(data stored in ACNUC8465 zone)

EMBL: D87116

ID   D87116; SV 1; linear; mRNA; STD; HUM; 2103 BP.
XX
AC   D87116;
XX
DT   14-DEC-1996 (Rel. 50, Created)
DT   16-JAN-2010 (Rel. 103, Last updated, Version 6)
XX
DE   Homo sapiens mRNA for MAP kinase kinase 3b ,complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2103
RA   Irie K.;
RT   ;
RL   Submitted (14-AUG-1996) to the INSDC.
RL   Contact:Kenji Irie Faculty of Science, Nagoya University, Department of
RL   Molecular Biology; Furou-chou, Chikusa-ku, Nagoya, Aichi 464-01, Japan
XX
RN   [2]
RX   DOI; 10.1074/jbc.271.43.26981.
RX   PUBMED; 8900184.
RA   Moriguchi T., Toyoshima F., Gotoh Y., Iwamatsu A., Irie K., Mori E.,
RA   Kuroyanagi N., Hagiwara M., Matsumoto K., Nishida E.;
RT   "Purification and identification of a major activator for p38 from
RT   osmotically shocked cells. Activation of mitogen-activated protein kinase
RT   kinase 6 by osmotic shock, tumor necrosis factor-alpha, and H2O2";
RL   J Biol Chem 271(43):26981-26988(1996).
XX
DR   MD5; 46f0af8f238edb0ef83417942376a405.
DR   Ensembl-Gn; ENSG00000034152; homo_sapiens.
DR   Ensembl-Tr; ENST00000316920; homo_sapiens.
DR   Ensembl-Tr; ENST00000342679; homo_sapiens.
DR   Ensembl-Tr; ENST00000361818; homo_sapiens.
DR   Ensembl-Tr; ENST00000613338; homo_sapiens.
DR   EuropePMC; PMC523249; 15479790.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2103
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        58..1101
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="MAP kinase kinase 3b"
FT                   /note="MKK3b"
FT                   /db_xref="GOA:P46734"
FT                   /db_xref="H-InvDB:HIT000101942.14"
FT                   /db_xref="HGNC:HGNC:6843"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46734"
FT                   /protein_id="BAA13248.1"
FT                   /translation="MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLD
FT                   SRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQ
FT                   KRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPE
FT                   DILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKT
FT                   MDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQV
FT                   VEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVK
FT                   EILGEDS"
XX
SQ   Sequence 2103 BP; 442 A; 619 C; 586 G; 456 T; 0 other;
     ctcgagatcc attgtgctct aaagagtctc caccgccgtc caggacccac ttgcagcatg        60
     gagtcgcccg cctcgagcca gcccgccagc atgccccagt ccaaaggaaa atccaagagg       120
     aagaaggatc tacggatatc ctgcatgtcc aagccacccg cacccaaccc cacacccccc       180
     cggaacctgg actcccggac cttcatcacc attggagaca gaaactttga ggtggaggct       240
     gatgacttgg tgaccatctc agaactgggc cgtggagcct atggggtggt agagaaggtg       300
     cggcacgccc agagcggcac catcatggcc gtgaagcgga tccgggccac cgtgaactca       360
     caggagcaga agcggctgct catggacctg gacatcaaca tgcgcacggt cgactgtttc       420
     tacactgtca ccttctacgg ggcactattc agagagggag acgtgtggat ctgcatggag       480
     ctcatggaca catccttgga caagttctac cggaaggtgc tggataaaaa catgacaatt       540
     ccagaggaca tccttgggga gattgctgtg tctatcgtgc gggccctgga gcatctgcac       600
     agcaagctgt cggtgatcca cagagatgtg aagccctcca atgtccttat caacaaggag       660
     ggccatgtga agatgtgtga ctttggcatc agtggctact tggtggactc tgtggccaag       720
     acgatggatg ccggctgcaa gccctacatg gcccctgaga ggatcaaccc agagctgaac       780
     cagaagggct acaatgtcaa gtccgacgtc tggagcctgg gcatcaccat gattgagatg       840
     gccatcctgc ggttccctta cgagtcctgg gggaccccgt tccagcagct gaagcaggtg       900
     gtggaggagc cgtcccccca gctcccagcc gaccgtttct cccccgagtt tgtggacttc       960
     actgctcagt gcctgaggaa gaaccccgca gagcgtatga gctacctgga gctgatggag      1020
     caccccttct tcaccttgca caaaaccaag aagacggaca ttgctgcctt cgtgaaggag      1080
     atcctgggag aagactcata ggggctgggc ctcggacccc actccggccc tccagagccc      1140
     cacagcccca tctgcggggg cagtgctcac ccacaccata agctactgcc atcctggccc      1200
     agggcatctg ggaggaaccg agggggctgc tcccacctgg ctctgtggcg agccatttgt      1260
     cccaagtgcc aaagaagcag accattgggg ctcccagcca ggcccttgtc ggccccacca      1320
     gtgcctctcc ctgctgctcc taggacccgt ctccagctgc tgagatcctg gactgagggg      1380
     gcctggatgc cccctgtgga tgctgctgcc cctgcacagc aggctgccag tgcctgggtg      1440
     gatgggccac cgccttgccc agcctggatg ccatccaagt tgtatatttt tttaatctct      1500
     cgactgaatg gactttgcac actttggccc agggtggcca cacctctatc ccggctttgg      1560
     tgcggggtac acaagagggg atgagttgtg tgaatacccc aagactccca tgagggagat      1620
     gccatgagcc gcccaaggcc ttcccctggc actggcaaac agggcctctg cggagcacac      1680
     tggctcaccc agtcctgccc gccaccgtta tcggtgtcat tcacctttcg tgtttttttt      1740
     aatttatcct ctgttgattt tttcttttgc tttatgggtt tggcttgttt ttcttgcatg      1800
     gtttggagct gatcgcttct cccccacccc ctagggtacc agcaggcaga gccttgccct      1860
     ctgctcaggc tggggtccag tgggaggggc ccaaaatctc tgctcagaga agtgcagggg      1920
     gagccttcca gctcactctc cctgaggact ggcgtgacag gggctatggg tgttgttttt      1980
     aaaaaaagaa aatatatttt tttgaaaaaa cgactgccca tcccgggtcc tttccctgat      2040
     gggttggggc agttacctgg ttgctgtttt aattaaaaac tttagagcac aatggatctc      2100
     gag                                                                    2103
//

If you have problems or comments...

PBIL Back to PBIL home page