(data stored in ACNUC8465 zone)

EMBL: D87905

ID   D87905; SV 1; linear; mRNA; STD; HUM; 1005 BP.
XX
AC   D87905; D84440;
XX
DT   06-OCT-1996 (Rel. 49, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens mRNA for mitogen-activated protein 6, complete cds.
XX
KW   mitogen-activated protein 6.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1005
RA   Hagiwara M.;
RT   ;
RL   Submitted (14-SEP-1996) to the INSDC.
RL   Masatoshi Hagiwara, Nagoya Univ. Sch. Med., Dept. 3rd Anatomy; Shouwa-ku
RL   Tsurumai-cho 65, Nagoya, Aichi 466, Japan
RL   (E-mail:i45247a@nucc.cc.nagoya-u.ac.jp, Tel:052-744-2030, Fax:052-744-2041)
XX
RN   [2]
RP   1-1005
RA   Hagiwara M.;
RT   ;
RL   Unpublished.
XX
RN   [3]
RX   DOI; 10.1074/jbc.271.23.13675.
RX   PUBMED; 8663074.
RA   Moriguchi T., Kuroyanagi N., Yamaguchi K., Gotoh Y., Irie K., Kano T.,
RA   Shirakabe K., Muro Y., Shibuya H., Matsumoto K., Nishida E., Hagiwara M.;
RT   "A novel kinase cascade mediated by mitogen-activated protein kinase kinase
RT   6 and MKK3";
RL   J Biol Chem 271(23):13675-13679(1996).
XX
DR   MD5; ea63b17486881d883d19fe478a41510f.
DR   Ensembl-Gn; ENSG00000108984; homo_sapiens.
DR   Ensembl-Tr; ENST00000589647; homo_sapiens.
DR   Ensembl-Tr; ENST00000590474; homo_sapiens.
DR   Ensembl-Tr; ENST00000613873; homo_sapiens.
XX
CC   D84440:Submitted (17-Apr-1996) to by:Masatoshi Hagiwara
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1005
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_line="Hela"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..1005
FT                   /codon_start=1
FT                   /product="mitogen-activated protein 6"
FT                   /db_xref="GOA:P52564"
FT                   /db_xref="H-InvDB:HIT000101976.14"
FT                   /db_xref="HGNC:HGNC:6846"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:2Y8O"
FT                   /db_xref="PDB:3ENM"
FT                   /db_xref="PDB:3FME"
FT                   /db_xref="PDB:3VN9"
FT                   /db_xref="PDB:5ETF"
FT                   /db_xref="UniProtKB/Swiss-Prot:P52564"
FT                   /protein_id="BAA13496.1"
FT                   /translation="MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQN
FT                   FEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISM
FT                   RTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIV
FT                   KALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAP
FT                   ERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD
FT                   KFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD"
XX
SQ   Sequence 1005 BP; 301 A; 216 C; 242 G; 246 T; 0 other;
     atgtctcagt cgaaaggcaa gaagcgaaac cctggcctta aaattccaaa agaagcattt        60
     gaacaacctc agaccagttc cacaccacct cgagatttag actccaaggc ttgcatttct       120
     attggaaatc agaactttga ggtgaaggca gatgacctgg agcctataat ggaactggga       180
     cgaggtgcgt acggggtggt ggagaagatg cggcacgtgc ccagcgggca gatcatggca       240
     gtgaagcgga tccgagccac agtaaatagc caggaacaga aacggctact gatggatttg       300
     gatatttcca tgaggacggt ggactgtcca ttcactgtca ccttttatgg cgcactgttt       360
     cgggagggtg atgtgtggat ctgcatggag ctcatggata catcactaga taaattctac       420
     aaacaagtta ttgataaagg ccagacaatt ccagaggaca tcttagggaa aatagcagtt       480
     tctattgtaa aagcattaga acatttacat agtaagctgt ctgtcattca cagagacgtc       540
     aagccttcta atgtactcat caatgctctc ggtcaagtga agatgtgcga ttttggaatc       600
     agtggctact tggtggactc tgttgctaaa acaattgatg caggttgcaa accatacatg       660
     gcccctgaaa ggataaaccc agagctcaac cagaagggat acagtgtgaa gtctgacatt       720
     tggagtctgg gcatcacgat gattgagttg gccatccttc gatttcccta tgattcatgg       780
     ggaactccat ttcagcagct caaacaggtg gtagaggagc catcgccaca actcccagca       840
     gacaagttct ctgcagagtt tgttgacttt acctcacagt gcttaaagaa gaattccaaa       900
     gaacggccta catacccaga gctaatgcaa catccatttt tcaccctaca tgaatccaaa       960
     ggaacagatg tggcatcttt tgtaaaactg attcttggag actaa                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page