaagg cccgatagca atgcgttttc cgcgcggaaa    195420
     cggactcggc gtaaaaatgg atgaacagtt gaaaacgatt ccgatcggta cgtgggaggt    195480
     gctgcgtcca gggaacgatg ctgtcatctt aacattcggc acaacaatcg aaatggcgat    195540
     tgaagcagcc gaagagctgc agaaagaagg cctttccgtg cgcgttgtga atgcgcgttt    195600
     tattaagccg attgatgaaa agatgatgaa gagtatccta aaagaaggct tgccaatttt    195660
     aacaattgaa gaagcggtct tagaaggcgg tttcggaagc tcgattttag aattcgctca    195720
     tgatcaaggt gaatatcata ctccgattga cagaatgggt atacctgatc ggtttattga    195780
     acacggaagt gtaacagcgc ttcttgagga aattggactg acaaaacagc aggtggcaaa    195840
     tcgtattaga ttactgatgc caccaaagac acacaaagga attggatcat gacgtcaaag    195900
     aaagaacgat tagatgtatt attagtggaa agagggctgg cggaaacgcg tgaaaaagcc    195960
     aaaagagcca ttatggcggg gatcgtctat tcaaacgaaa accgcttgga caagcctgga    196020
     gaaaaaattg accgcgacct tccgttaact gtcaaaggaa acccgctgag gtatgtgagc    196080
     aggggcggct taaagctcga aaaagcgttg aaggaatttc ccgtctctgt caaagataaa    196140
     attatgattg atattggctc ctccaccggc ggttttacgg actgcgcttt gcaaaatgga    196200
     gctaaacagt catacgctgt ggatgtaggc tataatcagc ttgcatggaa gcttagacag    196260
     gatgaacggg tcgtcgtgat ggaacggacg aactttcgtt atgcaacacc ggcagacttt    196320
     acaaagggca tgccggagtt tgccacaatt gatgtgtcct ttatttcact gcggctcatc    196380
     ctgcctgtcc taaggacttt gctcgtaccg ggcagcgact gcatggcttt agttaagcct    196440
     cagtttgaag cgggacggga atccgtcggc aaaaaaggga ttgttagaga tcctaaagtg    196500
     catgctgatg tgctcaagcg aatgatcagt ttttctgccg ctgaaggcta tatctgtaaa    196560
     ggcttgtcat tttctccaat cacgggagga gacggaaata ttgagtttct ccttcagttt    196620
     gcattggccg ggagagggac aggaaggcca ggaactgccg gaagaagaga tcatgcgcgt    196680
     tgtagaagaa gcacataaga cgttaaaaga aaaaaaagca gatgtaccgg aataataggg    196740
     cgctattatt ccttttttct gcattcatgt acaatgtgca gagaatcata taacataaaa    196800
     gaacagataa gcttggaaat agaggtgctt acatgaacaa aggccagagg catattaaaa    196860
     tcagagagat cattacaagc aatgaaatcg aaacgcagga tgaattggtc gacatgctaa    196920
     agcaggatgg atacaaagta acgcaggcca cggtatcacg ggatattaaa gaacttcacc    196980
     ttgtaaaagt gcctacaaat aatggttctt acaaatacag tcttccggcg gaccagcgtt    197040
     tcaatccgct gtcaaagcta aagcgggcat tgatggacgc atttgtgaaa atagactcag    197100
     caagccatat gattgtgctg aaaacgatgc cgggcaatgc ccaggcaatc ggggcgctga    197160
     tggacaattt ggactgggat gaaatgatgg ggaccatttg cggagatgat acgattttaa    197220
     ttatttgccg gactcctgaa gatacagaag gcgtaaaaaa caggctcctt gaactgctgt    197280
     aacagaaaat ctaacaaaga taagaggtgt aatgctgttt gttagctgaa ctatcgatta    197340
     aaaactttgc cattattgag gaactgacgg tttcttttga acgcgggctt acggttttaa    197400
     caggagaaac cggagccggc aaatccatca tcatagatgc catttctctt ttagtcggag    197460
     gccgcggatc atctgaattt gttagatatg gggaagcaaa agccgaactt gaagggctgt    197520
     ttctgttgga gagcggccat cctgttttag gcgtatgcgc tgagcaggga atcgacgttt    197580
     cagacgaaat gatcgtcatg agaagggata tcagcacgag cgggaaaagc gtttgccgtg    197640
     tcaatggcaa gcttgtcacg attgcttcac taagagagat cggcaggctt ttattagata    197700
     ttcacgggca gcacgataac cagctgttaa tggaagacga aaatcatctc cagcttttgg    197760
     acaagtttgc cggggccgaa gtggaaagcg cgctcaaaac gtatcaggaa gggtaccagc    197820
     ggtatgtgaa gctgctcaaa aagcttaagc agctttctga aagcgaacag gaaatggccc    197880
     attgtcttga tcttattcaa tttcagctcg aagaaatcga atcggcaaag cttgagctta    197940
     acgaagatga acagctccaa gaagagcgcc agcaaatttc aaactttgag aagatatatg    198000
     agtcgctgca aaatgcatat aacgcgcttc gcagtgagca gggcggattg gactgggttg    198060
     gaatggcatc agcgcagctt gaagatatat ctgatataaa cgaaccgctg aaaaaaatgt    198120
     ctgaaagtgt ttcgaactcc tactatttgc ttgaggatgc cacatttcag atgagaaata    198180
     tgctggatga gcttgaattt gatccggaac gcctgaacta tattgagacg cgacttaatg    198240
     aaatcaaaca gctgaaacga aaatacggtg ccactgttga agacattttg gaatatgctt    198300
     ctaaaattga agaagagatt gaccaaattg aaaacaggga cagccacctt caaagcttga    198360
     aaaaggagct tgactccgtc ggcaaagatg tcgcagtgga agcggcaaat gtgtcacaaa    198420
     tccgaaaaac atgggcgaaa aagctggctg atgagattca tcgggaatta aaaagcctgt    198480
     acatggaaaa atcaactttt gatacggaat ttaaggtcag aacagcgtca cgcaatgaag    198540
     aggcgccgct tgtaaacggc cagcccgttc agctgactga acaagggatt gacctggtga    198600
     agtttttaat ttcaaccaat acaggcgagc cgctgaaatc cctttcgaaa gtcgcttcag    198660
     gtggagagct gtcacgggtg atgcttgcca taaaaagcat tttttcctca caacaggatg    198720
     tgacatcgat catttttgac gaggttgata ccggtgtaag cggcagggtc gcacaggcaa    198780
     ttgctgagaa gatccataag gtgtcaatag gatcacaagt gctgtgcatt acacacctgc    198840
     ctcaggtggc tgccatggcc gatacgcatc tttatattgc gaaggagtta aaagacggca    198900
     gaacgacgac acgtgtcaag ccgctctcta agcaggaaaa ggtagcggaa atcgagcgca    198960
     gtattgcagg tgtcgaagta accgacttaa cgaaacgcca tgcgaaagaa cttttaaaac    199020
     aagcggatca agtcaaaaca actgggtaag ctgcgcgaga agcgcagctt atttttttcg    199080
     tgcacatcca ttcgttcatc agtatatcca atgtttttct tcatatgaca gttataaata    199140
     agccgtcaga aggcaaaatt aaatgatgta gcagcaagtc ataaagaagg tgtgggatag    199200
     gagcgaggag agtgaagtag tgaatgcccg ataacatcag aaaagcagta ggtttaattc    199260
     tccttgtttc gttattaagt gtaggtttat gcaaaccgct aaaagaatat ttactgattc    199320
     caacgcaaat gagagtattt gaaacccaaa cacaagcgat tgaaacgagt ttatcggtaa    199380
     atgctcagac atcagaatcc tcagaagcgt ttacagtaaa gaaagatccg catgaaatca    199440
     aggtgacggg caaaaaatca ggtgagtcag aattggtata tgatcttgcc ggatttccaa    199500
     ttaaaaaaac aaaagtgcat gttcttcctg atttaaaagt tatacctggc ggacaatcaa    199560
     tcggtgtaaa acttcattcc gtcggtgttc ttgtcggatt tcatcaaatc aatacaagtg    199620
     aaggcaaaaa atctccggga gaaacggcag gaattgaagc gggcgacatc attattgaga    199680
     tgaatggaca gaaaattgaa aaaatgaatg atgtagcccc atttattcaa aaggctggga    199740
     aaactggtga atctttagac ttactgatca aacgtgataa acagaaaatc aaaacgaagc    199800
     tgatcccaga aaaggatgaa ggagaaggca aatacagaat cgggttatat atcagagatt    199860
     ctgctgctgg catcggcact atgacctttt atgaaccgaa aacaaaaaaa tacggagcac    199920
     ttggccacgt gatttccgat atggacacaa agaaaccaat tgtagtggag aatggagaaa    199980
     tcgttaaatc cactgtaaca tcaattgaaa aagggacagg cggtaatccg ggagaaaaac    200040
     tggcgcgatt ttcctcagaa cgcaaaacga tcggggatat taacagaaac agcccgtttg    200100
     ggattttcgg cacactgcat cagccgattc aaaacaacat atcagatcaa gcattgccgg    200160
     ttgcgttttc taccgaagtc aaaaaagggc cggctgaaat tttaacggtt attgatgatg    200220
     acaaagtaga aaaattcgat attgaaatcg tcagcacaac gccgcaaaaa ttccctgcga    200280
     caaaaggaat ggtgttgaaa attaccgatc caagactgtt gaaagaaaca ggaggcatcg    200340
     tacaggggat gagcggaagc ccgatcattc aaaatggaaa agtgatcggt gctgtcaccc    200400
     atgtatttgt aaatgacccg acaagcggct acggtgttca tattgaatgg atgctgtcag    200460
     aagcaggaat cgatatttat ggaaaagaaa aagcaagctg actgccggag tttccggcag    200520
     tttttttatt ttgatccctc ttcacttctc agaatacata cggtaaaata tacaaaagaa    200580
     gatttttcga caaattcacg tttccttgtt tgtcaaattt catttttagt cgaaaaacag    200640
     agaaaaacat agaataacaa agatatgcca ctaatattgg tgattatgat ttttttagag    200700
     ggtatatagc ggttttgtcg aatgtaaaca tgtagcaagg gtgaatcctg ttaactacat    200760
     ttggggagga agaaacgtgg agaaaattaa agtttgtgtt gctgatgata atcgagagct    200820
     ggtaagcctg ttaagtgaat atatagaagg acaggaagac atggaagtga tcggcgttgc    200880
     ttataacgga caggaatgcc tgtcgctgtt taaagaaaaa gatcccgatg tgctcgtatt    200940
     agatattatt atgccgcatc tagacggact tgcggtttta gagaggctga gggaatcaga    201000
     tctgaaaaaa cagccgaatg tcattatgct gacagccttt gggcaggaag atgtcacgaa    201060
     aaaggccgtc gatttaggcg cgtcctactt tattctcaaa ccgtttgata tggaaaacct    201120
     tgtcggccat atccgccagg tcagcggaaa tgccagcagt gtgacgcatc gtgcgccatc    201180
     atcgcaaagc agtattatac gcagcagcca gcctgaacca aagaagaaaa atctcgacgc    201240
     gagcatcaca agcattatcc atgaaatcgg cgtcccagcc catattaaag gctatctcta    201300
     tctgcgcgaa gcaatctcaa tggtatacaa tgacatcgaa ttgctcggca gcattacaaa    201360
     agtcctctat ccggacatcg ccaaaaaatt taacacaacc gcaagccgtg tagaaagagc    201420
     gatccgccat gcaattgaag tggcatggag cagaggaaac attgattcca tttcctcgtt    201480
     gtttggttat actgtcagca tgacaaaagc taaacctacc aacagtgaat tcattgcaat    201540
     ggttgcggat aagctgaggt tagagcataa ggcttcttaa acatgagctt attaagtggt    201600
     cattaaatca aacgtctttt atttattagt ttgcgctgat aaataggagg cgttttgttt    201660
     tggggacatt tgtagtatgg gagaagaata ttaagtatcc gcatatagta aaggataggt    201720
     ttgaaaagta aggaaagcaa atggcggtat tacctgcact cttggtccat tcatacatct    201780
     tataggatca cgaagcatga tcgaccctag atgtgtccgt ttcatacatc ttataggatc    201840
     acgaagcatg atcgacccta gatgtgtccg ttataaaatg aaacctttct cctgcaaaat    201900
     cgtaagtaag gcgtattcat gtaaaaagga gacgtacgaa tgaaaaagaa aaaagcaaga    201960
     aagcgtgagg ggtttttcct ggattttctt ttcgaagttg gtggggagct ctttcttttg    202020
     ctgtttagat gtgtacacaa actatttata taaagggaaa aaagactgcc gaatcgtttc    202080
     ggcagtcttt gcacattaat ctttataagg cacccagcct tgtgtgttca caattgcttg    202140
     ccatagcggt tcaggcaaat gatatttttc tttatctgtg cctttgatca ctgtttcgat    202200
     ttgcttttca cggccttctt ttacttttac cgtccagtta gggtcaacta gaatttcgcg    202260
     tcccatagcg accagtggaa taccgttttc gatgacggca agcgcgtcat cagcggaatg    202320
     gatggaaccg acggcgatca gcggcacttt gtttccgaca cgttcattca ataagtccat    202380
     gcgtgtgcga gtcggatctg caccgcggcg cgcttttgag ttcacgtcca tcagtgagat    202440
     atgaagataa tccaattctt tatcccctaa agcatcaaca agcgtataag tttcagtcat    202500
     tgtcaatccc ggtgtctcag gttcttccgg agacaggcgg tagccgacta agaatgcacc    202560
     cttcgcatgt tctgaagcgg cttttttcac ttcatcgaca atagcgagcg ggaaggctaa    202620
     tcgtttttca tcgcttcctc cccagcgatc cgtgcgctgg ttggttttcg gagaataaaa    202680
     ctgctgaatt aagtagccgt ttgcaccgtg aatttcgaca ccgtcaaagc cggcttcaat    202740
     ggcgcgtctt gtcgcttctc caaacgcctt cacaatgttt tccacttctt cttctgttaa    202800
     tgcgcgagca atttgtttgc cgttatcaaa cacgtcactt ggccccacaa catcctgttg    202860
     aggaacgagc tcagacgggc actcaatacc gccgtgatga atttgtacaa cagctttagc    202920
     gccttgtgcc tgaatggctt gtgctaactt ttttaaacct ggaatgttgg aatcgtcatg    202980
     gatggccggc tgcccgggga atgcttttcc gtccggtgta acatttgcgc aggctgtaat    203040
     caccattccc atctcttttg aacgggggat gatgtagtcg agctccgctt cagatattgt    203100
     accgtcttca ttagaagcgt aatgagtcat cggtgctact gcgatccggt tgttgattgt    203160
     aacgccgctt ttaaacgtaa atggttcaaa aagtggctta tacttaggat tcatttgatc    203220
     atcttctttc ggttggattc gcacatattc tagcctatat gtaaaaatta atgcaattga    203280
     tctgctttac cgactgaata tcttgagtgc agagtgatgt tttggccgct ctttttcggg    203340
     gcctttgtag ccgccactga tttggtggcc gatggagcat gtgatgacag tgccgccagc    203400
     agcagaacga attttttcat ggctttaact tctttcaata aagtaaatat cctttaaaag    203460
     gttacgcttg gctgacccac ccgtcaaacg atttgctcac cctattctca aattttttaa    203520
     aatgaataaa aagttgcttc tttccgctaa ttttttctaa ttggcgcctc aattagagcc    203580
     atcctcatag acaaatctgc tcgttatctt tctaacaaca ggaaatgatc gggtcgtata    203640
     gcccttttga aaatcatgga acttgctcgc ctgcattcgc gttgtcttta caaattctcc    203700
     attctggtca aagataaaag ccaaacatca ggaagaggtg gtcatgtgaa acaaacggtt    203760
     cttttgctgt ttactgcgct ctttctttcg gggtgcagtg ttgcaagtgc ggatgactca    203820
     gtgccgaggt ttaccgaaga gggaaaatac attggctcgg ctgatcctca tacgattgcg    203880
     gtttctctta atggagaaga aaccatgata caagttccga aggataaacg tgatgaatgt    203940
     gaatcactgc cagatcagac acatgtcctg gtgaaatata caaagaagga taatggaact    204000
     ttacagctgg aagatattca gctgcgaaag acctcgtgac cggagggagt aagttgagaa    204060
     tgttatggag gagcttggcg ctgtgcggat tggctttgac gctcgcgcct tgtgcacagg    204120
     cagcagagcc gatagaaggg aaaacagtgt atattgatgc cggacacgcg gtgaagacag    204180
     tggagcggtc ggaaacgggc tctttgaaaa ggatattaat ttgcctgtct cagagcatgt    204240
     gacagacaaa ctaaaagagg agggagccaa tcctgttgca tcccggtctg acgatcattt    204300
     tctgaccttg gaggaaagag tggctaaggc aagtgccaat caggctgacc tttttgtcag    204360
     cattcatgtg aattcagggg ttgcttcagc ttcaggaaca gaaacgtatt ttcaatctga    204420
     ttatgaaggg gagaacagcc ggcgtctggc atccgatatt cagtcacagc tcgtttcttc    204480
     cttacaaacg agagacaggg gcgtgaaaga atcagacttt tacgtcatta catattcaca    204540
     aatgccaagt gtgttggcgg acttgggttt atcacgaaca gctctgacgc ggacaagctg    204600
     ggaagtgaag aataccagca aaaggccgca gatgcgattg tcaatggcat tgattcttat    204660
     tatgatcagt agattgatac agccttaatc ctagagtgga gccgacaaaa taagtataat    204720
     ggagaaaact ttagggtttg aggtgaaacg atgacaaaga tttttcccca ccggggggca    204780
     tcaggtcaat ttcccgaaaa tacaatgctt gcatttgaaa aaggaattga agccggagcg    204840
     gatgggatag agcttgatgt acagctgacg aaagacggac gcattgttgt aattcatgat    204900
     gaaagactta atcgcacgac atcacttaaa ggattcgtga aggatacagc ctatgatgag    204960
     gtaaagactg cgaatgcggc cgctggtcac gatcaagcgt acagcgatat aaaagtgccg    205020
     ctgctagaag atgtgctctc gtgggcggta aaaaaggatt ttctcatcaa cattgaatta    205080
     aaaaacagcg tgatccgcta tgagggaatg gaagaaaaag tgctggaggc agtgaagcga    205140
     tttaatgtag aggacagagt catcctatcc acgtttaatc atgacagctt ggcgctgtgc    205200
     gcccggcttg caccgcatat cgaacgggca gtattaactt cagatgtgct ttatcaggca    205260
     gatcgatata tcgcgtctat tccggcttcc ggctatcacc cgaagataaa cagcccaggg    205320
     gtcacagatg aagtactgaa gaaaatgagg aacggtttga ttaaggtaag gccgtataca    205380
     gtcaatcgtc cggaagatat gaagcgtctc attgaagcgg gagcagaccg catgtttacc    205440
     gactttccag aaaggcttcg gcattgctga aaaatgaata gttgttagaa ggaggctgtt    205500
     tgacgcagcc ttcttttttc attcattcat gcccgtttca aagcatacat tcatagaaga    205560
     caactagaaa ttgtaagcgc tgtctatctt ctgaatgagg tgaaaccatg aggaaaacag    205620
     tcattgtaag tgctgcaaga actccatttg gcaaattcgg cggagttttg aaagaggtga    205680
     aagctgctga gcttgggggc attgtgatga aggaggcgct gcaacaggct ggagtctctg    205740
     gagatgatgt agaaggaaac gtcatgggca tggttgtcca ggccggctca gggcagatac    205800
     cttcccgtca agctgcccgt ctggcgggaa tgccttggag tgtgccgtca gaaacactga    205860
     ataaagtctg tgcttccggc cttcgcgctg tcactttatg tgatcaaatg attcgggcgc    205920
     aggatgcgga catacttgtt gcggggggga tggaaagcat gagcaatatt ccgtatgccg    205980
     ttcccgccgg gcgctgggga gcacggatgg gggacggcga gcttagggac ttaatggtgt    206040
     atgacggatt aacgtgcgca tttgacgagg tgcacatggc tgttcacgga aatacagctg    206100
     ccaaggaata tgcaatctca cgaagagagc aggacgaatg ggcgttgaga agtcatgcaa    206160
     gggcagctaa ggccgccgat gaagggaagt ttcaggatga aattgttccc gtcaactgga    206220
     tcggtcgaaa aggaaaacca aacgttgttg ataaagatga agcgattcgc cgtgacacaa    206280
