(data stored in SCRATCH zone)

GenBank: ECORNPBW

LOCUS       ECORNPBW                4434 bp    DNA     linear   BCT 26-JUL-2016
DEFINITION  Escherichia coli K-12 genes for RNA component of RNaseP,
            hypothetical proteins, partial and complete cds.
ACCESSION   D90212
VERSION     D90212.1
KEYWORDS    .
SOURCE      Escherichia coli str. K-12 substr. W3110
  ORGANISM  Escherichia coli str. K-12 substr. W3110
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 3056 to 3818)
  AUTHORS   Reed,R.E. and Altman,S.
  TITLE     Repeated sequences and open reading frames in the 3' flanking
            region of the gene for the RNA subunit of Escherichia coli
            ribonuclease P
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 80 (17), 5359-5363 (1983)
   PUBMED   6351058
REFERENCE   2  (bases 4325 to 4434)
  AUTHORS   Schweizer,H.P. and Datta,P.
  TITLE     The complete nucleotide sequence of the tdc region of Escherichia
            coli
  JOURNAL   Nucleic Acids Res. 17 (10), 3994 (1989)
   PUBMED   2660107
REFERENCE   3
  AUTHORS   Komine,Y. and Inokuchi,H.
  TITLE     Precise mapping of the rnpB gene encoding the RNA component of
            RNase P in Escherichia coli K-12
  JOURNAL   J. Bacteriol. 173 (5), 1813-1816 (1991)
   PUBMED   1705543
COMMENT     These data kindly submitted in computer readable form by: Yuriko
            Komine
            Department of Biophyics
            Faculty of Science, Kyoto University
            Sakyo-ku, Kyoto 606
            Japan.
FEATURES             Location/Qualifiers
     source          1..4434
                     /organism="Escherichia coli str. K-12 substr. W3110"
                     /mol_type="genomic DNA"
                     /strain="K-12"
                     /sub_strain="W3110"
                     /db_xref="taxon:316407"
                     /map="68 min"
                     /clone="6B5(#515)"
                     /clone_lib="Kohara's Library"
                     /note="originally submitted as 'Escherichia coli K12'"
     CDS_pept        <1..507
                     /note="ORF1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="BAA14237.1"
                     /translation="DIGFYNFLIPFVETKEEAELAVASTRYPPEGIRGVSVSHRANMF
                     GTVADYFAQSNKNITILVQIESQQGVDNVDAIAATEGVDGIFVGPSDLAAALGHLGNA
                     SHPDVQKAIQHIFNRASAHGKPSGILAPVEADARRYLEWGATFVAVGSDLGVFRSATQ
                     KLADTFKK"
     CDS_pept        528..1427
                     /note="ORF2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="BAA14238.1"
                     /translation="MIDMTMKVGFIGLGIMGKPMSKNLLKAGYSLVVADRNPEAIADV
                     IAAGAETASTAKAIAEQCDVIITMLPNSPHVKEVALGENGIIEGAKPGTVLIDMSSIA
                     PLASREISEALKAKGIDMLDAPVSGGEPKAIDGTLSVMVGGDKAIFDKYYDLMKAMAG
                     SVVHTGEIGAGNVTKLANQVIVALNIAAMSEALTLATKAGVNPDLVYQAIRGGLAGST
                     VLDAKAPMVMDRNFKPGFRIDLHIKDLANALDTSHGVGAQLPLTAAVMEMMQALRADG
                     LGTADHSALACYYEKLAKVEVTR"
     CDS_pept        1443..2669
                     /note="ORF3"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="BAA14239.1"
                     /translation="MAYCNPGLESRPNKRNALRRHVVTGIGMKIVIAPDSYKESLSAS
