(data stored in ACNUC1829 zone)

EMBL: D89290

ID   D89290; SV 1; linear; mRNA; STD; MUS; 1819 BP.
XX
AC   D89290;
XX
DT   25-SEP-1997 (Rel. 52, Created)
DT   16-OCT-1997 (Rel. 52, Last updated, Version 3)
XX
DE   Mus musculus mRNA for CD151, complete cds.
XX
KW   CD151; SFA-1.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1819
RA   Hasegawa H.;
RT   ;
RL   Submitted (18-NOV-1996) to the INSDC.
RL   Hitoshi Hasegawa, Ehime University School of Medicine, First Department of
RL   Internal Medicine; Shigenobu, Onsen-Gun, Ehime 791-02, Japan
RL   (E-mail:hitoshih@m.ehime-u.ac.jp, Tel:089-964-5111(ex.2114),
RL   Fax:089-964-4766)
XX
RN   [2]
RX   DOI; 10.1016/S0167-4781(97)00095-X.
RX   PUBMED; 9294006.
RA   Hasegawa H., Watanabe H., Nomura T., Utsunomiya Y., Yanagisawa K.,
RA   Fujita S.;
RT   "Molecular cloning and expression of mouse homologue of SFA-1/PETA-3
RT   (CD151), a member of the transmembrane 4 superfamily";
RL   Biochim. Biophys. Acta 1353(2):125-130(1997).
XX
DR   MD5; d640b406686c6bb786fb012d635934b4.
DR   Ensembl-Gn; ENSMUSG00000025510; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033234; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033216; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033148; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033217; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032931; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033728; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032261; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032903; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033055; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033008; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033150; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033041; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033748; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031965; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032372; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000058746; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106000; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177840; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0087636; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0087723; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0087658; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0087678; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087241; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088182; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0087769; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0087183; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087378; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087222; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087410; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087261; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0088480; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0087168; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0086279; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1819
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /cell_line="WEHI Cell"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        328..1089
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="SFA-1"
FT                   /db_xref="GOA:O35566"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:1096360"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35566"
FT                   /protein_id="BAA22447.1"
FT                   /translation="MGEFNEKKATCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALK
FT                   SDYISLLASSTYLATAYILVVAGVVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLE
FT                   IIAGILAYVYYQQLNTELKENLKDTMVKRYHQSGHEGVSSAVDKLQQEFHCCGSNNSQD
FT                   WQDSEWIRSGEADSRVVPDSCCKTMVAGCGKRDHASNIYKVEGGCITKLETFIQEHLRV
FT                   IGAVGIGIACVQVFSMIFTCCLYRSLKLEHY"
XX
SQ   Sequence 1819 BP; 394 A; 482 C; 498 G; 445 T; 0 other;
     ggccgagcgt tctctgtact ccgagtgatc gctcctaccg tggctgccgg ggctggtatt        60
     tcaaagcgtg gttggtgagt gccccgtgaa gcatagccgg agggtgtggg gagcagtgtc       120
     ctgagttcct cgctcactgg tgttcctagt ctccaagctg gcctcaggga cgcccaggtg       180
     gcagagcctg agatctggtg gctctgagaa ccattttgac cactgcttaa gcttctgtag       240
     ttggagtggc aagatcccac ctgctaggtg aagggcagag agtgactttt gacctgtacc       300
     tgctggtcct gacttgagag gcccgggatg ggtgaattca atgagaagaa ggcaacatgt       360
     ggcacagtct gcctcaagta cctgctcttt acctacaact gctgcttctg gctggccggc       420
     ctggctgtca tggcagtggg catctggaca ctggccctca agagtgacta cattagtctg       480
     ctggcctcaa gcacttacct agccacggcc tacatcttag tggtggctgg tgttgttgtc       540
     atggtgactg gagtcctggg ctgctgtgcc actttcaagg agcgacggaa cctgttacgc       600
     ttgtacttca tcctgctcct catcatcttc ctcctggaga tcattgctgg catcctggcc       660
     tatgtctatt atcagcagct gaacacagag ctcaaggaga atctgaagga caccatggtc       720
     aagagatacc accagtcagg ccacgagggt gtgagcagcg ctgtcgacaa gctgcagcaa       780
     gagttccact gttgtggcag caacaactct caagactggc aagacagcga gtggatccgc       840
     tctggtgagg cagacagccg cgtggttcct gacagctgct gtaagactat ggtagctggc       900
     tgtggtaagc gggaccatgc ctccaacatc tataaagtgg agggtggctg tatcactaag       960
     ctggagacct tcattcagga gcacctgcgg gtcattgggg cggtgggcat tggcatcgcc      1020
     tgtgtgcagg tcttcagcat gatcttcacc tgctgcttgt accgaagcct caagctggaa      1080
     cactactgac cacgatgatg tcaggccggg cggccagcct tgcactatgt gccagcccca      1140
     ctactgaaca ctactgactt agactgctga ctgccagagg tagctaccct catgccatcg      1200
     ccatgacccc cctggcatgc cacctcaggg gcatgcatct tcaagattgc tttcactgca      1260
     caccaaagtc ccaaagctcg gaggcagcga actgccccag cattaagggg gggggagggg      1320
     ggttcaaatg ccagggttgg ctaggcctgc ctgtagaata gggtttagct tatttgacag      1380
     aggtgcctat tatgcagact gcttcccttt gggttgctgt gatctgcaga aagtctggga      1440
     gacctgtgat accactacac gttgggtaaa agcaggtggg cctttctggt tggcttaggc      1500
     acccttaatg cctgctacca ggaactctca gatctgttgc cccaaacaaa tggtgtaagc      1560
     tgagggaaac tccaacccca cacttgatgc tctgtcctct ccacacaggc ctcttgctcc      1620
     taacagctca gccctggcct tttctcacta ctgatagcat catgtaaatg ctccatgttc      1680
     ctgacactgt ctccttttgg agcatctctg aatggagcat ggctgttttc atctcactgc      1740
     tgtattccag atgctgccca caaatgctcc tgctatgtaa caggtgctca ataaatgtaa      1800
     atgtataagt aaaaaaaaa                                                   1819
//

If you have problems or comments...

PBIL Back to PBIL home page