     gtctggatca gctcgcaaaa cttgctccga tttatgcaag tgacggttct atcacagccg    206340
     gcaatgctcc tggagtcaat gacggagccg gcgcgttcgt gctgatgtct gaggaaaaag    206400
     ctgctgagct tggcaaacgg cctctggcta caattcttgg tttttcaact acgggaatgc    206460
     cagcgcacga gctggcggca gcgccagggt ttgctattaa caagctcctg aaaaagaatg    206520
     gtttaactgt ccaagatatt gacttgtttg aagtaaatga agcttttgct tcagttgttt    206580
     tgacatgtga aaaaatcgta ggtttcgatc ttgaaaaagt aaatgtgaat ggcggtgcga    206640
     tcgcgctcgg ccacccgatc ggcgcgagcg gtgcgagaat tctcatgacg cttgtttatg    206700
     aattaaagcg acggggaggg ggtctgggcg ttgccgctat ttgcagcggg gcagcacagg    206760
     gagacgccgt cttagtgcag gttcattaaa acatgatgaa aaaggggatt tgaatggaaa    206820
     tcaaacaaat catggtagct ggcgcaggtc agatggggag cggaattgct caaacagccg    206880
     ccgacgcggc ttttatgtgc ggatgtatga tgtgaatcca gaggccgcgg aggcaggatt    206940
     gaaacggctg aagaaacagc tggcccgtga tgctgagaaa ggaaaaagga ccgagacgga    207000
     agtgaagagc gtaatcaacc gcatttcgat ttctcaaaca cttgaggagg cagagcatgc    207060
     ggacattgtg attgaggcta tcgcagaaaa catggcggca aaaactgaga tgtttaaaac    207120
     acttgatcgc atttgcccgc ctcatacgat tttggccagc aatacatctt ccttgcctat    207180
     tacagaaatc gctgctgtaa caaaccggcc tcaacgggtt attggcatgc attttatgaa    207240
     tcccgtccct gtaatgaagc tggtagaagt gattcgaggc ttggctacat cagaagaaac    207300
     ggccttagat gttatggcat tagcggaaaa gatggggaaa acagcggtag aagtcaatga    207360
     ttttcctggg tttgtttcca accgtgtgct tcttccaatg attaatgaag ccatctattg    207420
     cgtgtatgag ggagtgcgaa cggaggcaat agatgaagtg atgaagctgg gcatgaatca    207480
     tccgatgggt ccgcttgcat tagcggattt tatcggactg gatacgtgtt tatcaattat    207540
     ggaagtcctt cactcaggcc ttggcgattc caaataccgt ccttgcccgc tgctccgcaa    207600
     gtatgtcaaa gcaggctggc ttggcaaaaa gagcggacgc ggtttttatg actatgagga    207660
     gaagacttcc tgaagtctat tccatccggg ggtggccgag ttgcatgtaa cccaagagca    207720
     agtcatgatg cgaaaaatgg tgcgtgattt tgcacgaaaa gaaattgctc ccgctgcgga    207780
     aatcatggag aaaacggacg aatttccctt tcagctgatc aaaaaaatgg gtaaacacgg    207840
     actgatggga ataccggtgc cggaacaata cggcggtgct ggagcggacg ttgtttctta    207900
     tattttggca attcatgaga tttctagaat cagcgcggct gtcggcgtga ttctctccgt    207960
     tcatacctca gtcggcacga atccgattct gtatttcggc aacgaagaac agaagatgaa    208020
     atatatacca aatctcgcgt caggagacca tttgggcgca tttgcactaa cggagcctca    208080
     ctcggggtcg gatgccggga gcctccgcac aacagcaatc aaaaagaacg gcaaatacct    208140
     attaaacgga tcgaaaatat tcataacgaa tggcggagca gctgatatct atatcacatt    208200
     tgctttaaca gctccagatc aaggcaggca cgggatttcg gcttttattg ttgaaaaaaa    208260
     cacacccggt tttaccgttg gaaaaaaaga aagaaagctg gggctttatg gctccaatac    208320
     tacggaactg atttttgata atgcagaagt gcctgaagcc aatttgcttg gcaaagaggg    208380
     ggatggcttt cacattgcca tggcgaattt aaatgtcggc cggatcggca ttgcggcaca    208440
     ggccctcgga attgcagagg cggctcttga gcatgccgtt gattatgcga agcagcgagt    208500
     gcaatttgga aggccgattg cagccaatca aggcatatca tttaagctgg ctgatatggc    208560
     gactagagct gaggcggcaa gacatcttgt ctaccacgct gcagaccttc ataaccgcgg    208620
     cctaaactgt ggaaaagaag cgtctatggc taaacaattt gcttccgatg cagccgtaaa    208680
     ggcgttagac gccgttcaaa tttatggggg atatggctat atgaaggatt atccagttga    208740
     gcgcctgctt cgcgatgcaa aggtgacgca aatttatgaa gggacgaacg agattcaaag    208800
     actgattatt tccaagtatt tgcttggcgg aacctgatag acaaaaaacg caaaaacgga    208860
     ggttgaggat atggaggaga aacagcatta ttctccaggg ttggacggtg tgattgcggc    208920
     agaaactcat atttcttatc ttgacacgca gtccagccag attttgataa gaggctatga    208980
     tttaatagaa ctttctgaaa caaaaagcta tctggagctt gtccatttat tgctggaggg    209040
     caggctgcca gaagaaagtg aaatggaaac gctggaacgt aaaataaaca gtgcctcaag    209100
     cctgcctgct gatcatctcc gtctgcttga gctgctccct gaggacactc atccaatgga    209160
     tggtctgcgt accggcctgt cggcacttgc tggctatgat cggcaaattg atgatcggtc    209220
     tccttccgca aacaaagaac gcgcctatca gcttcttggg aaaatgcctg ccctcactgc    209280
     tgccagctac aggatcatta ataagaaaga accgattctt ccgcttcaaa ccctatccta    209340
     cagtgcgaat tttctctaca tgatgacagg gaaattgccg tcttcattgg aagaacagat    209400
     ttttgaccgg tcgctcgtcc tgtacagtga gcatgagatg ccgaattcaa cctttgcggc    209460
     cagggtcatt gcatctacac attcagatct ttatggggct ttgactgggg ctgtcgcttc    209520
     cctgaaaggg aatcttcacg gaggagcaaa cgaagctgtg atgtatttgc ttttggaggc    209580
     aaaaacgaca tctgattttg agcagctttt gcaaacaaaa ctgaaaagaa aagaaaaaat    209640
     catgggcttc ggccaccggg tgtatatgaa aaaaatggac ccgagagcac tcatgatgaa    209700
     agaggcgctg cagcaattat gcgataaagc cggtgaccat cgtttatatg agatgtgcga    209760
     agcgggtgag cggctgatgg agaaggaaaa agggctttac ccgaatttgg attactatgc    209820
     tgccccagtg tattggatgc tcggcatacc gattccttta tatacgccga tctttttcag    209880
     cgcgagaacg tccggtttat gcgcccatgt gatcgaacag catgccaata atcggctctt    209940
     ccgtccccgt gtcagttaca tgggcccgcg atatcaaaca aaatcatgaa aggagctggt    210000
     agaatgccga aaacggatcg tgttatcgaa gaaatcacag actatgtgct tgagaaagag    210060
     attactagtg ccgaagcgta tacaacagcg gggcatgtat tgctggatac cctgggctgc    210120
     ggaatcttgg cgctacggta tccggaatgc acaaagctgc ttggcccgat tgttccagga    210180
     acgactgtgc cgaatggaag caaagtgccg ggaacgtcat atgttctcga tcctgtgagg    210240
     gcagcgttta atattggctg catgattcgc tggctcgatt acaacgatac gtggctggcg    210300
     gcggagtggg ggcatccatc cgataacttg ggaggaatcc ttgccgctgc tgattatgta    210360
     tcaagagtga ggctgtctga aggaaaagag ccgttaacgg tacgcgacgt acttgagatg    210420
     atgatcaaag cacacgagat ccaaggtgtg ctggcgttag aaaacagctt aaatcgagtt    210480
     ggccttgacc atgtgctgtt tgtcaaagtt gcgacaactg ctgttgcagc aaagcttttg    210540
     ggcggcggaa gagaagaaat caaaaatgcg ctttcgaatg catggattga caatgcagca    210600
     ttgaggacat accgccattc accgaataca ggctcgcgta aatcatggcc ggcaggagat    210660
     gcaacgagca gaggtgttca tttggcgctg atgtcgttaa aaggggaaat gggttatccg    210720
     acagccttga gtgcaccggg ttgggggttc caagacgttt tattcaataa gaaagagatc    210780
     aagcttgccc gtccgctcga cgcttatgtc atggaaaatg tgttatttaa agtgtcttat    210840
     cctgcggaat ttcacgccca gacagcggcg gagtccgccg tcattcttca cccgcaggta    210900
     aagaaccgga ttgacgagat tgaccgagtt gtcatcagaa cgcatgaatc agctatccga    210960
     atcattgata aaaaaggccc gctccacaat ccggcagacc gtgatcactg cctccaatac    211020
     attacagcaa tcggtttgct ttttggtgat atcaccgcac agcattatga agctgaaaca    211080
     gcgaatgatc cgagaataga taaacttcgt gataaaatgg aagtgactga aaataaaaca    211140
     tataccgagg attatttgaa gcctgataaa cgctccatct caaatgccgt tcaggttcat    211200
     tttaaagatg gaacgagcac ggaaatggtg gaatgtgagt ttcccctcgg ccatcgtttt    211260
     cgaagagagg aagcagtgcc gaaactgctg gaaaagtttt ctgacaatct caaaacccat    211320
     tttcctgata aacagcacaa acacatttat gagcgctgta ccagctatga gacattacaa    211380
     acgatgcgcg taaatgaatt cgtagacatg ttctgcatgt aaaaggggga ttttgtttca    211440
     tgtcgtggat cgtcaataag caatcgtcac aagaggagct tgccgggcgt ttccgcaagc    211500
     tgatgtcagc accggacatt cttcaaattc ccggcgccca tgacgggatg gccgctttgc    211560
     ttgcgaaaga agccggtttt tctgctattt atttgtccgg tgctgcctat acagccagca    211620
     gggggctgcc tgatttaggg atcatcacat cggcagagat agctgaacgg gccaaagatc    211680
     ttgtgcgtgc agctgatctg cctttgcttg tggatatcga tacgggattt ggcggtgtct    211740
     taaatgccgc ccgaacagcc cgggagatgc ttgaagccag ggtagcagcc gttcaaatgg    211800
     aagaccagca gctcccaaaa aaatgcggac atttaaatgg caaacagcta gttccgataa    211860
     aggaaatggc gcaaaaaata aaagccatta aacaagcggc accctccctt attgttgttg    211920
     cccgtactga tgccagggcg caggaagggc ttgatgccgc aataaaacgt tcagaggctt    211980
     acattgaggc gggagcggac gcaattttcc cggaagcgct acaggcggag aatgaattcc    212040
     gccagtttgc tgagcgtatc cccgttccgc tccttgcgaa tatgactgaa tttgggaaaa    212100
     cgccatatta tcgtgccgat gaattcgaag atatggggtt tcacatggtg atatatcctg    212160
     tcacctcgct tcgagcggcg gcaaaagctt gtgagcggat gtttggtttg atgaaggagc    212220
     acggctcaca aaaagaagga cttcatgata tgcagacacg aaaagaactg tacgatacga    212280
     tttcttatta tgactatgaa gcgttagaca aaacgattgc caagaccgtt ttgcctgacg    212340
     aataatgcaa caaaaaaagc cggagcattc tccggctttt tttcagctat cgttttctga    212400
     atcgcgggct gacttgattg cgttttctgt ctctgtataa aatgaacccg gccagcacat    212460
     agaggccgat cgcaaaaaag atgaatcctg acaacccttg gagccaaaga gctgaaaatg    212520
     gcttgattgt atggccgaaa agtgtatctc tcatcagttt aatgcctaaa gcagaaatag    212580
     ccccggggat gactaatatt aaaagcgcaa gaagtcggct catcttcaga aaaccccttt    212640
     atcttttcat ttcctttatt gtccagcgga aaaaatattt tgtcaagaga agaaaacgtg    212700
     gtaacatagg gttgtgcaaa ttattgcaac ggaataaata ggtgtgcaaa ttttttcata    212760
     caaaggggta tcgggatgca aaaggtactg atagtaggtg ccggcaaaag gggaacggcg    212820
     ttattacata ttctgattaa aacagccatc atagatatca ttgccgtagt tgacaaagac    212880
     cccgaggcgc cgggattgaa agaagcagaa cagtatggga ttgccgtatc atctgattgg    212940
     aaaccttaca tacaacaaaa accggatatc gtcattcata ctaccggcga tcaagccgtg    213000
     tttgacgagc tccttcaaag aaagcatgaa gataccattg tcatgccggg aaaaatggca    213060
     tacatcgttt ttcagctgat ggaagaaaag cagcacctga ttcaaatgct aaaagagcaa    213120
     acctataaat atgacagaat ttttaattcc acccatgatg gaatgatttt tattgatatc    213180
     aatgaagaaa tcattctctt taaccatatg gccgaaaaaa tggtcggaaa aaaacgtgag    213240
     gaagtcattg ggcgcccaat aaaagaagtg attccgagca ctaagatgcc gcggatttta    213300
     aaaacaagag tgcctgaata caaccagaag cagctgttag gcgatcattt gcaaattgtg    213360
     accacaagac tgccgattat tgatgaaggc ggacgtctgc tcggggctct ttgtgtgttt    213420
     aaagatatca ctgatgcggt cgagctggca gaggaagtga ccaacttaaa gcaggtccgt    213480
     acgatgctgg aggcaattat tcaatcctcc gatgaggcga tttctgtcgt tgatgaaaac    213540
     ggcatcggcc tgctaatcaa taaagcgtat acgaaaatga cggggctttc tgaaaaagaa    213600
     gtcatcggca agcctgcaaa cactgatatt tccgaaggcg aaagcatgca tttaaaggtg    213660
     cttgaaacaa gacgtcctgt ccgcggtgtc agaatgaagg tcggcccgaa tgaaaaagaa    213720
     gtgatcgtta atgtagcacc ggtgattgtg gacgggattt tgaaaggcag cgtcggcgtg    213780
     attcacgatg tttccgaaat taaaatgctg acagcggagc ttaatcgcgc cagacaaatt    213840
     attcgcacgc ttgaagcgaa atacacgttt gacgacatta tcggcaaaag cgagcaaatg    213900
     ctggttgcgc ttgagcaggc gaagctcggt gcgaaaacac cggcaaccat cttgctgcgc    213960
     ggggaatcag gaacaggaaa agaactgttc gcccatgcca tccataacga aagtgaccgg    214020
     aaatacaata aatttattcg cgtgaattgt gcagcccttt ctgaaaacct gctcgaatca    214080
     gaattgttcg gctatgagga tggtgcgttt tcaggagcga agcgcggcgg taaaaagggt    214140
     ttatttgagg aagcaaataa cggcagtatt ttcttagatg aaatcggtga gctgacacaa    214200
     aatatgcagg ccaaattgct acgcgtcctt caagaaaagg aaatcgtcag agtgggcggc    214260
     acgaaagcga tccctgtcaa cgtcagagtg atcgcggcga caaatgtaaa tattgaaaag    214320
     gcgatggcgg acggaacatt ccgggaagac ctgtattacc ggatcaatcg ctatccgatc    214380
     tccatcccgc ctttgcggca gcggttggag gacattgaag cattgagcgt cagacttatc    214440
     caaaagatca accgggatta cggcaggaat gtaaaagggc tctcacagca agccttgcgc    214500
     gccttatctg cctaccattg gcctgggaat gtccgggagc ttgaaaatgt ccttggacga    214560
     gccatgattt ttctgaatcc gcatatggaa tggattgaaa aagatcactt gcctgtattc    214620
     gaacttgagc aaaaagaaaa tgacacagat cagggaacag gttttgattt tccggatatt    214680
     gaaggcgaaa agctgtctgt cgcagtagaa aaatttgaag cgcatttgat ccagcaaacg    214740
     cttgaaaagc atcattttaa ccggacaaaa acagcaaaag ctctcggtgt cagcattcgg    214800
     aatttatatt acaaaatgga taaatatggc cttgcaaatg aaggcatgca ataatttgca    214860
     gaataaacgc aaacatctgc acgaatgttt cggtatacct ggtatgacag cacccttaag    214920
     agctggcatg gaacttgcat aataaaaggc ggagtcgaaa caagaaaggt ggtaacagat    214980
     gaagctgaaa gatttaatcg gcaaagcgtc gatacacaaa aataagacca ttgcggttgc    215040
     tcatgctgag gatgaggaag tgatccgggc tgtaaagctg gcagccgagc acctatccgc    215100
     ccgtttcttg ttaacgggcg acagcaaaaa actgaacgag ctgacatcat ccatgcaagg    215160
     gcatcaagtg gaaatcgtcc atgccaatac tcctgaggaa tcggcgaaat tagcggttcg    215220
     tgctgtgcat cataaaacag cggacgtttt aatgaaaggc aatgtgccga cttctgtttt    215280
     gcttaaagcg gtattgaaca gacaggaggg gcttcggtca gcaagtgtcc tttctcacgt    215340
     ggctgtcttc gatataccgg attttgaccg gctgatgttt gtgacagatt cggcaatgaa    215400
     tattgctcct tcgctggaag agctccggca gattttgcaa aatgccgttc atgtggccca    215460
     tgcagtgggg aacaatatgc caaaagcagc tgcccttgca gcggtcgaaa cggtgaaccc    215520
     taaaatggaa gcgaccgtga atgcagctgc tctagctcaa atgtacaaaa ggggccagat    215580
     caaaggctgc attgttgatg gaccgcttgc tttggataac gcagtttcac aaattgccgc    215640
     ggcccagaaa aaaatttcgg gagacgtagc gggcaaccca gatatccttc tcgtcccaac    215700
     aattgaggcc ggcaatattt tatataaatc actgatttat tttgccaagg ccagcgtggc    215760
     ggctgtcatt acaggagcaa aagcaccgat tgctttaaca agcagagcgg actctgctga    215820
     aaataaactg tattccattg cgctggcaat atgcgcatct gaagaataca cacattagga    215880
     ggaacgaaca tggaactttt taaatatatg gagaaatacg attacgaaca attggtattc    215940
     tgccaggatg aacaatctgg attaaaagcg attatcgcca ttcatgatac aacgcttggt    216000
     ccggcgcttg gcggaacgag aatgtggaca tatgaaaatg aagaagcggc aattgaagat    216060
     gcgctcagat tggcaagagg catgacctat aagaacgcgg cggcaggctt aaaccttggc    216120
     ggcggaaaaa cagtcattat cggcgatccg cgcaaagaca aaaatgagga aatgttccgc    216180
     gcgtttggcc gctatattca aggactgaat ggcagataca tcacggctga agatgtgggc    216240
     acaacggtcg aggatatgga tatcattcat gatgagacag actatgtcac agggatttct    216300
     cctgctttcg gctcttctgg aaatccgtcc ccagtcacag cgtacggggt gtacagagga    216360
     atgaaggcag cagctaaagc tgctttcgga accgattctc ttgaaggaaa aaccattgct    216420
     gtacagggtg ttgggaacgt agcctataac ctttgccgcc acctgcatga agaaggagca    216480
     aacttaatcg ttacggatat caacaaacaa tctgtacagc gtgcagttga agattttggc    216540
     gcccgtgcgg tagatcctga tgacatttat tcacaagact gcgatattta tgcgccgtgt    216600
     gcccttggtg cgactattaa cgacgacacc attaaacagc tgaaggcgaa agtgatcgca    216660
     ggtgcggcta acaaccaatt aaaagagaca cgccatggtg atcaaattca cgaaatgggc    216720
     atcgtttatg caccggatta cgtgattaac gcgggcggtg tcatcaacgt ggcagatgag    216780
     ctttacggct ataatgcaga acgtgcattg aaaaaagttg aaggcattta cggcaatatc    216840
     gagcgtgtac ttgagatttc tcagcgtgac ggcattcctg catatttagc ggctgaccgc    216900
     ttagcagagg aacggattga acgcatgcgc cgctcaagaa gccagttttt gcaaaacggc    216960
     cacagtgtat taagcagacg ttaagaaatt gatctggagg ttatgaaagt gctacatgac    217020
     gaaaaacgca ttctcacaat taatccaggc tcaacttcaa cggaaatcgg tgtttttcat    217080
     aacgaaagaa gcatttttga aaaaacattg agacacaaca tagaagagct gcagcgattt    217140
     gaccgaatta ttgatcagta tgaatttcgt aaaaaccata ttctcgaaac gcttcatgaa    217200
     cagggaatca atatttcaaa gtttgatgca gtctgcgcaa gaggcggcct tctccggcca    217260
     attgaaggcg ggacctacgt agtgaatgat gagatgattg aggatttgaa aagcggctac    217320
     gccggtcagc atgcttctaa tctcggcggc attatcgcgc gggaaatcgc tgacggcctg    217380
     aatatccctt cgtatatcgt cgaccctgtt gtcgtagacg aaatgtcagt gcttgcgaaa    217440
     gtttcaggca tgcctgaaat tgaaaggaaa agcattttcc atgcgttaaa ccaaaaagct    217500
     gtcgctcgta aagcggcagc ctcccttggc aaacgatatg agaacatgaa aatgattatt    217560
     acccatatgg gcggaggtat tacaattggc gtccatgacc gcgggcgagt ggtggatgtc    217620
     aataacggcc tgcacggcga gggaccattc agtcctgaac gagcaggaac agtgcctgcg    217680
     ggagatcttg ttgatctatg tttttcaggg gaatatacaa aagaagaaat catgaaaaag    217740
     cttgttggca ccggcggact tttaggctat ctcggtacaa atgatgcagt aaaagtggaa    217800
     cagatgattc aagggggcga tgaaaaagcc cgcttcattt atgatgccat ggcatatcag    217860
     gtagcaaagg aaatcggggc agccagcgcg gcgttaaaag gcgaagttga agcgattgtg    217920
     ctgacgggag gccttgcgta cggaaaaagc tttgtttctg ctatcagatc atacatagat    217980
     tggatttcag acgttttagt ttatccgggt gaaaatgaac tgcagtctct tgcccaaggg    218040
     gcgctaagag tattgcaggg cgaagagcaa tccaaacaat atcgtattga atagacagac    218100
     aggagtgagt caccatggca actgagtatg acgtagtcat tctgggcggc ggtaccggcg    218160
     gttatgttgc ggccatcaga gccgctcagc tcggcttaaa aacagccgtt gtggaaaagg    218220
     aaaaactcgg gggaacatgt ctgcataaag gctgtatccc gagtaaagcg ctgcttagaa    218280
     gcgcagaggt ataccggaca gctcgtgaag ccgatcaatt cggagtggaa acggctggcg    218340
     tgtccctcaa ctttgaaaaa gtgcagcagc gtaagcaagc cgttgttgat aagcttgcag    218400
     cgggtgtaaa tcatttaatg aaaaaaggaa aaattgacgt gtacaccgga tatggacgta    218460
     tccttggacc gtcaatcttc tctccgctgc cgggaacaat ttctgttgag cggggaaatg    218520
     gcgaagaaaa tgacatgctg atcccgaaac aagtgatcat tgcaacagga tcaagaccga    218580
     gaatgcttcc gggtcttgaa gtggacggta agtctgtact gacttcagat gaggcgctcc    218640
     aaatggagga gctgccacag tcaatcatca ttgtcggcgg aggggttatc ggtatcgaat    218700
     gggcgtctat gcttcatgat tttggcgtta aggtaacggt tattgaatac gcggatcgca    218760
     tattgccgac tgaagatcta gagatttcaa aagaaatgga aagtcttctt aagaaaaaag    218820
     gcatccagtt cataacaggg gcaaaagtgc tgcctgacac aatgacaaaa acatcagacg    218880
     atatcagcat acaagcggaa aaagacggag aaaccgttac ctattctgct gagaaaatgc    218940
     ttgtttccat cggcagacag gcaaatatcg aaggcatcgg cctagagaac accgatattg    219000
     ttactgaaaa tggcatgatt tcagtcaatg aaagctgcca aacgaaggaa tctcatattt    219060
     atgcaatcgg agacgtaatc ggtggcctgc agttagctca cgttgcttca catgagggaa    219120
     ttattgctgt tgagcatttt gcaggtctca atccgcatcc gcttgatccg acgcttgtgc    219180
     cgaagtgcat ttactcaagc cctgaagctg ccagtgtcgg cttaaccgaa gacgaagcaa    219240
     aggcgaacgg gcataatgtc aaaatcggca agttcccatt tatggcgatt ggaaaagcgc    219300
     ttgtatacgg tgaaagcgac ggttttgtca aaatcgtggc tgaccgagat acagatgata    219360
     ttctcggcgt tcatatgatt ggcccgcatg tcaccgacat gatttctgaa gcgggtcttg    219420
     ccaaagtgct ggacgcaaca ccgtgggagg tcgggcaaac gatttcaccc gcatccaacg    219480
     ctttctgaag caattggaga agctgcgctt gccgcagatg gcaaagccat tcatttttaa    219540
     aagcataaag gaggggcttg aatgagtaca aaccgacatc aagcactagg gctgactgat    219600
     caggaagccg ttgatatgta tagaaccatg ctgttagcaa gaaaaatcga tgaaagaatg    219660
     tggctgttaa accgttctgg caaaattcca tttgtaatct cttgtcaagg acaggaagca    219720
     gcacaggtag gagcggcttt cgcacttgac cgtgaaatgg attatgtatt gccgtactac    219780
     agagacatgg gtgtcgtgct cgcgtttggc atgacagcaa aggacttaat gatgtccggg    219840
     tttgcaaaag cagcagatcc gaactcagga ggccgccaga tgccgggaca tttcggacaa    219900
     aagaaaaacc gcattgtgac gggatcatct ccggttacaa cgcaagtgcc gcacgcagtc    219960
     ggtattgcgc ttgcgggacg tatggagaaa aaggatatcg cagcctttgt tacattcggg    220020
     gaagggtctt caaaccaagg cgatttccat gaaggggcaa actttgccgc tgtccataag    220080
     ctgccggtta ttttcatgtg tgaaaacaac aaatacgcaa tctcagtgcc ttacgataag    220140
     caagtcgcat gtgagaacat ttccgaccgt gccataggct atgggatgcc tggcgtaact    220200
     gtgaatggaa atgatccgct ggaagtttat caagcggtta aagaagcacg cgaaagggca    220260
     cgcagaggag aaggcccgac attaattgaa acgatttctt accgccttac accacattcc    220320
     agtgatgacg atgacagcag ctacagaggc cgtgaagaag tagaggaagc gaaaaaaagt    220380
     gatcccctgc ttacttatca agcttactta aaggaaacag gcctgctgtc cgatgagata    220440
     gaacaaacca tgctggatga aattatggca atcgtaaatg aagcgacgga tgaagcggag    220500
     aacgccccat atgcagctcc tgagtcagcg cttgattatg tttatgcgaa gtagggagga    220560
     agaacaaatg tcagtaatgt catatattga tgcaatcaat ttggcgatga aagaagaaat    220620
     ggaacgagat tctcgcgttt tcgtccttgg ggaagatgta ggaagaaaag gcggtgtgtt    220680
     taaagcgaca gcgggactct atgaacaatt tggggaagag cgcgttatgg atacgccgct    220740
     tgctgaatct gcaatcgcag gagtcggtat cggagcggca atgtacggaa tgagaccgat    220800
     tgctgaaatg cagtttgctg atttcattat gccggcagtc aaccaaatta tttctgaagc    220860
     ggctaaaatc cgctaccgca gcaacaatga ctggagctgt ccgattgtcg tcagagcgcc    220920
     atacggcgga ggcgtgcacg gagccctgta tcattctcaa tcagtcgaag caattttcgc    220980
     caaccagccc ggactgaaaa ttgtcatgcc atcaacacca tatgacgcga aagggctctt    221040
     aaaagccgca gttcgtgacg aagaccccgt gctgtttttt gagcacaagc gggcataccg    221100
     tctgataaag ggcgaggttc cggctgatga ttatgtcctg ccaatcggca aggcggacgt    221160
     aaaaagggaa ggcgacgaca tcacagtgat cacatacggc ctgtgtgtcc acttcgcctt    221220
     acaagctgca gaacgtctcg aaaaagatgg catttcagcg catgtggtgg atttaagaac    221280
     agtttacccg cttgataaag aagccatcat cgaagctgcg tccaaaactg gaaaggttct    221340
     tttggtcaca gaagatacaa aagaaggcag catcatgagc gaagtagccg caattatatc    221400
     cgagcattgt ctgttcgact tagacgcgcc gatcaaacgg cttgcaggtc ctgatattcc    221460
     ggctatgcct tatgcgccga caatggaaaa atactttatg gtcaaccctg ataaagtgga    221520
     agcggcgatg agagaattag cggagtttta aagacgtaag ggaggataca atcatggcaa    221580
     ttgaacaaat gacgatgccg cagcttggag aaagcgtaac agaggggacg atcagcaaat    221640
     ggcttgtcgc ccccggtgat aaagtgaaca aatacgatcc gatcgcggaa gtcatgacag    221700
     ataaggtaaa tgcagaggtt ccgtcttctt ttactggtac gataacagag cttgtgggag    221760
     aagaaggcca aaccctgcaa gtcggagaaa tgatttgcaa aattgaaaca gaaggcgcga    221820
     atccggctga acaaaaacaa gaacagccag cagcatcaga agccgctgag aaccctgttg    221880
     caaaaagtgc tggagcagcc gatcagccca ataaaaagcg ctactcgcca gctgttctcc    221940
     gtttggccgg agagcacggc attgacctcg atcaagtgac aggaactggt gccggcgggc    222000
     gcatcacacg aaaagatatt cagcgcttaa ttgaaacagg cggcgtgcaa gaacagaatc    222060
     ctgaggagct gaaaacagca gctcctgcac cgaagtctgc atcaaaacct gagccaaaag    222120
     aagagacgtc atatcctgcg tctgcagccg gtgataaaga aatccctgtc acaggtgtaa    222180
     gaaaagcaat tgcttccaat atgaagcgaa gcaaaacaga aattccgcat gcttggacga    222240
     tgatggaagt cgacgtcaca aatatggttg catatcgcaa cagtataaaa gattctttta    222300
     agaagacaga aggctttaat ttaacgttct tcgccttttt tgtaaaagcg gtcgctcagg    222360
     cgttaaaaga attcccgcaa atgaatagca tgtgggcggg ggacaaaatt attcagaaaa    222420
     aggatatcaa tatttcaatt gcagttgcca cagaggattc tttatttgtt ccggtgatta    222480
     aaaacgctga tgaaaaaaca attaaaggca ttgcgaaaga cattaccggc ctagctaaaa    222540
     aagtaagaga cggaaaactc actgcagatg acatgcaggg aggcacgttt accgtcaaca    222600
     acacaggttc gttcgggtct gttcagtcga tgggcattat caactaccct caggctgcga    222660
     ttcttcaagt agaatccatc gtcaaacgcc cggttgtcat ggacaatggc atgattgctg    222720
     tcagagacat ggttaatctg tgcctgtcat tagatcacag agtgcttgac ggtctcgtgt    222780
     gcggacgatt cctcggacga gtgaaacaaa ttttagaatc gattgacgag aagacatctg    222840
     tttactaaat aagcaaaaag agcatttttt gaagttttgt ttcaaaaaat gctctttttc    222900
     tatgctttat tattcagcga tccgtatttt catttcgact cgatattctt cttgtttttt    222960
     cggggagtaa tgaatcggta tgattaactc gtatacatca ctgacaactg ttaattggcg    223020
     gtccgcgata tatttgataa gcttctgtaa gttgagaaaa taatgttcag gcgaaaaatt    223080
     atacgcgata cacgcatacc tccctttagg gatcgttgtg atttccatat ccggcgtaat    223140
     tgatgaaatc tgtttattcg tcaatacagg tgtgaaaata tgacggtaag tcatttcatc    223200
     aatgctggtg tagggctgaa aagagaaagt agcgccgtag ctattgttcg taaatccatc    223260
     tgctgactcg ataaattttt ttaatttgct gtaggaggcg ttgagcacgt tttcaggccc    223320
     gattccttct gcctctgtct gaatgatccg tatttcttct tcatctaaaa caaacacctc    223380
     accgaggcgg cgggatattc catctgccgt ttcatccgct ttttcaccaa tgaaatggtt    223440
     tgctccaggg ctgataaaaa gtctaatttc tccctgattt gcctctcctg ctctgtataa    223500
     aaagcaaaca gttcttccat ctctaagtcc ttgtgctttt ttcatctctt ctaaaggtgt    223560
     gccgatatat ttcaatgatt tgatcaaatc cagatgaatg agctgagaat ctgtataata    223620
     gcggtagctg gtatccgggt cgacgtaggc tggtttaaat aaatcaattt tatcgtaata    223680
     acggagcgct tttatcgaca cgtttgccag ttttgatact tccccaattg agtaatacga    223740
     ttccttcatg ccatcactcc ttctatcatc agtataaaga agaagcgcat tctttgcagt    223800
     acacaaagaa tgcgcttctt atcacgtgct ggctttaaga tgtgcaggcg ctttccaagc    223860
     aatggtcagt gcaatcccta tggctaaggt gaccgttgca aagtagaaag gatagtttac    223920
     atctatatcg aacagcattc cgccgataat aggcccgaat acattgccga tacttgtaaa    223980
     cattgaattc ataccgccgg caaacccctg ttcatttccc gcaatctttg acaggtaagt    224040
     cgttaccgca ggccgcatga gatcaaatcc gacaaatacg gtgactgtca ccagcagaat    224100
     cgcaacatat gaatgtaccg ttgtcagcaa gaataccaga ctcgtcgaga gaattaagct    224160
     gtaccgaatt aaatgaattt cgccaaacca tcttgtgaag cggtcgaata agacgacttg    224220
     cgtaatggcg ccaacaatcg ctcctcctgt aatcataatg gcaatgtcgc tggccgtaaa    224280
     tccgaattta tgatccacga ataatgcaaa taaagattca aatgatgcta aaccaaaaga    224340
     cgaaattaag ataatgagaa aagctatgaa atacatgggg gcaaaaattc gtttaaagcc    224400
     tgtcttctgt ccttttattt cctgattttc agggtttcgt tccggctcgc gcagcgtgag    224460
     gattgataaa atggctgcta acagtgcaaa agctgccgca aagaaaaaag gcagccggga    224520
     atggacttct gctaaaaatc ccccgatgcc ggggccgata ataaatcctg ttgaaatagc    224580
     ggctgacata taaccgagcg cttttggccg tgttttaatg gtcgtgatat ctgcaataaa    224640
     agccgtgacc ccgggcataa tgaacggtgc gctgataccg cccagcatac gggagataaa    224700
     taacatctca actgtttttc caatgccgaa caaaaactcc gacacactaa agaacaacag    224760
     gccgattacg atcatgatct tgcgcccgaa gcgatcaacc catcgtccgg ctattggtga    224820
     gacaatgagc tgtgtaatag cgaagcaggc aaccatatag ccgaccgcgg tccccgataa    224880
     atgcaattca ttcataatgg tcggcgttac tggaatcaca agcccgatcc ccaaaaaagc    224940
     aataaataaa ttggttaata atatagttaa ggtaatattt ttcttctcca tatgacttcc    225000
     cctttttcaa gtgtgtatcc cttatactgt aagacctcct cctaggggag agtcaacgga    225060
     tttgcaaaat ctttctaaag ccttatgaca gttattcatt tgcgggaaca agcatgtcga    225120
     tatgctgtgg caggacctga atgactgcgg gtgtatgtgt ataaacttct ccatccatat    225180
     ccgccttttt ggcagtgtct gtttcaatct cgatacggga agcctggaca taggacaact    225240
     ctccagtaaa acgatcaatt gagccttgtt ccatgctcat cagctcccgc agcgcggtga    225300
     ggttggtatt gcggcatatg agaacatcaa gtaacccgtc ttcaatactg gcatcgggca    225360
     gaggaattcg attcgttcca atgtattggc cattcatcac aagcagcata acggcttctt    225420
     ctttaatttc ttctccatca atttttaatg tcatcggaaa cgatgcagca gatgagacgg    225480
     ttcgcaaggc acttgtaaaa tagctgattt ttcccaataa tgctttttcc gtttcgttga    225540
     tttgattcga cgtttctgca attaagccga tcccccagaa attcaaaaaa taacggtcat    225600
     tcatctgaca tacgtctacg ctggtttttt ttcccgccat aagtgcttcc gcggcctttg    225660
     caagattttg agggatgcca agcactcttg aaaagtcgtt gctcgtgccg ccgggcaaaa    225720
     ttccgacagc gggttttctt tctagagcgc tgatagcatt tatgcattga tggatcgtgc    225780
     cgtcgccgcc gagaatgaag acggtgtcga cagaatcatc aatggatcgg caaaaatgat    225840
     acgcatgatc ctttttcttt gtctgtttaa taatcacctc atctaaatgg tgagataaaa    225900
     ccggcaccac agcaccaagt gctttttcta tatttttgtt ggcggcattt ccgttatgaa    225960
     tcagtaacgc tttccggtgg ctcatataca actgctcctt tattttcctt ctggttatat    226020
     aatccccttt ttctgtaagc agtaaacgaa gaggccaaaa aaagtgcacg gcgaagcaaa    226080
     gtcatttgcc gatatggacg tttccttgct atcataagaa cagatgatga aaaaggagag    226140
     gtcttcattg aacatggact ttaatttatt tatgaatgat attgtccgcc aagcgagaca    226200
     agaaataaca gctgccggat acaccgagct taaaacagcc gaagaggtgg atgaggcact    226260
     tacgaaaaaa ggaacgacgc tcgtcatggt aaactctgtt tgcggatgcg ccggaggaat    226320
     tgcaagaccg gcagcctacc attccgttca ctatgataaa agacctgatc agctcgtcac    226380
     cgtttttgcc ggacaggata aagaagcgac agcgcgtgcg cgtgactatt ttgaaggtta    226440
     tccaccatct tctccgtcct ttgcgatttt gaaagacgga aagatcatga aaatggtaga    226500
     gcgtcatgaa attgaaggcc atgagccgat ggctgtagtg gcaaagctgc aggaagcctt    226560
     tgaagaatat tgtgaagaag tataaagacg aacaacccgg atgctcaaag cagcccgggt    226620
     ttttttgtgc ataaatttcc aaggatatat gaataaatat taagggatta ttcaatcgga    226680
     ttgtacagcg atttaatttt tatctagtaa tatcagaaga gatcactgga aagataagcc    226740
     taaagataat ttttaaaaat agtattgcat aaaaatgaga aactgtttaa aatacaaatt    226800
     aacgaataaa tattcaaata caccaaaagt aatgaatacg ggggaaatgg atcatgaaaa    226860
     aatggctctt attacttgtg gctgcttgca tcacctttgc attaactgcg tgcggctcaa    226920
     gcaattcagg ttcagaaagc ggaaagaaaa aattaattat gggtacttcg gcggattaca    226980
     aaccgtttga atataaagaa ggagataata ttgtcggctt tgatgtagag ctggcaaaag    227040
     ctctggcaaa gaaggcaggc tatgaaattg aagtgcagga tatggacttc aacagcttaa    227100
     ttacagcgct taaatcaaaa caggtggatc tcgttctgtc aggaatgaca ccaacgcctg    227160
     agcgtaaaaa acaagttgat ttttccgatg tgtattacac agcgaaccat atgattgtca    227220
     gcaaaaaaga cagcggcatt caatctttga aagacctgaa aggaaaaaca gttggcgttc    227280
     agcttggctc tattcaggaa gagaagggga aagagctttc tccggaatat ggttttaaaa    227340
     cagaagaccg caacagaatt tctgatttgg tgcaggaaat caaatctgac cgcttcgatg    227400
     ccgcgattat tgaagacatt gttgcagaag ggtatttcaa atcaaatgat gacctgcaag    227460
     gctttgtgat tcctgatgcg aaagcggaag aagccggttc agcaattgct ttcagaaagg    227520
     acagtgaact gacagacaaa ttcaataaag cgctcaagga aatggaagat aacggagagc    227580
     ttgagaaatt gaagaaaaaa tggttcactg gcgagaagta aaaaaaagcg gctcaacttt    227640
     ttcgttgagc ctttttattg aataggaaac ttttttcctg taagaaaagg agacaaaggc    227700
     tatgaatttg gatttttcag caacgatccc ccaaattcct tttatattag aaggcttggc    227760
     aattacatta aaaattgttg ttgtatctgc tattatcgga cttatactcg gtattgtgct    227820
     aagcttatgc aagatcagca cattccgccc gtttatctgg atcgctgatt tttatacatc    227880
     agtgttccga ggcacgcctt tagtgctgca gcttatgatt gtctattttg gccttcctca    227940
     gctgctcgga tttcaaattg accagttttg ggctgcggtt gtcgcattgt ctttgaattc    228000
     cgccgcttat gtatcggaaa ttatcagagc cggaatcaat gccattgata aagggcaaaa    228060
     agaagctgct gttgcactcg gtgtcccgta tggaaaaatg atgaaggatc tgctgctgcc    228120
     gcaggccttc aaaaatatat cacctgcaat tgtgaatgaa ttaattacgt taacaaaaga    228180
     atcggcgatc gtcaccgtca tcgggcttgg tgatgtcatg agacgcgcat atcaagctgg    228240
     cgccgccact tacaattacc ttgagccgct cattatcgcg ggattgattt attatgtgct    228300
     tgtcctgatt ttaacgttta tcggcaaggc tgtagaaagg aagctgaaat ccaatgatta    228360
     aggttgaaaa gctgtcaaaa tcatttggga aacacgaagt attaaaaaac atttcaacaa    228420
     caatcgctga gggtgaggtt gttgccgtga tcggtccttc aggctcaggc aaatcaacgt    228480
     tcttacgctg tttaaacctg ttggaaaagc ctaacggcgg aaccattaca ataaaagaca    228540
     cagagattac gaagccgaaa accaacacat taaaggtccg ggaaaacatc gggatggttt    228600
     ttcagcattt tcatctcttt ccgcacaaaa cggttctcga aaacatcatg tacgcgcctg    228660
     tcaatgtaaa aaaagaatca aaacaggctg cacaggagaa agctgaggac ctgctccgca    228720
     aagtcggttt gtttgaaaag cgaaatgact atccaaaccg tttgtctggc ggacaaaaac    228780
     agcgtgtcgc gattgccagg gctcttgcga tgaatccgga catcatgctg tttgacgagc    228840
     cgacctccgc ccttgatcca gagatggtca aagaagtgct acaggtgatg aaagagctgg    228900
     tcgaaaccgg catgaccatg gtgattgtca cacatgaaat gggcttcgca aaagaagtgg    228960
     cagaccgtgt gctgtttatg gaccaaggaa tgattgtcga agacggcaat ccgaaggaat    229020
     tttttatgtc gccaaaatcc aaaagagcgc aggacttttt agagaaaata ttatagaata    229080
     taaaaaagaa gaaggctggc cgcctcttct tttttattga agaaacaaat agaaatggag    229140
     tccgacatgt ttaaaattgg ttaccgcaca ataaagaccg cgcttggaac agctttggct    229200
     atttatataa gccagttatt gcatttgcaa aacttcgcat cagcaggaat catcaccatt    229260
     ttgtgcatac aaatcacaca aaaacggtcg cttcaggcct catgggcccg cttttgggca    229320
     tgctgtctgg caattgcttt ttcttatctc tttttcgagc ttattggcta ccacccgttt    229380
     gtgatcggag cgcttctttt gatattcatt ccgataacgg ttctgttaaa aattaacgag    229440
     ggtatcgtca ccagttctgt tattatcctt catttataca tgtccggcgg cattacgcct    229500
     actttcatct ggaatgaagt tcagctgatt acggttggca tcggcgtcgc tctattgatg    229560
     aacttgtata tgcctagtct tgaccggaaa ctgattgcct accgcaaaaa gatagaggat    229620
     aactttgctg tcatttttgc agaaatcgaa cggtatttgt taactggtga gcaagattgg    229680
     tcaggaaaag aaattccgga aacgcaccag ctcattacgg aggctaaaaa cctggcatat    229740
     cgagatgtgc aaaaccacat tttgcgttat gaaaatctgc attatcatta ttttaaaatg    229800
     agagaaaagc aatttgaaat tatcgaacgc cttctcccta aagtgacatc gatctccatc    229860
     acggtagatc agggaaaaat gatcgctgaa tttattcatg atttgcggga ggcgatacac    229920
     cctgggaata cagcatacaa atttctgaaa agacttgctg acatgagaaa agaatttgag    229980
     gagatgccgc ttcctgcgac tagagaggaa tttgaagcga gggccgctct cttccatctt    230040
     ctcggcgaaa tggaacaata tttagtgatt aaaagttatt ttaaaggaat aaaagcgcaa    230100
     aaatcactcg gatgattcgc atgagctctt ccttcattgg tcaacctaat gaaaaaggag    230160
     gagcttatgc gttttttctt atgttcgatt ttcatgatga tttcaccgat ttggccgctc    230220
     ggcgaaaatc cgctgccggg tgatccgtat gttattgtca acaagcgaac aaatgaactt    230280
     gctgttatcc tcgacaacaa agtagaaggc gtgtatagtg tggcgactgg aaaaacagat    230340
     gatttgacgc ctgaaggaga gttttcggta acggtaaaag cggaaaatcc ttactacaga    230400
     aagaaaaata ttgaaggggg atctcctgat aacccgcttg gggcaagatg gatcggattt    230460
     gacgcgaaag gaacggacgg gcggatttat ggaattcatg ggacaaaccg agaggaatca    230520
     gtaggaaaat ttgtgtctaa cggctgtata cgtatgcata acgatgaggt tgttcatttg    230580
     tttcaaacga taccagtagg aacgagagtg ctgatcacgg acgacaaccg ctcttttgag    230640
     gagattgcca tcgagcataa agctctgata aaaaagcagg atattcccat tgaataaggc    230700
     gcctgctttt ttatcgttat agaaacatga cgattcctga gagtacagtt gaaagaataa    230760
     aaactcccaa aatcacgatc aaaacgcttt tcatcagttt ttgagacatg attttctctc    230820
     cttaaacaat ctgtctatat tttagcgtgt tttgaatggg cggacaagcg atatctatta    230880
     gcgaaagcag ggatgaaaat gaacaggctt gaccatatcg ggatagccgt ttttccgata    230940
     aaagatgcaa gaagctttta tgaaaatgta ttggggcttg catttcttca tcaagaaacg    231000
     gttgaagagc aaaaggtgaa tgttgctttt tttcaagctg gtagcgtcaa acttgggctg    231060
     atagagccgt tgacagctga cagccccgtc catttatttt tggagaagaa agggcaggga    231120
     ctgcatcata ttgcgttttt gtgcaactgc ctatctgaac agcttcaagc attgtctgat    231180
     cagcatgttc aattgattga caggtttcca agacagggag cgaacgggaa aaagatcgcg    231240
     tttatttccc ctcgggaaac aaacggtgtt cttgtagagc tttgtgaacc gaaaggagac    231300
     caacacaatg agcatgaatg agcacatgga tcatttttac acgaaaccgc aagcaggcag    231360
     aagaaggcgg aggacgggaa aagctggctc agcagcggca aaagggcaag ctcactgctc    231420
     gggaaaggat catatttctt ctagatcagg acagctttat cgaattacac cccttcatgg    231480
     aaagtcaagt gttaacaaga gaacagcgca tgttagggga tggggtcgtg acagggtacg    231540
     gcacaattga cggtcgctca gtttatgtat ttgcgcaaga cttcacagtg tacggagggg    231600
     cgcttggcga aacccatgcc aggaaaatct gcgctttgat ggatctggca gcaaaaaata    231660
     aggcgccgat tatcgggctg aatgactcag gtggtgcgag aattcaagag ggtgtgttat    231720
     cattagatgg atacggtcac atattttacc gaaacgtctt atattccgga gtcattccgc    231780
     aaatatcggt tattttaggg ccgtgcgctg gaggcgctgt atattctccg gcactcacag    231840
     attttatatt tatggctgaa cagactggcc ggatgtttat taccggcccg aaggtgattg    231900
     aaaaagtgac aggggaacag gttgatgcgg agagcttagg cggagcgggg atacataatg    231960
     ccgtcagcgg aaacgcccac ttttccgggc atacggagaa ggaggttctg acaggggtga    232020
     gaaaactact gtcttatttg ccgctgaatg gccggacaac agagccgaag ccagagaaag    232080
     aggcgtccag accgttatta aaccgtcttg tccctgctga tacgacaaag ccttatgatg    232140
     ttcggaaggt gattagggag ctggctgacc cgcagtcttt ttttgagatt cagccatttt    232200
     ttgcgaagaa cattgtcatt gggtttgcaa ggctgggtga aaaagcaatc ggcatcgtgg    232260
     cgagccagcc gaagcatctg gcgggaagcc tgacgattga cgctgctgat aaagcagcaa    232320
     ggttcatccg tttttgtgac gcatttgata tcccgctgtt gactgtcgaa gatgtcccgg    232380
     ggtttctgcc gggtattcag caagagcaca acggaatcat caggcatgga gcaaaattat    232440
     tgtttgctta tgctgaagcg actgtcccaa aagtcacact catcattaga aaagcgtacg    232500
     gcggcgccta tgtggccatg aacagcaaag cgatcggagc ggaccttgtg tttgcatggc    232560
     cgaatgctga aatcgcagtg atgggtccag aaggtgcggc atcgattttg tatgaaaagg    232620
     aaatcaaagc ttcagctgac ccgcaaaaga cgaaacgcga aaaaactgct gaatacaaaa    232680
     agcaaaacgc cggcccatac aaagcggccg cttgtggaat ggtcgatgac atcattttgc    232740
     cggaagaatc aaggggaaga ctgattcaag cttttcatat gcttacacat aagacagaag    232800
     agagaccgaa aaaaaagcac ggtaacatac cgctttaata tggagggact tacaaatggt    232860
     gaatgaaaaa cgcctgctgg aagaattttt agagcttgtc caaattgact cagaaacaaa    232920
     gcacgaagct gaaatctgca aagtgctgaa acgaaaattt tctgatttag gtgtggacgt    232980
     taaagaagac gatacaatgg atatcacggg ccacggagcc ggtaacctga tttgcacgct    233040
     aaaagggaca aaacaaacag atacgatcta ttttacatct catatggaca cagttgtacc    233100
     cggaaacggc gtaaaaccag ttgtagagaa cggttacgtc aaaactgacg gcacgacgat    233160
     tttaggtgct gatgataaag cgggattggc tgcaatgttt gaggcgatta aggtgctgaa    233220
     agaagaaaat attgaacacg gcacgattga attcatcatc acagtagggg aagaatcggg    233280
     tctgatcgga gcgaaggcgc ttgaccgtcc tatgatcact gcatcctacg gctatgctct    233340
     tgattcagac ggaaaagtcg gaaatatcat tgtggccgcg ccgacacagg cgaaggtaag    233400
     agcggcaatt ttcgggaaaa ccgctcacgc cggggttgaa cctgaaaaag gcatttcagc    233460
     gattacaatc gctagcaaag ccatctcaaa aatgccattg ggccgtatcg atgaagaaac    233520
     aacagctaat atcggccggt ttgaaggcgg cacacaaaca aacattgtgt gcgacgaagt    233580
     tcatattctt gctgaagcgc gctctttagt tcctgagaaa atggaagctc aggttcaaaa    233640
     aatgaaagct gcttttgaag aggcagctgc tgatatgggc ggacgcgcag aagtcgaaat    233700
     tgaggttatg tatccgggct ttaaatatca agacggcgac caagttgttg aaatcgcgaa    233760
     aaaagcggct gctaaaatcg gacgtccaag cgagctgcaa acgagcggcg gcggaagcga    233820
     cgcgaacgta atcgctggtc atggcatccc gacggtcaat cttgctgtcg gttatgagca    233880
     aatccataca aaaaatgaaa aaatgccgat cgaagagctc gttaaaacgg cagaaatggt    233940
     tgttgccatt attgaagagg cggcaaaata aaaaaagaaa acccgagtgc gatttcccgc    234000
     atcgggtttt tttagctcca tttcctaagc ggccaaaata acacatcctg ttttttagca    234060
     taatgaagca aggggtctga ctccggcaat gtaataccgt gagcatcagt caccgtattg    234120
     actgaaattt ctgcttcggc gttttgcagc agccacggat gatgatggat gtcttcgtaa    234180
     tagagcttat tgcgataagt ggtgtagagc ctgtatcgtc tgtcagccag taatcgagcg    234240
     aatccttttc tgctgtaaaa ggcgctgaaa ttggccggta tgcggcgtgg aatgctgctt    234300
     ctttgtcatt tttccgcttg ctgacatagt caatggcatc accgtttttt tcggacttca    234360
     tatccgcgta aaaataaggc agatgaaaga atgtgcgagc gccaaggacc gccagacgat    234420
     gatcggcatc taagctaaaa aaataaatgc cgggcttgcc tttatacgtg acataggtgc    234480
     ggaggttaag ctcaggaaat gcacgcgcac cgggaatgac agggagataa cgcgccctca    234540
     ggttcgtgag cataaaggga agcatgctga tccaagcttg cccgttatat gtatctaatt    234600
     ctaaaacgga cggtaccaaa gcgcgaagga tagaaacatc aacaggccag tgagcaaata    234660
     agacatcatt ccaggtttgt ttcatgatcc agattccatc aggtacagaa atattttttt    234720
     gctgaaagcg ttccgtcaac gtataggctc ctttcggttg gaggtgagta aaggtattcc    234780
     cgatttcctt ctttttaaac gatacggcta ttttttagga tggccatttc tgcttcagcc    234840
     atgataaaca agactgtttg gcgcggtact ttgcaagtaa caaaaaacaa ccccggcttt    234900
     ttgcacgggg ttgctttttt atttcaccga ctcagtaaga gcggctgttt ttttactttt    234960
     atgatgcgtc atctgaagga cgatgttttg cactgtcaaa aacagtccgc ttgtaaacca    235020
     gtacagcgga agggctgccg gcacattaag cgagaaaatc gtcatcatca cagggaagat    235080
     gaacaccatc aattttgcgg attgctgcgc tgcagggttt tgcgggacag cggaatattt    235140
     cgcgctcagt ttttgagcga tataggcttg gacaaaatac ataatccctg cactaaggga    235200
     catgagaata tcagattgcc ctaaactgaa ccatagaaac gagtgtgacg caatttcagg    235260
     tgttgagcga atcgcgtaat aaagcccaat cataatcgga gactgaatca gcattggaag    235320
     acagcccatc gcaagcgggt tgatattatg ctcctgatac agcttcatca tttccatttg    235380
     cagctctttt tgcttttccg ggtccttcgt ctttttcaac ttaacctgga tactgtcaac    235440
     ctgaggttta ataacggcca ttttctcttg gaagatgcgc tgttttttga actgattgac    235500
     aaacaaaggc aatacaacta tacgcacaat aatggttacg aggataatag agagtccgta    235560
     ttctccgtga aacagcccgg caacaccctt aagcagagcg gaaaacggtt cgattaaata    235620
     atcgtggaaa aaacctacgt tgctgaggcc tcccacctga ttagtcgctg caaatgcagc    235680
     attgcccgag cataatacga tcaaaaagat acccatagcc aaaagttttt gatatgtttt    235740
     taacaatttt gttctcctcc tttttataaa tgcggtttat aaaagaagag aaccggcgtc    235800
     ttcctcatcg ttcacaggcg aattcatgcg gaagacttta cgtatccaag ttgtaatgcg    235860
     atgatatata ataataagaa agtctgttcg gttaatgtga aagaccgtct gatgttcatc    235920
     tgttcgtttt gatttccatt gctcgcccgc acggcactcc cgtaagagga atgcaatccc    235980
     gattgccgtt agagcaggaa gaataattgt gacaaaaatc gactaagaat aaaacgtcat    236040
     ttatcgattc cacaaacatt gtcatcacat ccattcaata gcttcatttt actatatgta    236100
     caagctgttg tctaatgacc gaaaaggaga tttgtttatg ccgggaaaga gccgaattat    236160
     tttccatatt gatatgaata gcttttatgc gtcggttgaa atggcatatg atccggctct    236220
     ccggggaaag ccggtcgcag ttgccggaaa cgtaaaggag cgaaagggca ttgtggtaac    236280
     atgcagctac gaagcaagag cgcgcggcgt caaaacaacg atgccggttt ggcaagcgaa    236340
     gcgccattgt cctgagctca tcgttcttcc gccgaacttt gaccgctata gaaactcttc    236400
     acgagcgatg tttaccattc ttcgtgaata tactgaccta gtggagcctg tctccatcga    236460
     cgaaggctat atggacatga ccgatacacc atacagcagc cgcgctctag agacggcaaa    236520
     agaaatccaa agcaggctgc aaaaagagct gctgctcccg tcaagcatag ggattgcacc    236580
     gaataaattt ctcgctaaga tggcgtctga tatgaaaaaa ccgcttggaa ttacgatctt    236640
     aagaaagagg caagtgcccg atatcctgtg gccgcttcct gttggagaga tgcacggagt    236700
     cggcaaaaag acagcggaaa aactgaaggg actcggcatc catacaatcg gagagctagc    236760
     tgcagctgat gaacactcgc tgaagcgcct gcttggcatc aacggtccgc gccttaaaaa    236820
     taaagcaaat ggcattcacc atgcgccggt tgacccggag cgcatttacg aatttaaaag    236880
     cgtcggcaac tcatcgacac tttcccatga ttccagtgat gaagaagagc tgttaggcgt    236940
     ttttagaaag cttgccgctt ctgtgagtga ccgtttacag cgcaaggaag tcatggcttc    237000
     gaagcttttt attatgatta gatatgcgga ttggagaacc atcacaagaa gcactacgct    237060
     gagaaacccg attgatcaaa aaaatgacat tttgaaagaa gcggagcacc tcttttttaa    237120
     acattggaaa aaaaatcctg tcaggctgct tggcattacc ggaacggatt tagtagaaaa    237180
     agagcaggcc tataaacagc tcgatttgtt cagctttaat gaagatgcga aggatgagcc    237240
     cattcagcag atgatggaaa agctgaataa aaagtacggt accaaactga tcagaaaagg    237300
     ggcaacgtta aaaaaagagg agagcaaaac aaagggaaca agctttaata aagatttttt    237360
     tcaagatgaa aagaaaagct gaaacgcttg aaaaaaaggg tgaatgtatg gtaatttctt    237420
     tattataaat atcattttat tttaatttaa attttaaaat gattaaacgt ttgcagaagg    237480
     gacgttagaa tatgtcaaaa caacaaatcg gcgttatcgg acttgcggtc atgggtaaaa    237540
     atctggcttt aaatatcgaa agccggggat tttctgtttc tgtttacaac agatcaagca    237600
     gtaaaactga gggagttttt acaggaggca aaaggaaaaa atgttgttgg cacttacagc    237660
     attgaagaat ttgtccaatc cttggaaaca ccgcgcaaaa tcttattaat ggttaaagcg    237720
     ggaactgcaa cagatgcgac aattcaatct cttcttcctc atctagagaa ggatgatatt    237780
     ttaattgacg gcggtaatac atactataaa gatacacagc gccgtaacaa agaactcgct    237840
     gaaagcggca ttcattttat cggaacaggc gtttccggcg gagaagaagg agcgcttaaa    237900
     ggaccttcta tcatgcctgg cggacaaaaa gaagcacatg agcttgtaaa accgattctt    237960
     gaagccattt ctgcaaaagt tgacggagaa ccttgtacga catatatcgg tccggacggc    238020
     gccggccatt acgtaaaaat ggtgcacaac ggaattgaat acggagatat gcagctgatc    238080
     tctgaatcat atttcattct gaaacaggtg ctgggccttt ctgctgatga gcttcatgaa    238140
     gttttcgctg aatggaataa aggtgagctt gatagctacc tgattgagat tacggctgac    238200
     atcttcacaa aaaaagacga agaaacaggc aaaccgcttg ttgatgtgat tcttgataaa    238260
     gcaggccaaa aaggaacagg aaaatggaca agccaaagcg cacttgactt aggcgttccg    238320
     cttccgatta ttactgaatc tgtattcgca cgctttatct cagctatgaa ggaagagcgt    238380
     gtaaaagcga gcggacttct ttcaggacca gaagtgaagc ctgttacaga aaataaagaa    238440
     gagctgattg aagcggtcag aaaagcgttg ttcatgagta aaatctgttc atacgcgcaa    238500
     ggatttgccc aaatgaaagc tgcttctgaa gaatacaact gggatctgaa atatggtgaa    238560
     atcgctatga tcttccgcgg tggttgcatc attcgcgcgg cattccttca gaagatcaaa    238620
     gaagcttacg atcgcgagcc tgagcttgac aacctgcttc ttgacagcta tttcaagaat    238680
     attgtagaaa gctatcaagg agcgcttcgc caagtgattt cacttgcagt tgcccaaggt    238740
     gtgccggtgc catcattctc aagcgcatta gcctactatg acagctaccg cacagccgta    238800
     ctgcctgcaa acttaatcca agcacagcgc gactactttg gcgctcatac ttatgagcgt    238860
     actgacaaag aaggcatctt ccatactgaa tggatgaagt aatcaataga aacccccgaa    238920
     gctcttaagc tttgggggtt ttgttattaa ggagattgtt atacctttgt tcagcgtaaa    238980
     aaagccgaaa atgcttgtaa acattttcgg cttttttctt cttattatat gttccaccag    239040
     tgtaagccgt ctttcaccaa aagatcatca gattctttcg gtcccattga gcctgattcg    239100
     tagttaggag ataaggtttt gtttgctgcc catgtttcag aaatagagtc gacaaagctc    239160
     caagaaaggg caacttcatc ccagtgtgca aagtttgttg catcgccaag aagacagtcg    239220
     tgaattagtt tttcatatgc ttcaggggtg ttcaactcgt cattgcaatt gctgcaataa    239280
     tcgagtttga ttggctgtgc gtgtgctgct ccgccaagct ttttagcatt taagtaaagc    239340
     gtaatgcctt cgtcaggctg aatatgaatg acaagcaagt tcggattcat gttgttttca    239400
     ttaccgtagt acaggttcat cggaatgtcc ttaaattgaa cgacaatttt tgtggacttt    239460
     tctctcattc gttttccggt tctgatgtag aatggaacac cagcccatct gaagttgtcg    239520
     atcaagagct tgccggcaac aaaggtttct gtattggagt caggagcgac attatcttca    239580
     tctgtataag caggaaccgg tacaccgtca atttcaccag catgatattg tccgcgcaca    239640
     aagtattcat ccacttcgtc ttttgcaata ggacgcagtg ctctcagcac cttcactttc    239700
     tcgctgcgga tttcttctgt gttcaatttg ataggcggct ccattgcaag aagggcaacc    239760
     atctgcataa tatggttttg caccatgtcg cgaagggcgc ctgatttttc gtaatatctt    239820
     gcgcggtctt caacgcctag tgattcgcta gatgtgattt gaatgtttga aatgtagcgg    239880
     tttgtccaaa gcggttcgaa aatcgcattg gcaaatcgaa tcacttcaat gttctgaacc    239940
     atttgtttgc ctagataatg gtcgattctg taaatttgat cttccgtaaa tgcttcgcgg    240000
     atttctttat tcaatgcctg tgcgcttggc agatcatggc cgaacggttt ttcgatgaca    240060
     aggcgggacc agccggttgt agctgttaca ccctctgatt ttaatgtttt tgcaatcgtt    240120
     ccgaagaatt caggagccat tgccaagtag aacattctgt tgttaggaat ttgatatgta    240180
     tcttccagct ggttaagcaa tacgtttagc tcttgataag aaccagggtt tgtcacgtca    240240
     aacgggtgat agtaaaaatg agacgtgaaa tcatctatat gcttatctgc agatgaggaa    240300
     atggatgttt taacagtttg gcgaagatcc tcattagacc aaggtcttct tccaactcct    240360
     accactgcaa actcttctcc gatttgtccg ttttgatata aacggtgaat agacggatac    240420
     aattttcgtt ttgctaaatc tccagttgca ccgaatatga caattactgc ttttggttgt    240480
     tggtttgttt tcactaaaag tacctcactt tattcgaagc tttattttag tacaccccgt    240540
     atatttcctt cattttaaat ctaaaattca acgaaagcaa acatttaagc ccttttttaa    240600
     gcagaatgct gaaaaaatgt ttctagcacg aaaggattgt tcttttcaga ggcaagattc    240660
     acattttccg cttgatcctg tattcttgta ggtatctggt tctagtagga ggaaggaaac    240720
     gtggaattac tttttttagg gacgggagcc ggcatccccg ccaaggcgag aaatgtaacg    240780
     tcggtggcat taaaattgct tgaagaaagg cgttcggtat ggctttttga ctgcggggaa    240840
     gccacacagc atcaaatttt acatacaacg attaaacctc gtaaaataga gaaaatcttt    240900
     attacacaca tgcacggcga tcatgtatac ggacttccgg ggcttctggg gagccgttcc    240960
     tttcaaggcg gagaggacga gctgacagtg tacggaccta aagggatcaa ggcgtttatt    241020
     gaaacaagcc ttgccgtcac gaaaacccat ttgacatatc cgcttgcgat ccaggaaatt    241080
     gaagaaggaa tcgtgtttga ggacgatcag tttattgtca cagcggtatc tgttattcat    241140
     ggagtggaag ccttcgggta ccgtgtgcag gaaaaagacg taccgggttc cttgaaggct    241200
     gacgtattaa aagaaatgaa catcccgccc ggacctgtat atcagaaaat caaaaaaggc    241260
     gaaacggtaa cgcttgaaga cggacgaatc atcaatggga atgattttct ggagcctcct    241320
     aaaaagggaa gatctgttgt gttctccggt gatacgagag taagtgacaa actaaaagag    241380
     cttgcgaggg attgtgatgt gcttgttcat gaagcaacct ttgctaagga agaccgtaaa    241440
     cttgcttatg attattatca cagtacaacg gaacaagcgg ctgtaacagc gaaagaagca    241500
     agagcgaagc agctcatttt aacccatatc agcgcaagat atcagggaga tgcttctttg    241560
     gagcttcaaa aagaagcggt tgacgttttc cccaatagcg tggcggcata tgatttctta    241620
     gaggtaaacg tcccgcgagg ctgaaggcgg agctcttatt tgacaatttg tgatgacgtt    241680
     gtataataaa acgtaatcat tacgttttat aaggagatgt taattatgag agtaaatgtt    241740
     actttagctt tgcactgaaa cgggagaccg aaattacatc acaacaaaaa ataaacgcac    241800
     caatccagac cgtttggagc tgaaaaaata ttcaccgcgt ttaaagaaat atacccttca    241860
     ccgtgaaaca aaataatata aaagaccggg aatcccttac ggcccggtct ttttttacgt    241920
     taattgactg cctggtaaag aggagcggcc tgctggcacg ctgcgcacca tacgtcataa    241980
     atagccaagt gaacgatatg aggttcatca tgatggatgt tgtgggagct gtttttagct    242040
     tgaatccagc cgctttggtt agatagagac aatatgctgc tgtgcaagtt ttgccactcc    242100
     tgttcagcag cgaatttctc agtccgttct cctgatgaca acacaagaag aggcatgttt    242160
     cctaagtgga cttgccgctt tttgagctcc tgcagacttt ttgaaaactc tgcatgtgtg    242220
     ccctcaagca tcatctttct cgtatgtgat ttgtgcattt cttcgggtat aaaggtaaag    242280
     ctggcgcaat cgcctaaagc tgggtcaaga aggaccatgc cgataatatc atgcttgttt    242340
     ttgcaggccc ataaaccggt gatgacagct ccgtatgagt gtgaaacagc caaataagga    242400
     ggttttacat cagctgcttt aagcaaactc tccaattctt tcacttgttg atcagctgtt    242460
     cgtttagctc tgctttgccc gctttttcct atgcctgccc gatcatatgt gaaaatgcca    242520
     aattcatcat caatgtccgc cattaatggt ttccacgtct cagaagaagt accatagccg    242580
     gcctcaaaga caatcgttac accgcttgat cctttccggt gctgtgtatg aaacgcacat    242640
     ccgtcaattg tatatgtctt ttccatccaa gctgatttca ttggagtcat ctcctctaat    242700
     tggttctact agggagacgg agaaccttag ccgatcgttt ctctaaaaat aaaaaaagag    242760
     atatcctcta caggatatct cttatgggca ttaccagcct ctttcgtatt gaacaggggc    242820
     cggaatctct gtattgagct gtttcgcagc agttcttgca aaaaatggat cccgcaaaag    242880
     ctctctgccg ataaagatga ggtcggcacg tccgttttgc agaatttctt cagccattga    242940
     accgtctgta atcatgccga cggcaccagt agccatgtcc gcctgttcac ggattttctc    243000
     agcgaagctg acctgatagc cagggaatac gttaatgtct gcgtgaacaa gggcgcctga    243060
     gctgcagtca attaagtcaa caccctgctc cttcatccat tttgcaaaac cgatgtgatc    243120
     ggcaatgtct aagcctttat cagtgtagtc agaagcagat acacggacaa ataaaggacc    243180
     gtcccatact tgtttgactt catcaatgat ctctctcaag aaacgatagc ggttttcagg    243240
     tgagccgcca tattcatctg ttcgatggtt ggaaagcgga gacaaaaatt catgaattaa    243300
     atatccgtgc gccgcatgaa tttcaatcac atcaaagccg gcttcttttg cgcgggcagc    243360
     cgcttgcttg aactcctgga ccgtttcttt tactttttct gctgacattt ctacaggtgt    243420
     tgctgattgt tcgtcaaacg caatcgccga tggagcgaag atatctcctt caagctcagc    243480
     tttacgtccg gcatgggcaa gctgaatgcc gatttttgaa ccttgttctt tgacctgctc    243540
     agtcagtttt gcaaagcctt caatatgctc gtcgctccaa atgcctaagt cttggtcagt    243600
     gattcgtcct tgagggttaa ccgctgacgc ctctacaata atcagtccga cctggccgat    243660
     tgcgcgcgat atgtaatgtg ccatgtggaa cggtgttaat tttccgtcct tttcatgaga    243720
     agaatacatg cacattggcg acatgacaat gcggtttttt aacgtcatat ctttaattgt    243780
     aataggtgta aataattttc tggccatttc tttcgcctcc cgtaaggttt ttagagattg    243840
     attatatcaa gtcatttctt tcccgtcata taaactgctc aaatgaaccg cttttgtcaa    243900
     acatttctgt ataatagacg agaaatcagt ttatttttca gtatagaagc atttttattc    243960
     ataggagggg cggaatcaat gaattggcag acgaaggacg aattgctggc acttttaact    244020
     tctcttgtgc aatacgaaag catcaccggt tcaaagggcg aggtagcgct tgcagagtat    244080
     ctttatttta ttttgaagga caagccctat tttcaaaagc accctgatga tgtaacacct    244140
     catccgatgg acgatggcag atcttttctt acggctctag tcaaaaagaa gaatgtcaaa    244200
     aagacagtcc ttctgctgag tcattttgat gtcgttgaca tagaagatta cggcgaattt    244260
     aaacatatgg cttgcaagcc tgctgagctt ttgagctcct ttttagagaa aaaagagctg    244320
     ctcccggaac gtgtgagaag agatgccgaa agcggagact ggctgttcgg aagagggacg    244380
     atggatatga aagcggggct ttgtattcaa ctgtcgatgc tggagagggc aatgaacggg    244440
     cattttgagg gcaatctgct gttgataacg gttccggacg aggaagtgaa ttcaagaggc    244500
     atgattgaag cggttcctgc attgaaggag atggagaaaa agcatgatat cacattaacc    244560
     gcttgcctga atgccgaacc gatgtttgaa aaatttcccg gcgatcagca gcaatatttt    244620
     tatacaggaa gcattggcaa ggtgcttgcg ggttttttct gcaaggggat tgagacacat    244680
     gttggagagc cgttttcagg tctaaacgca aatttaatgg tatctgagat taaccgtttg    244740
     cttgaactga atgctgatta ttgcgaaaag gttgatggcg aggtcactcc gccgccggta    244800
     aacttaatgc aaaaggactt gaaagaggca tattcagtcc agacaccgca tacagccgtc    244860
     acattattta atgtgctgtc aatgaaacgc tcagctagtg agctgcatca gatgctgctt    244920
     aaaacagcag aacaggcggc ggaggaaatc atgtcgaacg ttcggaagaa aacacaggat    244980
     tttcaacaat ttgagccatt tcagccgatt gagcgggacg tcactgtttt gacatttgat    245040
     gagctggtct cgcgtgcaaa aaagcgtgcg gggatctcgg aaacagagcg ggctctaaat    245100
     tatgcctttg ctaacagggg ggagcttgga gacagggatt tttcgacgaa aattgtttct    245160
     gagcttgctt cgctttgtaa ggaggatgcg ccgctcatcg ttctgtttta tagtccgccg    245220
     ctttatccag ctgtttcttc aaaggatgat caattgatca gaaatacagc agatcagata    245280
     aagcattatg cggctgagcg atacggcatt gcattacggg aggttcagta cttccccgga    245340
     ctttcggact tgagttatct tcagctggaa aaacaggagg ttgatgcata cacaagcaat    245400
     atgccgctct ttaacagagg gtattcattg ccaagcggta aaaatcaggc tttatatgtc    245460
     ccagttttaa atgtcggtcc ggctggtaaa gacccgcata aatggacgga aagattgtat    245520
     atgccttatt cctttgaagt gcttcccgat ttgctttcat ttacgatctc cgcgctatta    245580
     aagcaatcag aatctgccgg ccagctgctg cgggaaaaat aaaaaacaga aggcactgtg    245640
     ccttctgttt ttgtccttac atctaagaat gtctctctaa ggcggcaccg gcaaactgtt    245700
     ctttgatttc tgcgctccgt ttagctgttt cttcaataca gtgaataatt gcttcttcaa    245760
     agcgggagtc ctgtaaagcg cgaagacctg cctctgtagt gcccccagga ctggtgattt    245820
     ctttacgcag cttttccggc tgtttgccgc tttggaggag catatctgtt gcccctgcca    245880
     ttgtctgcaa aatgagtgct tttgccgttt ctttatctaa tcctactttt tgtgctgctt    245940
     tttccatcgc ctcaatataa cgatacacat aggccgggcc gctgcctgcg attgcagtga    246000
     cagcgtcaag atgccgctcc tcaaccagtg ttgcatcacc gattgtttcc aatagagctt    246060
     ttgcggcaat aatatcattc ttgcttgctt ccgtgcttac ggaaaatccg gttgctgatt    246120
     ttctgattgc cgctgatgta ttaggcatga cgcgaatgac cgcgagcttt ctgccaaaat    246180
     aatgctgaat ggtttcgatg gtaaggcctg caagtactga aatgacaagc tggtccttga    246240
     tatacggccg gatgctgtcg atgctttccg ccgcgtcttt cggtttgaaa gcgaggataa    246300
     tgatatcggt gtgagtgaaa aactcatttt tatctctgca tggacgcacg ctgtacgttt    246360
     cctttaattc aatcagacgc tcgtcatttg agcgatttgt aatatagata tgttctggtt    246420
     ttgtgatgcc gctttgcaaa atgccgttga tcattgcttc tgccattgac ccggcgccga    246480
     caaatcctat ctttttcatt gatatcctcc ttctattaga acaacaaaaa accttttcat    246540
     cacgtaaagg acgaaaaggt tcgcggtacc accctcatta gcacaaattg tgctcagctc    246600
     aaatccccgt aacgcgggaa acgtttaggt tttcctaacc gcgacttgag ggcaggttct    246660
     acaaacaagc gggccgcaac acctttcagc cgggggtatc gctctcttag gccattgcct    246720
     tgtatactat tcctcgtcat agcgttccaa tggttctcgt tttagtttgt tgttcattat    246780
     gcaatggcgg acaagctaat gtcaatagct ttttcaaaaa ggtttgttct cattctgcaa    246840
     taatgacaca agaccgagaa aaagctaaaa tatgaataat gaatgaagac aaggagcgaa    246900
     aggatgacaa ctgaagatgt aattgcgatc cgcgtcccga caccgtttgc tgtcggcgat    246960
     gttatcgttt acctcgtaaa aggtgatgcg ctgacactta tcgatgccgg gccgaataca    247020
     aaagaggctg ccagagcctt acaagagcag cttgccgctg taaatgtgaa attgtcagat    247080
     atcgagcagg ttgtactgac tcaccatcat gctgatcatg caggcttgct tgatgtcttt    247140
     tcagatgaaa tcgaagtgat tgggcataca ttcaacgaac cttatatcag ccaaaatcaa    247200
     gcctttatgg attggcaaaa acgttttttt caaaagctgc tgcctgaatt aggcgttcca    247260
     tttgatacgg ggaaggcgga aaagctgatt cgatcagcgt acgcattttc ctgtacgaga    247320
     tctctgacaa aatcaatcag agaaggtatg ggcatagatg ggcttgaggg ctggtctgtg    247380
     ttggagatgc ctggacatgc tgaatcgcat attgttctgt tccatgaaaa aagcggaagg    247440
     atgcttggcg gcgatctact gctggcaaac agctcgtcta atccgatttt ggaagcgccg    247500
     aaagcgggag acgtcaggtc aaagccttta gtggattatc agcggtcatt gcgaaggctg    247560
     tctcaacttg atccaacaat cgtatttcct ggtcacggcg agcctatcac cagtgtacaa    247620
     gcgctgattg agaagcgttt tgacaagcag aggaacagga cggaggatgt gcgtcgcatg    247680
     ctggatgaaa agccgatgac cgcttttcag gtctgtcagc agctttttcc tgctgtatat    247740
     gaaaaggaat tgtttttaac gatgtcagaa acggcaggtc accttgatgt gttggaggct    247800
     gaagaagcca tcacgtcata ttgggaagga aataccgtat actttaaaac aatgaagagg    247860
     tgaaatgggt gaaacatata gcgggaaaaa ggatttggat aaccggcgct tcaggagggc    247920
     ttggagaaag aatcgcatac ttatgcgcgg ctgaaggagc ccatgtcctg ctgtcggcta    247980
     gacgcgagga tcgtttgata gaaatcaaaa ggaaaataac cgaggaatgg agcggacagt    248040
     gtgagatttt tcctctggat gtcggccgcc tagaggatat cgcccgggtc cgcgatcaga    248100
     tcggctcgat tgatgtactg attaacaatg caggcttcgg tatatttgaa acggttttag    248160
     actctacatt ggatgacatg aaagcgatgt ttgatgtgaa tgtcttcggc ctgatcgcct    248220
     gtacaaaagc ggtgcttccg caaatgcttg agcaaaaaaa gggacatatc atcaatatcg    248280
     cctctcaagc ggggaaaatc gccacaccga agtctagcct gtattccgcg accaaacatg    248340
     ccgtgttagg ttactcaaac gctttgcgga tggagctttc gggaaccggc atttatgtga    248400
     caacagtcaa cccgggcccg attcagacgg actttttttc cattgctgat aaaggcgggg    248460
     actacgccaa aaatgtcggc cgctggatgc ttgatcctga tgacgtggca gctcaaatta    248520
     cagctgcaat ttttacgaaa aagcgggaga tcaatcttcc gcgtttaatg aatgccggca    248580
     ctaagctgta tcagctgttt ccagctcttg tagaaaagct ggcaggacgc gcgctcatga    248640
     aaaaataatg atagaactgc ctgtggtgga gtggcttgtt tctcacgggg cagtttttga    248700
     tagtggaagg gagagattgt tgaatgtcag ttcattcaga agtccttcat gctctgctta    248760
     aagatccgtt tattcagaaa ctgattgatg cagagcctgt attctgggca aattcaggca    248820
     agaaagaggg gccattaccc cgtgcagatg agtgggcaac cgagatagcg gaagcggaaa    248880
     aaagaatgca gcggtttgca ccttacattg ccgaggtgtt tcctgagacg aaaggcgcta    248940
     aaggaatcat cgagtctccg ctttttgagg tgcagcatat gaagggaaag ctggaagcgg    249000
     catatcagca gccatttccc ggaagatggc ttttaaagtg cgaccatgag cttccgattt    249060
     caggatcgat taaagcgagg ggcgggattt atgaagtgtt aaagtatgct gaaaatctcg    249120
     cgcttcaaga aggaatgctt caggaaaccg atgattaccg catcttacag gaagagcggt    249180
     ttaccgggtt tttctcccgc tattcgattg ctgtcggttc gacaggaaat ctaggtttaa    249240
     gcatcggcat catcggcgcg gcactcgggt ttcgcgtgac agtgcatatg tccgccgatg    249300
     ctaagcagtg gaaaaaggat ctcctccgcc aaaagggagt cactgttatg gagtacgaaa    249360
     cagattacag tgaagcggtg aacgaaggga gacggcaggc ggaacaagat ccattctgtt    249420
     attttattga tgatgaacat tctcgtcagc tgttcttagg atatgctgtt gctgcaagcc    249480
     gattaaaaac acagcttgac tgtatgaata taaagccaag tcttgagacg cccttgtttg    249540
     tgtatctgcc gtgcggagtc ggcggaggac cgggcggtgt agcatttggg ctgaagcttt    249600
     tatacggaga tgatgttcat gtgtttttcg cagaaccaac tcattcacct tgtatgctgt    249660
     tagggcttta ttcaggactt cacgagaaga tctccgtcca ggatatcggc ctggataatc    249720
     agacggctgc tgacggactt gccgtaggga ggccgtcagg atttgtcggc aagctgattg    249780
     aaccgcttct gagcggctgt tatacggtag aggacaatac gctttatact ttgcttcata    249840
     tgctggctgt atctgaagat aaatatttag agccctctgc tcttgctggc atgttcgggc    249900
     cggttcagct tttttcgaca gaagagggaa ggcgctatgc tcagaaatat aagatggaac    249960
     atgccgtaca tgtcgtctgg ggaacgggag gaagcatggt tccaaaagat gaaatggctg    250020
     cgtataaccg aatcggtgct gatttgctaa aaaaacgaaa tggaaaataa gcagacagtg    250080
     aaaaggtttt ccgttacaat ctttgtaagg gttttaacct acagagagtc aggtgtaaac    250140
     agtgaaaaat aaagaactta acctacatac tttatataca cagcacaatc gggagtcttg    250200
     gtctggtttt ggggggcatt tgtcgattgc tgtatctgaa gaagaggcaa aagctgtgga    250260
     aggattgaat gattatctat ctgttgaaga agtggagacg atctatattc cgcttgttcg    250320
     cttgcttcat ttacatgtca agtctgcggc tgaacgcaat aagcatgtca atgttttttt    250380
     gaagcaccca cattcagcca aaattccgtt tattatcggc attgccggca gtgtcgcagt    250440
     cggaaaaagc acgacggcgc ggatcttgca gaagctgctt tcgcgtttgc ctgaccgtcc    250500
     aaaagtgagc cttatcacga cagatggttt tttatttcct actgccgagc tgaaaaagaa    250560
     aaatatgatg tcaagaaaag gatttcctga aagctatgat gtaaaggcgc tgctcgaatt    250620
     tttgaatgac ttaaaatcag gaaaggacag cgtaaaggcc ccggtgtatt cccatctaac    250680
     ctatgaccgc gaggaaggtg tgttcgaggt tgtagaacag gcggatattg tgattattga    250740
     aggcattaat gttcttcagt cgcccacctt ggaggatgac cgggaaaacc cgcgtatttt    250800
     tgtttccgat ttctttgatt tttcgattta tgtggatgcg gaggaaagcc ggattttcac    250860
     ttggtattta gagcgttttc gcctgcttcg ggaaacagct tttcaaaatc ctgattcata    250920
     ttttcataaa tttaaagact tgtccgatca ggaggctgac gagatggcag cctcgatttg    250980
     ggagagtgtc aaccggccga atttatatga aaatattttg ccaactaaat tcaggtcaga    251040
     tctcattttg cgtaagggag acgggcataa ggtcgaggaa gtgttggtaa ggagggtatg    251100
     aaatgtgcat catattgaac tgtatgtctc tgatttggag gcgtctaggc ggttttgggg    251160
     ctggttctta aaagaacttg gttataaaga gtatcaaaaa tggagctcag gcatcagctg    251220
     gaagaaagat cgtttttacc tagtgattgt gcaggcgaaa gagccatttc tagagccgga    251280
     ataccataga tgccgagtcg gtctgaacca tctcgcattt catgctgaat ccaagcttca    251340
     agtcgatcag atgactgaaa aattgacggc aaaaggctat cgtgtgttgt accgagacag    251400
     gcatcctttt gccggaggag acgggcatta tgcagtcttt tgtgaggatc cagaccggat    251460
     taaggtagag ctcgttgccc caagctgtta atcgtgatct tcggacaggc tgttcagctt    251520
     tttctcaatg cgatccagct gcgcttttcg gtttttcgca tacttgaagc ctgtaacagc    251580
     cgcaaagacg acagcggcaa atataataaa tacaaacagc tgaaacatca catcacctat    251640
     attcatgttc ttcacctcat gtttgcggga gagattcatt ctcttccgtt ttttatttaa    251700
     agcggctttt ccagacggga acggtgtttt gtggtctcca ttttcatttg ccgataggcg    251760
     aacgctaaaa atggcaggcc gagcagggta atgccgctca ggacagaaaa aatataaatc    251820
     ggccggccag cgccaaacag gtctatacat atccccccga cccaagggcc gatgacgttt    251880
     ccgagctgtg gaaaaccgat tgccccgaaa taagtgcctt ttaatcctgg ttttgcaatc    251940
     tggtctacat acaaatccat catagagaat aaaagcactt cgccgattgt aaatgtgatg    252000
     acaatcatca caattgatgg aacaccgtgt gatacggtga aaatggccat gctgatgcta    252060
     accatcacat taccgagcat cagagaacaa agcggcgaaa accgttttgc aaaatggaca    252120
     atgggaaatt gcgtcgccaa cacaacgatt gcgtttaatg tcagcatcag cccatacagc    252180
     ttcgttccat tgccgatcaa ggggttctgc gccatatact gagggaatgt ggaactgaat    252240
     tgtgagtagc cgaaggtgca tagcgtaatg ccgaccaaag caatggtaaa aagataatcc    252300
     ttttgcgtga ccataaacgc ttcccgcacg ctcatatttc gggactgggc tggtgctgat    252360
     aaggatggat gttttttaaa ttggagggca agcacaattc cgtatagtcc gtaaatgact    252420
     gcaggcacca aaaagggcgt agtcgattgc gatgagccga aatataggcc aagcacaggt    252480
     ccgaagacaa cgccgatatt aatagccgca tagcgtaaat taaaaactag cagtctcgtt    252540
     ttttcttctg tcatatcaga caacaaggcc tttgaagcgg gctcaaacag tgatttgcaa    252600
     agaccgttta atgcgtttac tacaaaaaac acccagagat tagatgctgc cgcaaagcct    252660
     gcaaatacca gcatccatcc gaaaatcgat acaagcatca tgttttttct gccgaattta    252720
     tctgagatat atccgccgta aaagcttgcg aggatgccga ctgatgagct cgcggcgatg    252780
     accagccctg cataggaagc tgatgcgcct tggacggctg tcaaataaat cgctaaaaaa    252840
     ggaatgctca tcgatgttgc cattctgccg aaaatggttc cgattataat tgtccagctg    252900
     atcgggtgga tatctttcca tttcttcatg aattatattc tctcctgtat gtatgatctt    252960
     tctctatcat atatgaaaaa atttccttct ccaatagatc gttcaaaata tttcgttatt    253020
     gacatgtagt atgcctgatt gtatggatgg caatatacta tgcgttgagg atgcgtgtgg    253080
     ctgacggagt ttacatcttg aaagaaggaa aatgacggga tgtccgatga aaagcaaagc    253140
     gattggtcag tgagggtgtg ttagtttaag ccgccagaac gtggatcata tcggcagtga    253200
     aaccggctat gagatcaaga tgtacgctga aaaccggcat ggaccgcatg acagaacaag    253260
     agagcacatc tcttcgaaaa agtgtatacg cgtgatcatg gacagcttat tccgttttgc    253320
     gcgagcattg aggggaattt tacgccaggc catatgaatc tatggagcgt gagaaaatcc    253380
     tgcttttttt ctgtaagcct gagactgttt atttgtttca ggcggtgttt tcaaagggaa    253440
     gccgcatcag cggctgaaag aactgacagt catgcgttta agagaacagg ccttggtttg    253500
     tgacatagtc ataaatgata tcttctatat gcgcatgcaa atcctcatct ggttcttcat    253560
     tccgtctctc ttgtagagcc gctttcaggc tttgtttttc atacgggctt aacggatcta    253620
     tagcaacgtt tctgccgtat tgccgcaatg cctgtcccag cattttttcg acaaatttct    253680
     ccatcatgac tctcctatcc ttatgcttcg cttttattct actaaatgtt tttcttctct    253740
     caaacccttg gatcatattt tctgtcagac aagaatcatt taccagtata aaacgaacat    253800
     actttcgcat ataatgaaaa gcgaacataa gttcttttta gaggtgtgta tgatgaaaga    253860
     aaaagtgatt tttctcgttg acatgcaatc gttttatgca tctgtagaga aagcggaaaa    253920
     tccacatttg aaaaataggc ccgtcattgt ttcgggtgac cctgaaaaaa ggggcggagt    253980
     cgtattggct gcctgcccgc tggcgaaaca aaagggtgtg gtgaatgctt cacggctgtg    254040
     ggaggcgcag gaaaagtgtc ctgaggctgt tgtgctccgg ccgcgtatgc agcggtatat    254100
     tgatgtatca ctgcaaatta cggccattct cgaggagtat acagaccttg tggagccgta    254160
     ttccatcgat gaacagttca tggacattac aggcagccag aagctgtttg ggacgccgat    254220
     ggagatcgcg aaaagcattc agggcagaat catgcgggag atcggcgttt atgcacgggt    254280
     cggaatcggc cctaacaaag cgctggccaa aattgcgtgt gacaattttg ccaaaaagaa    254340
     taagaacggt atttttacct taacgaaaga aaatatgaaa accgaaatgt ggccgctccc    254400
     ggtgggcagc atgtttggcg tcgggagccg catgaagcat catttaaatc gaatgggcat    254460
     cagcacgatc ggcgggctcg cggcttttcc gctcgatctt ttaaaaaaga aatggggcat    254520
     taacggccac gtgctgtgga tgacggcaaa cggaatcgac tattcccctg tgtcaacttc    254580
     gtctctggac gggcaaaagg cgataggtca tggaatgact ctcccgagag actacgaaca    254640
     ctttgacaaa gaaatcaagg tcgtattgct tgagctgagt gaagaggtgt gcaggcgaag    254700
     ccgaaacgcc ggggtcatgg ggcagacagt gtcagtgagc tgccggggtg ctgattttga    254760
     ttggccgacg ggcttcaacc ggcaagtgaa gctggcagag ccgactaatt ctacgcagga    254820
     tgtatatgag gctgtacgac ggctgtttct tacattttgg gacgggaaac ccgtccgccg    254880
     cctcggtgtc aatctgtctc agctctcatc tgatgacata tggcagctca atttatttca    254940
     ggattatgca aagaaaatga gcctaggcta tgtgatggat ggcattaaaa atcgattcgg    255000
     cgatacagca atcatcaggg cggcgtcact gacagcggca ggccaggcat ttgaacgtgc    255060
     ggctaaaata ggggggcatt ataaatgaac gaccatttaa aaaggggcaa cctgctgtgg    255120
     gaagggagca ggatgtttct gccggaacat aagcaaagcc tgctggagag aaagcgactt    255180
     aaacagaagc tgcaaaagcc gatccttgac cccgataagc tggaagagat gaatcaaacg    255240
     ctttgcgccg cgatggagtt tgctcaggat atcactgtca gctgctttca ggacggtgag    255300
     attgtctgct gcaccgggaa aatctgccgg tatgaagagt ttgaaaaagc agtatggata    255360
     aaaggagacg aggatcagct ttataagctg aaacttgatc aagtgcttga tattgtgctg    255420
     taaagtctct cctcctgttt gggggagaaa taggcgtaaa atgatcaaac attgttccct    255480
     cggcagtctg gaaacgtatg atacaggaaa gaaggcattt acaattccag ccaggcaaaa    255540
     tataattttt atattgtgag aaaaagagct gacattcgtt ttgccagacg gagggagatc    255600
     aaatcgtaat ggatattcga acaatcacgt cttcagatta tgaaatggta acgtctgtac    255660
     tgaatgaatg gtggggcggc agacagctga aagaaaaatt gccgagacta ttttttgagc    255720
     attttcagga cacaagcttt attacatccg aacataacag catgacggga tttttaatcg    255780
     gatttcaatc gcaatccgat cctgaaacgg cgtacattca tttttccggt gtgcatccgg    255840
     atttcagaaa aatgcaaatt gggaaacaat tgtatgatgt atttatcgaa acagtaaaac    255900
     aaaggggctg cacccgggtg aagtgtgtca cttcacctgt gaataaggta tcaatcgcat    255960
     atcacacaaa attggggttt gatattgaaa agggcaccaa aacggtaaat ggcatctcag    256020
     tgtttgcaaa ctatgatggc ccgggccaag acagggtact atttgtcaaa aacatatgag    256080
     ggggaaatat gatggatttt ttatcaaaaa cacctgagcc tccttactat gcagtcattt    256140
     tttcttctgt caaaagcgaa aatgacacag gatatggaga aacagcggag cggatggtat    256200
     cacttgcggc ggatcagcct ggatttttag gcgtggaaag cgtacgtgaa gcggatggaa    256260
     ggggcatcac agtttcctat tgggacagta tggacgcaat taaccattgg aggcatcaca    256320
     ctgaacatca agcagcaaaa gaaaaaggaa gaagcgtttg gtacgagtcg tatgcagtcc    256380
     gcgtcgcaaa agtcgacaga cagcggctgt ttcaggagaa cacgaatgat tgaatttctc    256440
     cagcataagg aagccactat agcgcgtgag attttagccg tacagatccc cgcctacata    256500
     aaggaaacag agattatcgg ttttgacggt attcccgctt tacaagagaa ggtaaaggat    256560
     attcaagcat cccatgaacg gtttgcggga tatcggaaaa acggcaagct gatcggtgtc    256620
     atttcatatg agaaaaacat gcattatctc accatttgca ggcttgttgt gcatcctgac    256680
     ggtttcagaa aaggaattgg acgagcgctt ctgcaatttg tcattgatca taatgaagac    256740
     gctgagaaaa tcgaagtagt cacagccgag aacaataccc cggctgtgtc actctataca    256800
     caggccggat tccaaaaggc agaaaccgtc aaagcagcgc agggtctatt gctgtcggtc    256860
     tttcatttgt atccgaaaag aaaagttgag atcattctct acaacgaaaa atgggcagaa    256920
     tgtttcgatg aagaaaaaga acggctgaaa cttgtgttcg ggccggagat tatcgctatt    256980
     catcacatcg gaagcacatc aatacctaac atggcagcga agccaatcat tgatatgtta    257040
     attgaagtca gaagcattga agccgtgagc caatttgatg aacaaatgaa ggccaacggc    257100
     tatacaccaa aaggtgagaa cggtatagcg ggcaggcgtt atttccaaaa gggcggaaat    257160
     aaacgcactc atcatgtcca tatgtacgaa cagggaaacc ctgctattga aaggcatctg    257220
     ttattcagag attatctcag agctcatcca aacatagcga aagaatacgc cgttctcaaa    257280
     aaacagctgg cggcccagca ccctgacagc atcaatcagt atatacaagg gaaagatgag    257340
     tggatcaaga ctgcagaaga aaatgcgaag cggtggaaaa aaggcagaaa caatgcgaat    257400
     ggcagtattg tatgctacaa tagcgaaaat gatgaaaacg ggggtttcac cttatgaaca    257460
     tacatgtgac agatgcagca aaacaggcac tgcagcaggc gtttgacgcc aacccgggaa    257520
     aaaaagccca gcttcgttac gatgcagaag gatgcggctg cgcggtaagc ggtgtcccga    257580
     caatctggct ggcagaagaa ttaacgggac agtgcgagca gctggaaacg aacggcattc    257640
     cgctgtatat ccaatcgtcg caaaaagtgt tttttgacga tcaaatgacg atcgattaca    257700
     atgaaaaagc caaaacattg gcgctgaaaa gcccggctga aatgctcagc cccagaatga    257760
     gcatattagt aaagtaggag acgcgaaacg tggaacaaaa gctgaaggca atgaagaaca    257820
     cagcacaaaa taaaacgtgg gtatccttcc tgaatcaaaa ccatccttat accttgcttc    257880
     actggtcaat cggaggagca gagtccatca agaaagatgt ctggctattg caggatgaaa    257940
     tgaccttcga gacgcaggag tttacaacga tagatcttgc gattgaatgg atcagagaaa    258000
     atatggatgg cattaccgac gttctgtaac ataaaaaagc gaaagagccg aagaggcctt    258060
     tcgctttttt attctgttga atcattcatg ttgtctaaaa actcctgcac tgtttttcgg    258120
     tacgtatgcc gatttttggt atatgacatg gcgtgttcac cgttctcggc aatgtacagc    258180
     gctttcggac cgcgtttctt ttcataaagc cgctcggttg aagaaacagg aatgtagtca    258240
     tcatccttac tgtgaataaa gaggaccggc ttttcaattt tatcaatgac agcaagcgga    258300
     gatacttcac gtgcgcgata gcctcccctc agcttcaaaa agaagtcggc gataggaagc    258360
     aggggccaag acgggagcct gtattccgct ctcagccgat aggcaagctg ttcatcaaaa    258420
     catgcgaacg gacaatcggc aatataaaaa tcagcgccat cgctgcagtg tgcaccagca    258480
     taaagcaggg cggtcacggc ccccatcgac tcaccatgaa ttccgatcaa tccgcgatga    258540
     tttgttttgt ttttgagcaa gctgacaacc ttattgagat catccttttc gtaaaacccg    258600
     tagctggtcg tctttccgcc gctttggcca tgccggcgat ggtcataaat gagcacattc    258660
     cagccgagat ctagaaataa atgcatatac ttaagagaat tcagtacatt catcgtcacc    258720
     ccgtggcaga tgatgatggt atttggtgtg tcatgcggtg cgacatggta tccttttatg    258780
     tcgtacccgt aagcggaggg tatcacaaaa gcggttttct ccatttgttc aaatgattca    258840
     aacacatcat gtccgttgtc tgtctctctt ttgataatgt cttcatccgt ttttttcttg    258900
     atgaatagaa tcatatgtga aaaaacaatt ccgattgcga tgacagctgt tacgagcgcg    258960
     ccaatggcca aaaggatttt cttcaaaagt cacagcacct ttcaacgaaa tatataggca    259020
     attcgtgttt aagatcatta tacctaaaca ctgctacgct gagaaagtga tcagaagaga    259080
     gtctgcttgt tcagtttata tgctccgtga taaactggct tcaaaacaaa acatggggga    259140
     agtctgcatg aaaaaacaaa aatccattga caaacaccag ctaaaagacg gccttcaatc    259200
     cgatatcaaa gcaaagctta tggagatgaa gagccaattg aaggaagagg atgaaaagag    259260
     gcagaaaaga gaaaaagcag aacagattag aaagaaaaaa gagatcgaaa aaaataagag    259320
     ctttgaagaa ctcctaaatg aaagccaaat ggattggcat caatataaat aaaccagcac    259380
     ccgtacaggt gctggttttt ctgctatgag cgatgagctt tgtaaatgtc ttgtttcgta    259440
     tgagattgga gcgctttgat ttcctcttcg gttaaacgcc gtgcatttgc tgcctgaata    259500
     ttttcccgta actgctcaat cttactggcg cctgtaatca ctgaagcgac agccggctgt    259560
     gctagcagat actgcagcga cttttctgtc atggaaagat cgggagccac ttcctccatt    259620
     gccttacggg catttgtcag ttcctcgaat gaataggaca agtacccgtt ttgtttcata    259680
     ctttctgaag cttgatcaag cggtttttca gttaagagcc ctttggcaac aggacctctg    259740
     gcgactacgc tgatttgatg ttcctctaaa agcgggagcc attcctcagg gcgtctgtca    259800
     aacaggctga attgcatcat aatgctgacg atgtttgatt tttttacata ttctttaatc    259860
     acattcgggc ggatggaaga aatgccgtag tagcggatga caccttcttg ttttaattcc    259920
     tcaaacgctt caatcgtttc atcaatgttg tcctctatcg tgccgccgtg gagctgataa    259980
     aggtcgatat aatctgtttt cagacgtgta aggctctttt ttaccgcctc ttttatgtaa    260040
     gcttttgaag ggtcccaata ccagccctcg cttccgtcat cccaacggtt tcccgctttt    260100
     gttgccagaa taatatcatg gcgtctgttt tggatcgcat caccgacaat ttcttcattg    260160
     cgtccccggt catacaaatc cgctgtgtcc aaatagttga tgccaagctc gatcgcttca    260220
     tccagaatgg acaatgcttt gtttttttca gttccaagag acatacagcc gagtccgact    260280
     tcgctaatgt ctaaatcaga tgtacccaat ttgcgctttc tcatgtgcac actccttttt    260340
     taggctttgt attgaccgta atataaagga gctaaagttt caacttttat ggctttgaga    260400
     tccaatcttt cacatattga aatgtgcgtc catactcttt taacttcgct cgaatttccc    260460
     atgcttttcc gactaagaca acaccttttg gcatgcggtg cactttcacg aagaagcccc    260520
     cttttgctct agtatgataa aatgtatggg gcatcatata gagacagaac gggagatgaa    260580
     gaaatgaaat cattagaaga aaaaacaatt gccaaagaac agattttttc gggtaaagtc    260640
     attgatcttt atgtcgagga tgtagagctg ccaaacggca aagccagtaa acgtgaaatt    260700
     gtgaaacacc ctggagctgt agcggtacta gccgtcacag atgaagggaa aatcatcatg    260760
     gtcaaacaat tccgtaagcc gcttgagcgg acgatcgttg aaattccggc cggtaagctt    260820
     gaaaaaggtg aggagccgga gtatacggca cttcgggaac ttgaagagga aaccggttat    260880
     acagcaaaaa aactgacaaa aataactgcg ttttatacat cacccggatt tgcagatgaa    260940
     atcgttcacg tttttcttgc tgaggagctt tctgtgcttg aagaaaaacg ggagcttgat    261000
     gaggacgagt ttgttgaagt gatggaggtg acgcttgaag atgcgctaaa gctggttgaa    261060
     tcgcgtgaag tatatgatgc taaaacagcc tacgcgattc agtatcttca gctgaaagaa    261120
     gcgctccaag cacaaaaatg aaaaagattt acgcggattt gcacattcat atcggccgga    261180
     cctttacagg aagggctgtc aaaataacag gcgccaaaac attaacgctg gacagaattt    261240
     tggttgaagc cagtgaacat aaaggaattg aactcctcgg cattatcgac tgtcattctc    261300
     cggaagtcat tctagagctt gaggaaggca tttcatctgg aaaatatcgc gagcttgacg    261360
     ggggaggaat ccgttatcgc agcacgactc ttttattggg gagcgagctg gagatttatg    261420
     atgaagcctg cagcggaccc gatccatgtg ctcgtattta tgccgacgct ggctgatatg    261480
     aaacagtttt caaactggct gtcagcccgg ctgaaaaata ttcatttaag ctcgcagcgg    261540
     atttatgaaa cgggcttaaa cctgcaaaaa aaagtgcagg atatgggcgg cctgtttatc    261600
     cccgcccata tctttacgcc gcataaaagc ttatatggaa aaggggttaa atcaagctta    261660
     actgaggttt ttgatccatc tatgatagac gcggtggagc ttggattaag ctgtgataca    261720
     gacatggcat cacacgtatc gcaattgaat ccgtatcctt ttttaacaaa ttctgatgcg    261780
     cattcgttgg ggaaaatcgg cagagaatat aatgaattat atgtgcagtc agctgatttt    261840
     actgaatttg ctcttgcatt aaagggacaa gatgacagga aaattatcgc aaattatggc    261900
     ttggacccgt tattggggaa atattatcag acggcttgcg aagcgtgcgg agagcctgct    261960
     gtaagcgggg aaacagcgtg cgcgaattgc ggaaaagcca gatttaccaa gggagtcagc    262020
     gatagattgc gtgaattgag tgatcagctt gaagttcgcg tcccgcgtcc gcgatatgta    262080
     catcagatcc cgctgcaatt tgttccgggt gtaggcccga aaacgctgga caaactaaaa    262140
     aaagccttcg gaacagaaat ggctgttctt catgaggctg cagaagaaga tttggctcgc    262200
     gttgtcccgc cgaaaaccgc ggcgcttatc gtaaaagcga gatccggaaa actggaattg    262260
     aaagccggag gaggaggaac ctacggtaaa attaaaccgt gagctaaaga ttaactcagt    262320
     tcctcctgta cttttctttt tgtgcgtata aaggtaatca gctggatgat ttcatcttca    262380
     ctcagcggct ggccatcaac agaaatggta aagtcgaggc tgctccacgt ggccaattct    262440
     atggcctgag gagcagtctg cttttgtttc tcgcggccta aaagttcatc gcaggttgtg    262500
     tcaaagaggt cagccagcat ggcaagcgct tcaagtgaag gccgtcggta gcctgactcg    262560
     tagccggcat atgtgctttt tgcgataccg agaaggtcag ctgtatattg aagcgaccaa    262620
     tttttctttt ttctcaattc agttaaacga tctagattca tgaacttccg ctcctttttc    262680
     accttgagct gattatatca tataggtatt aggaagtgta cgcgaattga ataataatgt    262740
     cttgcgtatt ttattttccg tgtctataat tgcattaaaa gtatgcgaaa agcgaatacc    262800
     ttctcgcaac ccatctttag atacagtgaa gaggtgcatg gtatgaaaaa attattgatg    262860
     ttgacaactg ggggaacgat tgcttcagtt gaaggggaaa atgggctggc tcccggagtc    262920
     aaggctgatg aattattaag ttacgtatca aaacttgata acgattacac aatggaaact    262980
     cagtcgctta tgaatataga cagcaccaat atgcagcctg aatactgggt ggaaatagca    263040
     gaagccgtta aggaaaatta tgatgcctat gacgggtttg ttattactca cggtacagat    263100
     acaatggcct atacatctgc cgcactatcg tatatgctgc agcatgccaa aaagccgatt    263160
     gtcatcaccg gctcgcagat tccgatcacg ttccaaaaaa ccgatgccaa aaaaaatatt    263220
     acagatgcca ttcgatttgc ctgtgaaggc gtgggcggcg tttatgttgt gtttgacggc    263280
     agagtcattc agggaacgcg tgcgatcaaa ttaagaacga aaagctacga cgcatttgaa    263340
     agcatcaatt acccatatat cgcttttatc aatgaagacg ggatcgaata caacaaacaa    263400
     gtaacggaac ctgagaacga caccttcaca gttgacactt cactatgcac agatgtatgt    263460
     ctgctgaagc tgcatccagg cttaaagccc gaaatgtttg atgccctgaa aagcatgtac    263520
     aaaggaattg tcattgagag ttatggcagc ggaggagtgc cgtttgaagg cagagacatt    263580
     ttgtcaaaag tgaatgaact gatcgaaagc ggcattgtcg tcgtcattac gactcaatgt    263640
     cttgaagaag gcgaagacat gagcatttac gaggttggcc gcagagtcaa ccaagactta    263700
     attatccgat caagaaatat gaacacagaa gcaattgtgc caaaattgat gtgggcgcta    263760
     ggtcagtctt cggatcttcc tgtcgtcaag agaattatgg aaacgccgat agctgatgac    263820
     gttgtcctgt aaaatgtaaa aacgataacc agcaaagaga aagaaggtta aagattatgt    263880
     taaacggcca aaaagaatat cgcgtggaaa aagacttcct tggggaaaaa caaattgaag    263940
     cagatgttta ttacggaatt cagacgctcc gtgcttctga aaattttccg atcacaggat    264000
     acaaaatcca tgaggaaatg attaacgcac tggcgattgt gaaaaaagct gcggctcttg    264060
     ccaacatgga cgtgaaacgg ctgtatgaag gaattggcca agctatcgta caagccgctg    264120
     acgagattct ggaaggcaag tggcacgatc agtttatcgt cgatccgatt cagggcggtg    264180
     ccggaacttc tatgaacatg aacgcgaatg aggttatcgg aaaccgggcg cttgaaatca    264240
     tgggacataa aaagggagat tatatccatt taagtccaaa cacacatgtg aacatgtcac    264300
     agtctcagaa cgatgtgttc ccgactgcta tccatatttc cacattgaag ctcttagaaa    264360
     aactgctgaa aacaatggaa gatatgcata gtgtgtttaa acaaaaagca caggagtttc    264420
     actctgttat taaaatgggc cggacacacc ttcaagatgc ggttccgatc cgtcttggcc    264480
     aggaattcga agcttacagc cgtgttctcg agcgtgatat caaacgaatc aagcaatcgc    264540
     gccagcacct gtatgaagtc aacatgggcg caactgctgt tggtacaggg ctgaacgctg    264600
     atcctgaata tatcaaacag gtagtaaagc accttgctga tattagcggg cttcctcttg    264660
     tcggcgctga tcatcttgtt gatgcgacac aaaatacaga tgcctataca gaggtatcag    264720
     cttcattaaa agtctgcatg atgaacatgt cgaagatcgc aaacgacctg cgcttaatgg    264780
     cgtcgggacc gcgcgccgga cttgcggaaa tttctctgcc tgcacgtcag ccgggttcat    264840
     ctattatgcc ggggaaagtc aatccggtta tggcggagct gatcaaccaa attgcgttcc    264900
     aggttatcgg aaatgacaat acaatctgcc ttgcttcaga agccggccag cttgagttga    264960
     acgtcatgga gcccgtgctt gtctttaatt tgcttcaatc catcagcatc atgaacaacg    265020
     gcttccgttc gttcactgac aactgcttaa aaggcattga agccaacgaa aagcgtatga    265080
     agcaatacgt agaaaaaagc gcaggcgtga tcacagctgt caatccgcat cttgggtatg    265140
     aagcggcagc tagaattgcc agggaagcaa ttatgacagg gcaatctgtc cgggatcttt    265200
     gtctgcagca tgatgtgctg actgaagaag aattggatat tattttaaac ccatatgaga    265260
     tgaccaaacc aggtatcgca gggaaagaac tattagaaaa ataaaatttg tataaaatac    265320
     agcttattca tctccgaata gtcggatgaa taagctgttt acaacatagg gatgaggaag    265380
     tatagtatac gtgttgcact atatattgaa agcgttttag cttttacatg aagggggact    265440
     tcttttgaag gatgtaagat tgccaacact atttgaaatt attattgtac taggagtatt    265500
     tttagcactt gttctatcgt ttacagtctt tctcgacttg ccgatacagc tggcgctttt    265560
     tgtttcatgg tttattgcaa tgcttttagg tattagactc ggttattctt ataaagattt    265620
     acaaaatgcg attgtacatg ggatatcaaa tggccttgaa gccgtactga ttctcgtttc    265680
     agttggggcg ctcatcggaa catggattgc cggaggcgtt gtgccgactt tgatttatta    265740
     cggactggaa tttattcacc caagtatctt tttactggca acgttaatta tttgttccat    265800
     tatgtctgtg gcaacaggaa cgtcatgggg aacagtcgga actgccggca ttgccatgat    265860
     cgcaattgga gaggggttag gcattccgct tcctctagta gcgggagcta ttctttcagg    265920
     tgcttatttt ggggacaagc tgtctccgct gtctgacagt acagttctag cttcttcact    265980
     atcaaaagtc gatgtattgg ctcacgtgag agcaatgctt tatttatcaa tacctgctta    266040
     tgtcattaca gctatactct ttacagttgt tggatttatg tacggcggga aaaatattga    266100
     tcttgataaa gttgaattct taaaatcatc tttgcaaaac acgtttgaca ttcatatttg    266160
     gatgctgatc ccggcagttc tcgtcatagt cttattggcg atgaaaaagc catctatgcc    266220
     agttatcgta attggcgctt tactcggtgc aatctgggct gttgttttcc aaggaatgga    266280
     tattgcccat gcgattgcaa ctgcgtacaa cggcttctct attaaaacgg atgttgaatt    266340
     tttgaacggc ttgttaaacc gcggtggaat tgtcggtatg cttgattctc tcgtcgtcat    266400
     catctttggc cttggttttg gcggtctgct tgagaaactc ggcgtgttaa aagtcattgt    266460
     ttcaacgttt gaaaagaaat taacttcagc cggcaatgtc acattgtcta cactgatcgt    266520
     agcgttttta gcaaacatct tcggctgtgc gatgtatgta tctcttattt tgactccgaa    266580
     aattatggaa gacagctatg atcgcttaca tctggacaga agagtgttat cacgtaactc    266640
     agaggtcggg ggaacattga cttcggggat ggttccttgg tctgataatg ggatttacat    266700
     ggctggtatt ttaggtgttt ctaccttctc ttatctgccg tttatgtggc tcagttttgt    266760
     agcaataggt cttgcaatta tctatggtta tacaggaaaa tttatatggt atacgaaaaa    266820
     caatacagtt aaagccgaaa aactaggcta ataggggagg atcactgaat gatagcgaaa    266880
     cacatgattc ggacactgat gatcgaaacg ccttcggttc ccggaaatct tggaagggtg    266940
     gctacggcca tcggccttct gggcggggat attggtgaag tggagacggt aaaagtcgga    267000
     cccaattaca caatgcggaa tattaccgtt caagtggaga atgaagaaca gcttcaggaa    267060
     gtgatcgcgg ctgtacaggc cctcggagaa gggatcaggc ttcacaccgt atctgatgaa    267120
     gtcctgtccg cacatgaagg cggaaaaatc caaatgaaaa gcaaaatgcc gatccgttca    267180
     ctggcagagc tgggacgtgt ctacacacca ggtgttgcgg acgtgtgccg actgatcgaa    267240
     aaagaacctg aaaaagcttc tatttataca acgatcagca attctgttgc aattgtaacg    267300
     gatggaaccg caattttagg ccttgggaat atcggctctg tggctggcat gcctgtcatg    267360
     gaaggaaagg ctgctttatt tgatcagctg gcgggtatta gcggcattcc gatactgctt    267420
     gatacgagtg atcctgaaga aatcatcaaa acagtaaaac atatttctcc gggctttagc    267480
     ggcatccttc ttgaggatat cggttcgccg cattgttttg aaatcgagga tcgcctaaaa    267540
     gaggagctga acatccctgt tatgcacgat gaccagcatg gtacagctgt agtgacgctg    267600
     gcagctgcca tttcggcatg caggagtgcg ggggttgacc tgaaggaagc gaaagtgggg    267660
     caaatcggcc ttggcgcagc aggcgtggcc atctgccgga tgttcatggc ttatggtgtg    267720
     aatgctgtat acggaacaga caaatcagag tcagcaatga accgtctcga acaatacggc    267780
     ggacaggcag tttccagtat tgaggagctt atggaaacat gtgatattgt cattgctaca    267840
     acgggcgttc cgggtttaat aaaaccggca tttgtacgtt ctggtcaagt gattctggct    267900
     ttatcgaatc cgaagccgga aattgagccg gaggccgcac tgcaggctgg cgccgcatat    267960
     gcagctgacg ggcgttctgt taataatgta ctcggttttc cagggatttt tagaggagcg    268020
     cttaacgcaa aaagcacgga gattaatcat gatatgcttg tcgcagcagc agaggccatc    268080
     gcagcttgca ctaaacaagg tgatgttgtc cctcagccgc ttgattcaaa agtccatcat    268140
     gcggtagcag cagctgtcga gcatgcagct cttacagcag tgaaataaat gtagctaaac    268200
     agcacctgtc gtagcaggtg ctgttttttt cttatcattg ttcaattttg ttatcattac    268260
     tatgaaaata aaaaagggag tgatcacatg gcaaaaagcc aagcgaaaaa gaagcggggg    268320
     catcgattga gaaacggcgg acgtgacgtc ttattatcaa gaggcagcac accatctttc    268380
     agcacacatg gaagaatgac aaaaagcaaa aaagagattt tgaataaacg gaagcataag    268440
     aatccttatg atcatacagc agttgatgat aaggattttt ttgtgcccca aaaagccgcc    268500
     tagcattcat ctctattgtt tctttttgaa aaagggcatg tttttctgtt tctttcatac    268560
     aatctattaa atcaaatcac tagagcgggc gggaggaaac ggtatgcgaa aaatctctta    268620
     taaggacatg tttctcaggc atgtcaaaga tcatctctct ctttatatat ttgtgtcagt    268680
     gctgtttttc atgggtgtca tctttggcgc gattattgtc aacagtatga ccatcagcca    268740
     gaaagaagat ttatactact acttaagtca attttttgga cagctttcgg atggaaaaca    268800
     ggcaagttca gctgatatgt ttgggcaaag tatctttcat aatgcaaagt atttaggcct    268860
     gatgtggata ctgggaattt ccgtcattgg gatgccgatt attttcatta tgatctttct    268920
     gaaagggatc gtcgtcggct ttactgtcgg gttcctagtc aatcagatgg gagtaagcgg    268980
     gtttttccta tcatttgtct ccgttttgcc gcaaaatgtg ctgctgattc cggcttatct    269040
     cattatgggc acatgtgcaa ttgcgttttc tttaaagtta atcagacagc tgttcgtgaa    269100
     acgaagcctg catgacgcgc cgattcaatg gttcgggcgg tatgcctttg tgctgctggt    269160
     cattctgttt ttagcgctga tttcatctct ctttgaagca tacttatctc ctgttttaat    269220
     ggaaaagctt acatctagac ttttttaaaa tcattattaa aagaaaacca ttttatttat    269280
     cagtttataa taattatagt tggaactctg cgcgtatttt gttataatga gtcatggaat    269340
     gcggcgtagg agggaaagac atggaaaacc gtattgatcg tattaagaaa caactgcact    269400
     catccagcta taaacttacg ccacagcgtg aagcgacagt aagagtgctg cttgaaaacg    269460
     aagaagacca tttaagcgca gaagatgtat acctcctcgt aaaagagaaa tctcctgaga    269520
     tcggtctcgc tacagtatac cgtacgcttg aattattaac tgaattaaaa gtcgtagata    269580
     aaattaactt tggagacggt gtgtcccgtt acgaccttcg gaaagagggc gcagctcact    269640
     ttcatcacca cttggtgtgc atggagttcg gagccgttga tgaaattgaa ggagatttgc    269700
     ttgaagacgt ggaagaaatc attgaacgtg attggaaatt taagattaaa gatcatagat    269760
     tgacgtttca cggcatttgc caccgctgta acggaaaaga aactgaatag acggtgccga    269820
     gcgcgaacct tttctcatgg ggaaagggtt ttttgctgtt tctatgtata aaacctttct    269880
     gatttggcat atggtttata taactggaac catagggaaa ggatcgatta ggacatggga    269940
     agattcctga aaacagctgt cgatgcattg aaagttttca tcctgtttac cggttttacc    270000
     gctttgttct attatgctat gatatgggtg aatcaagagt atgaaaacta tcatcggtat    270060
     gataaaccgg aagctccgct gtaaaagttg ttgaaatgga tcaggatgaa aaaggcggat    270120
     ggttcgaccg gttgatcttt ttttaccaaa acggggagta gatcaagagt gaaagatcaa    270180
     ataaaggatt tcatccacta cgttatggta gagagagggc tctctcaaaa tacgatcgta    270240
     tcctatgaac gtgacttgaa aagctattct ctctacttaa cagaaaccct tcatgttaca    270300
     gattggaatc acgttacccg catacatatt atccaatact taaagcattt gaaggactcg    270360
     gggaaatccg gcaagacatc ggcgcggcat ttggcatcca ttcgctcttt tcatcaattt    270420
     ctgctcaggg aaaaagtaac ggataaggac ccttccgttc atatcgaaac acaaaagacg    270480
     gaacgggcgc ttccgaaggt gctcgcgctc aatgaagtcg agcggttatt ggacacgcct    270540
     aagctgacga gccctttcgg atatcgggat aaagcaatgc tggagctgct ttatgcgaca    270600
     ggcatacgag tcagtgaaat gattgaattg aaaacggctg atgttcattt atctatgggg    270660
     tttatccgat gcttcggcaa aggaagaaaa gaacggattg tgccaatcgg tgaagccgct    270720
     gcttccgcca ttgaggaata tatgacaaaa gccaggggaa aactgttaaa aaataatgta    270780
     tctgacgccc tctttttaaa tcatcacggc aaacagatca gccgccaggg attttggaag    270840
     aacctgaaaa aaatcgcatt ggaagccggc attaagaaag agctgactcc gcatacactc    270900
     aggcattcct ttgcgacgca tctgcttgag gacggggcag atttaagagc ggtgcaggaa    270960
     atgctcggtc atgcggatat atccacgacg caaatttata cgcatgtgac gaaaacaagg    271020
     ctgaaggatg tgtacaagca gtttcatccg cgagcatagc cgcaggtggc tgcggctttt    271080
     ttgtttagag cgacagaaaa tattgaagtt tctcattatt tccaaataca ttgtcaacgg    271140
     gaatgaaaac ggtttatact tgagttgtca gacctcttag cgatacaata gacgtataga    271200
     aaaaaaggag gctttcaaga tgcctgcata caaatataat cgtgtgtttt taattgtgat    271260
     ggactcagtc ggaatcggcg aagcgccgga tgccgctgac tttaatgacg aaggcgctca    271320
     tacgctcggt catattgccg agcatatgaa cggattacat atgccgaata tggcaaagct    271380
     cggccttggt cttatcgaag atatcaaagg tgtagaaaaa acagaacatc cgcttgccta    271440
     ttatggaaaa ttgcaagaag cgtcaaacgg caaagatacg atgaccggcc attgggagat    271500
     tatgggttta tacattgata aaccgtttaa agtgttcccg gaaggctttc ctgatgaatt    271560
     gcttcaagag ctggaaaaga gatctggccg caaaattatt ggaaacaagc cggcttccgg    271620
     cacagcgatt ttggatgagc ttggccagga gcacatggag acaggggctt taattgttta    271680
     cacgtctgct gactctgttc tgcaaattgc cgctcacgaa gaggttgtgc cgcttgagga    271740
     gctgtatcgc atttgcgaaa cggcgagaga gctgacgctt gatccgaaat atatggttgg    271800
     ccgcattatt gcacggccgt tcgtcggaga gccgggtcaa ttcaaacgga cgccaaaccg    271860
     ccatgattat gcgctgaagc cgtttgaccg cactgtcatg aatgaattga aagactgcgg    271920
     cttagatgtg atttcaatcg gtaaaatctc tgatatttac gacggagaag gcattacttc    271980
     ttcacgcaga acggtttcta atatggacgg aatggacaag gtgatcgata cgctgggaga    272040
     agattttacg ggtctgagct ttgcgaacct tgttgatttt gacgcgttat tcggacaccg    272100
     ccgtgaccct gaaggctacg gacgcgcgct tgaagaattt gatgcgcggc ttccggaagt    272160
     gtttggaaaa atgagagaag acgatctgtt aattattaca gccgaccacg gcaatgatcc    272220
     gattcatcat gggactgacc atacacgcga gtatgtgccg attctggctt acagcaaaaa    272280
     acataagaaa gcccaaatgc tgccgcttgc agatacattt gccgatattg gcgcaacgat    272340
     cgctgataat ttccaaacaa ataaaccgaa atacgggaaa agctttttat ctttattaca    272400
     atagggggac tgtttcttga aggacagaat tgaacgcgca gccgctttta ttaaacaaaa    272460
     cctgccggaa tctccaaaga tcggccttat tttaggctca ggtcttggca ttttggcgga    272520
     cgaaatcgaa aatccggtca agctgaaata tgaagatata cctgaattcc cggtatctac    272580
     tgttgaaggg catgccggac agcttgtgct tggcactctt gaaggagttt ccgtcattgc    272640
     aatgcagggc cgctttcatt tttatgaagg ctactcaatg gagaaagtca cattccctgt    272700
     acgcgtgatg aaagcgctcg gtgtggaagc gttgatcgtg acaaatgccg caggcggtgt    272760
     caacactgaa ttccgtgcgg gagatttaat gattattacc gatcatatca actttatggg    272820
     aacaaacccg ttaatcgggc caaacgaagc agatttcggc gccagatttc cagatatgtc    272880
     ttcagcctat gacaaagatc tgtccagcct ggctgaaaag attgcgaaag accttaatat    272940
     cccaattcaa aaaggcgtgt acactgctgt gacaggacct tcttacgaaa caccggcaga    273000
     agtccgtttc ttaagaacga tgggctctga tgcagtcggc atgtctactg ttccggaagt    273060
     cattgtagcg aatcatgcgg gaatgcgggt tcttggcatt tcctgcatct ctaacgcggc    273120
     agccggaatt ctggatcagc ctttaagtca cgatgaagtt atggaagtga ccgaaaaagt    273180
     aaaagctgga ttcttaaagc ttgttaaagc gatcgtcgct cagtacgaat aaatatgaat    273240
     caatgcagga ccaaaagaca gctgtgtctg atatcacaca gctgtctttt tttatgccca    273300
     aaattcgaaa cattttccat cagtggcgta taaaaccatc acgcttggaa aaaataaaaa    273360
     ggattatgaa atggagggct tttgagatga aacgtctttt atccactttg ttgattggta    273420
     taatgctgct tacatttgca ccgtctgcat ttgcaaaaca agacggaaaa cgtacatcgg    273480
     agcttgctca tgaagcgaag tctgcggtgc tgatagaacg tgacacggga aaagtgcttt    273540
     acaacaagaa cagcaatgag agactggcgc ctgcaagcat gacgaaaatt atgacgatgc    273600
     ttttgattat ggaagcttta gataaaggca aaatcaaaat gagtgataag gtccgtacaa    273660
     gcgagcatgc ggcgtcaatg ggcggctcac agatattcct tgagcccggc gaagaaatga    273720
     ctgtcaaaga aatgctgaaa ggcatcgcaa tcgcttcggg aaatgacgct tccgtcgcca    273780
     tggctgaatt tatttccggc tctgaagaag aatttgtgaa gaaaatgaat aaaaaagcaa    273840
     aagagctggg attgaaaaat acatccttta aaaacccaac aggactgacc gaggaaggac    273900
     actacagctc tgcttatgac atggcaatca tggctaagga attattgaaa tacgaatcaa    273960
     ttacgaagtt taccggcacg tatgaagatt atctgcgtga aaatacagat aaaaagtttt    274020
     ggcttgtaaa tacaaatcgc cttatcaaat tttatcctgg tgtagacggc gtaaaaacag    274080
     gctatacagg cgaagcgaaa tattgtctga ctgcttcggc taaaaaagga aacatgcggg    274140
     ccatagcggt tgtattcgga gcgagcacgc ctaaagaaag aaacgcgcaa gtgacaaaaa    274200
     tgcttgactt cgcctttagc caatatgaaa cgcatccttt atataaacga aatcaaacag    274260
     tagcaaaagt aaaggtcaaa aaagggaaac aaaaatttat cgaactcact acatctgagc    274320
     cgatttcaat attgacgaaa aaaggcgagg atatgaacga tgtgaaaaaa gaaatcaaga    274380
     tgaaggacaa tattagtgct ccgattcaaa aaggccaaga gcttggcact cttgttctga    274440
     aaaaggatgg agaagtactc gctgaaagtc ctgttgctgc aaaagaagat atgaagaaag    274500
     ccgggtttat cacattctta aagcggacga tgggagactg gacaaaattt aagtaattat    274560
     gccgaatgac cactagtttt gtcacggtga aggaattcat tccgtcgaaa tcgaaacact    274620
     cattatccga tcatatcaag gaggaatgag catgagcctt ggaattgaca tgaatgtcaa    274680
     agaatctgtg ctttgtattc gattaacagg cgaactcgat caccatacgg ctgaaaccct    274740
     gaagcaaaaa gtgactcaat cattggagaa ggatgatatt cgccatatcg tgctgaactt    274800
     ggaggacctt tcctttatgg acagctcggg gcttggcgtt attttaggaa gatacaagca    274860
     aattaagcaa attggcggag aaatggttgt ttgcgctatc tctcctgcgg tgaagcgatt    274920
     gtttgatatg tcgggtctgt ttaaaattat ccgatttgaa caatctgaac agcaggcact    274980
     cctgacactg ggggtggcat catgaaaaat gaaatgcacc ttgagttttc tgccctcagt    275040
     cagaatgaat cgttcgcccg tgtgacagtt gcttcattta tagctcagct ggacccgaca    275100
     atggatgaac tgactgaaat caaaacagtc gtgtcagagg ctgtcacgaa tgcgattatc    275160
     catggatatg aagagaactg tgaagggaaa gtttacattt cagtgacgct ggaagatcat    275220
     gtcgtatata tgactattcg tgatgaaggc ttaggcatta cagatcttga agaagcccgt    275280
     cagcctctat ttacgactaa gcctgagctt gagcgctctg gaatgggctt taccattatg    275340
     gaaaatttca tggatgatgt cagtatcgat tcatcgcctg aaatgggaac aacgattcgc    275400
     ttaacaaagc acttatcaaa aagcaaagcg ctttgtaatt aaggagattt gttatggatg    275460
     tggaggttaa gaaaaacggc aaaaacgctc agctgaagga tcatgaagta aaggaattaa    275520
     tcaaacaaag ccaaaatggc gaccagcagg caagagacct cctcatagaa aaaaacatgc    275580
     gtcttgtttg gtctgtcgta cagcggtttt taaacagagg atatgagcct gacgatctct    275640
     tccagatcgg ctgcatcggg ctgttaaaat ctgttgacaa atttgattta acctatgatg    275700
     tgcgtttttc aacgtatgca gtgccgatga ttatcggaga aatccaacga tttatccgtg    275760
     atgacggaac cgtaaaggta tcacggtcat taaaagagct tggaaacaaa atccggcgcg    275820
     cgaaggatga gctttcgaaa acactgggca gagtgccgac ggtgcaggag atcgctgacc    275880
     atttggagat tgaagctgag gatgttgtac tggcccaaga ggcggtaagg gctccatctt    275940
     cgattcacga aaccgtttat gaaaatgacg gagatccgat taccctgctt gatcaaatcg    276000
     ctgacaactc agaagaaaaa tggtttgaca aaattgcgct gaaagaagcg atcagcgatt    276060
     tggaggaaag ggaaaaacta atcgtctatc tcagatatta taaagaccag acacagtccg    276120
     aggtggctga gcggctcggg atctctcagg tgcaggtttc caggcttgaa aagaaaatat    276180
     taaaacagat caaggttcaa atggatcata cggatggcta gtctgcagtg caggctagct    276240
     tttttgtgca aaagcgtggt aatttatggt cttttcgagc ggatgaatga gaacaaaatc    276300
     gaaccacata ctacatatat aaccaccgaa agatggtgat caatgatgga acgacgaata    276360
     tttatccggc ttcgccaccg agtgctggca catccagggg atattattac cgttggagat    276420
     gccgcgcaaa tagaagggca gcttcagctg aaaaagaaac tttcggctat gccgctttat    276480
     caggtgagcg aaaaagataa aaatatcgta attctggata tcatacaagt cctcagagcc    276540
     attcatttac aagacccgac aattgatgtt caaaccgtag gcggagcaga aaccattgtt    276600
     gaaattcagt atcgaaagcg aaatttatca acggttctat ttatcggtgt ctggctgctt    276660
     ctgtttattg gatcgtgtct tgccatcatg aactttcatg aggatgtaag catgagagat    276720
     gttcatatcg cactatatga aatcataacc ggagagagga atgactatcc atatttgctt    276780
     caaatcccat acagcatcgg tttgggactg gggatgatcg tgttttttaa ccacatattt    276840
     aaaaagcgcc taaatgaaga gccagcccgc tggaggttga gatgtttaac tatcagcttg    276900
     atctcgatca atatgtggcc atgcatgaga atcaagaaac cataaaggat ctgcatgatc    276960
     gttagtgtat tgttcatcat ttttgtcggg ctcggcggag gcataacggt gggggcgggt    277020
     ttcgttgctt ttttaaccgt aatgggaatc attccgcggc tgatgcagct caccaaaaca    277080
     atgagatttg ttcaggctta tgaagcggct gttattcttg gcgcggtttg cgggggatgg    277140
     gagacgcttc atatgaatca tctttatcta acaaaatgga tagctgtgcc ggtcgggctt    277200
     ctggcaggtt tgttcgtcgg gatgctagcg gctgctctta cagaggtttt aaatgtcctg    277260
     ccgattttgg cgaaacgaat cgggctcaga agtaaaatca ttattctgtt aatggccatc    277320
     gtgattggga aaatcgcggg atctttattt cactggctgt actttattga ccattcataa    277380
     ggaggttcaa gatgacaaac ataaaagaaa attacaaatc aaaagtgaaa acatatcagc    277440
     ctaagccgcc ttacgtctgg aactgtgtaa aagccttttt agtgggcgga ctgatttgtg    277500
     caatcgggca aggtctgcaa aatttttata tccatttttt tgatttcaat gaaaaaactg    277560
     cggggaatcc aacagctgca acgctgatat taatttctgc cctgcttaca gggtttggaa    277620
     tctatgacag aatcggacaa ttcgcaggcg caggttcagc cgtacctgtc acgggttttg    277680
     ccaacagtat ggcaagtgcg gctcttgaat ataaaagcga aggattagtg cttggagtag    277740
     cgacaaatat gtttaaactg gcaggaaatg ttattgtttt cggagttgta gctgcataca    277800
     tcgttggaat gattcggttt gcttttgaga aactgatgtc ataggaggag aagaaaatga    277860
     aattaacagg aaagcaaacc tgggtatttg aacatcccat atttgtcaac tcagcgggaa    277920
     cggcagcagg accaaaggaa aaagacggac cgcttggctc tttatttgat aaaacctatg    277980
     acgaaatgca ttgtaatcaa aaaagctggg aaatggcgga acggcagctg atggaagacg    278040
     ctgttaatgt tgcacttcaa aaaaacaatc tgacaaaaga tgatattgac ctattgctgg    278100
     caggcgactt gctgaaccaa aacgtgacgg ctaactatgt ggcaagacac ttgaaaatcc    278160
     catttctttg tatgtttggc gcctgttcaa catcaatgga aacagtggct gtcgcatcag    278220
     ccttagttga tggagggttt gccaaaaggg cactcgctgc caccagcagt cacaatgcaa    278280
     ctgcggaaag acagtttcgc tatccgacag aatacggagg ccaaaaaccg gacactgcta    278340
     cctccactgt aaccggaagc ggtgcagttg tcatcagtca gacaccgggt gatatccaaa    278400
     tcacaagtgc gactgtcggg aaggtttctg atttaggaat tacagatcct tttgatatgg    278460
     gatcggctat ggctccggct gcagctgata cgattaagca gcactttaaa gatctcaacc    278520
     ggacagcgga tgactatgat ctaatcctga caggtgacct gtcaggcgtc ggttctccaa    278580
     tcgtaaaaga cattttaaaa gaagatggat atccagtcgg cacaaagcat gatgattgcg    278640
     ggcttctgat ttacactccg gatcagcagg tctttgccgg ggggagcggc tgtgcttgtt    278700
     cagcggttgt cacctactct catattttta agcagctgag agaaggaaaa ctaaaccgtg    278760
     tatttgtcgt ggcgaccggg gcgctattaa gcccgacgat gatccagcaa aaagaaacca    278820
     tcccgactat cgcccacggg gttgtatttg agcgtgcagg aggtgcatct taatatggac    278880
     taccttttgg cttttgtctg cggcggggcc atctgtatcg tcggccagct gctcttggat    278940
     atttttaaat tgacgccagc tcatgtcatg acatcatttg ttgtaatcgg tgcaatatta    279000
     gatggtttcg gcatttacga taaatttatt gaatttgccg gaggaggcgc cattgttccg    279060
     atcgtcagct tcggtcacag tcttctgcac ggcgccatgc atcaggcgca tatacacgga    279120
     tttatcggaa tcggcatggg gatttttgag ctgacctcgg ccggtatctc agccgctatt    279180
     cttttcgcct ttatcgtagc tgttattttc aaagccgaaa ggataagtgc cgacatgacg    279240
     acaaaacgca aggtcatact ggtaacagac ggggatgttt atgccgctaa aacaattgaa    279300
     tacgccgcaa gcaaagtggg aggccgatgt atttcacaat caaaagggaa tccttccacc    279360
     cgcagcggcg ccgagcttgt caagctgatc gcctcagcac cgtatgatcc tgtatttgtc    279420
     atgtttgacg actccggcct tcaaggagag ggcccgggag aagccgctct aacctatgtc    279480
     gcaacccatc cgtctattga agtgctcggt gtgattgcgg tcgcgtcaaa aacacatcag    279540
     gctgaatgga ccagggtcga tgtaagcatt gaccgcaatg gagaaataac tgaatacggc    279600
     gtcgataaag tcggggaaag ggaatttgat gaccacagaa tgagtggaga tacagtctat    279660
     tgccttgata aacttgatct cccgcttact atcggtatcg gggatatcgg caaaatgggc    279720
     agaaaagacg atatctcaaa agggtcgcca atcaccatga aagcggtcga gtttatttta    279780
     gaaaggagcg ggtatcatgc cggaccacaa ggaagagaaa attcgggttt atcggaatcc    279840
     agctaaaaat gaagagtatt tcaaaaaccg tgttgggatg gggacgagct atgatgtagg    279900
     tgttcgcaag ctcacgattt tagataaaga gatccagctt tactatctaa atggattatg    279960
     cgatacagcc tatattattc atttaatgag agagcttgtt gccattaaca atcggaaaga    280020
     agaccctgat gagctggtcg acatcgtcga aaacaggctg cttaacgccc aggtcgaaaa    280080
     agtaaaaacc ttggatgaaa ccaccgacca agtgctgtcc gggctcgtcg ctgtcattgt    280140
     tgaaggtgca ggcttcgcat ttataattga tgtcagaagc tatccgggca gaaacccgga    280200
     agaacctgat acggaaaagg tggtcagggg agccagagac ggatttgttg aaaatatcgt    280260
     cgtcaatacg gcccttctca gaaggcggat cagagacgaa cgccttcgag tcaagatgac    280320
     taaagttggt gagcggtcaa agacggattt aagcatttgt tatatagaag atatagctga    280380
     tccggatctg gttgagatcg tagaaaaaga aattgcatcc attgatgtcg atggattaac    280440
     aatggcagac aaaactgtcg aggaattcat tgttaatcaa agctataatc cttttccgct    280500
     cgtgcgctat acagaaagac cggatgtggc cgcaaatcat gttctagaag gccatgttat    280560
     cattatagtg gacacatcgc cgagtgtgat cattaccccg acgactttat ttcaccatgt    280620
     gcagcatgct gaagaatata ggcaggcgcc ttcagtcggg acctttttaa gatgggtaag    280680
     atttttcggt attcttgctt ctactttatt tcttccgatc tggtttctct ttgtgcttca    280740
     gcctgatctg ctcccggaca acatgaaatt tatcggttta aataaagata cgcatatccc    280800
     gatcatcctg cagatatttt tagctgactt aggaatcgag tttctcagaa tggctgccat    280860
     tcacacaccg acggctttat cgacagcaat gggtttaatt gccgctgttc tgatcgggca    280920
     gattgcgatt gaggtcgggc ttttttctcc tgaggtgatt ctgtacgtct cacttgcggc    280980
     gattggaacc tttacgacgc ctagttatga attaagcttg gcaacaaatg agccgtcttg    281040
     tcctcatgat actcgttgct ttatttcata taaaagggct cgtcatcgga tttacagtgc    281100
     taattatgcc atggcaagca tcaaatccct tcagacaccg tacttatggc cgctgattcc    281160
     ctttaacgga aaggcgctgt ggcaggttct tgtccgcaca gcgaaacctg gcgcaaaagt    281220
     aagacccagc atcgttcacc ccaaaaatcg cttaaggcag cctaccaatt cataatcgca    281280
     ttgaaactga ctgaagagta tgataatgta tgtcttaatt atgaagggac agtccataaa    281340
     actgtccttt catccataag cggagaaaga gggaatgaca ttgttcttac acggcacaag    281400
     cagacaaaat caacatggtc atttagaaat cggaggtgtg gatgctctct atttagcgga    281460
     gaaatatggt acacctcttt acgtatatga tgtggcttta atacgtgagc gtgctaaaag    281520
     ctttaagcag gcgtttattt ctgcagggct gaaagcacag gtggcatatg cgagcaaagc    281580
     attctcatca gtcgcaatga ttcagctcgc tgaggaagag ggactttctt tagatgtcgt    281640
     atccggagga gagctatata cggctgttgc agcaggcttt ccggcagaac gcatccactt    281700
     tcatggaaac aataagagca gggaagaact gcggatggcg cttgagcacc gcatcggctg    281760
     cattgtggtg gataatttct atgaaatcgc gcttcttgaa gacctatgta aagaaacggg    281820
     tcactccatc gatgttcttc ttcggatcac gcccggagta gaagcgcata cgcatgacta    281880
     cattacaacg ggccaggaag attcaaagtt tggtttcgat cttcataacg gacaaactga    281940
     acgggccatt gaacaagtat tacaatcgga acacattcag ctgctgggtg tccattgcca    282000
     tatcggctcg caaatctttg atacggccgg ttttgtgtta gcagcggaaa aaatcttcaa    282060
     aaaactagac gaatggagag attcatattc atttgtatcc aaggtgctga atcttggagg    282120
     aggtttcggc attcgttata cggaagatga tgaaccgctt catgccactg aatacgttga    282180
     aaaaattatc gaagctgtga aagaaaatgc ttcccgttac ggttttgaca ttccggaaat    282240
     ttggatcgaa ccgggccgtt ctctcgtggg agacgcaggc acaactcttt atacggttgg    282300
     ctctcaaaaa gaagtgccgg gtgtccgcca atatgtggct gtagacggag gcatgaacga    282360
     caatattcgt cctgcgcttt accaagctaa atatgaagct gcggcagcca acaggatcgg    282420
     agaagcgcat gacaaaacgg tatcaattgc cggaaagtgc tgtgaaagcg gagatatgct    282480
     gatttgggat attgacctgc cggaagtaaa agaaggcgat cttcttgccg ttttttgtac    282540
     aggcgcttat ggatacagca tggccaacaa ttataaccgt attccgagac ccgccgttgt    282600
     atttgtcgaa aacggtgagg ctcatttagt cgtgaagcga gaaacatacg aagatattgt    282660
     aaaacttgat ctgccattta aaacgggtgt aaagcaataa                          282700
//

If you have problems or comments...

PBIL Back to PBIL home page