                     EVAQAIEKGFREIFPDAQYVSVPVADGGEGTVEAMIAATQGAERHAWVTGPLGEKVNA
                     SWGISGDGKTAFIEMAAASGLELVPAEKRDPLVTTSRGTGELILQALESGATNIIIGI
                     GGSATNDGGAGMVQALGAKLCDANGNEIGFGGGSLNTLNDIDISGLDPRLKDCVIRVA
                     CDVTNPLVGDNGASRIFGPQKGASEAMIVELDNNLSHYAEVIKKALHVDVKDVPGAGA
                     AGGMGAALMAFLGAELKSGIEIVTTALNLEEHIHDCTLVITGEGRIDSQSIHGKVPIG
                     VANVAKKYHKPVIGIAGSLTDDVGVVHQHGIDAVFSVLTSIGTLDEAFRGAYDNICRA
                     SRNIAATLAIGMRNAG"
     gene            2702..3078
                     /gene="rnpB"
     ncRNA           2702..3078
                     /ncRNA_class="RNase_P_RNA"
                     /gene="rnpB"
                     /product="RNA component of RNaseP"
                     /note="mature M1-RNA"
     variation       3201
                     /citation=[1]
                     /replace=""
     variation       3278
                     /citation=[1]
                     /replace=""
     variation       3313
                     /citation=[1]
                     /replace="ta"
     variation       3332
                     /citation=[1]
                     /replace="gt"
     variation       3661
                     /citation=[1]
                     /replace=""
     CDS_pept        complement(3691..>4434)
                     /note="ORFX"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="BAA14240.1"
                     /translation="DIVDLSSLDLRNVDLDYYDFTDKHMANTILNPFKLNSTNFTNAN
                     MFQVNFVSSTQNATISWDYLLKITPVLISISDMYSEEKIKFVESCLNEPGDITEEQLK
                     IMRFAIIKSIPRATLTDKLENELTKEIYKSSSKIINCLNRIKLTEMKEFSSEKIYDYI
                     DIIIEDYENTKENAYLVVPQINYTMDLNIEDSSSEELLSDNTLEKDENSPDNGFEVGE
                     YNTYEAYNSEKQYFTREDYTYDYDLLNAI"
ORIGIN
        1 gatatcggtt tctataactt cctgattcct tttgtagaaa caaaagagga agcagagctg
       61 gcggtggcat caacccgtta cccaccggaa ggcattcgcg gcgtctccgt ttctcaccgc
      121 gccaatatgt ttggcaccgt ggcggattat ttcgctcagt cgaacaagaa catcactatt
      181 ctggtccaga tagaaagtca gcagggcgta gataacgtcg atgccattgc cgctaccgaa
      241 ggcgtagacg gcatcttcgt cggccccagc gatctggccg cggcattagg ccatctcggc
      301 aatgcatcac acccggatgt acaaaaagca attcagcaca tttttaaccg tgccagcgcg
      361 cacggcaaac ccagcggtat cctcgcgccg gtcgaagccg atgcgcgtcg ttatctggaa
      421 tggggcgcga cgtttgtggc tgtcggcagc gatctcggcg tcttccgctc tgccactcag
      481 aaactggctg atacctttaa aaaataacca ccaccgcaac aagagagatg attgatatga
      541 ctatgaaagt tggttttatt ggcctgggga ttatgggtaa accaatgagt aaaaaccttc
      601 tgaaagcagg ttactcgctg gtggttgctg accgtaaccc agaagctatt gctgacgtga
      661 ttgctgcagg tgcagaaaca gcgtctacgg ctaaagcgat cgctgaacag tgcgacgtca
      721 tcataaccat gctgccaaac tcccctcatg tgaaagaggt ggcgctgggt gagaatggca
      781 ttattgaagg cgcgaagcca ggtacggtat tgatcgatat gagttctatc gcaccgctgg
      841 caagccgtga aatcagcgaa gcgctgaaag cgaaaggcat tgatatgctg gatgctccgg
      901 tgagcggcgg tgaaccgaaa gccatcgacg gtacgctgtc agtgatggtg ggcggcgaca
      961 aggctatttt cgacaaatac tatgatttga tgaaagcgat ggcgggttcc gtggtgcata
     1021 ccggggaaat cggtgcaggt aacgtcacca aactggcaaa tcaggtcatt gtggcgctga
     1081 atattgccgc gatgtcagaa gcgttaacgc tggcaactaa agcgggcgtt aacccggacc
     1141 tggtttatca ggcaattcgc ggtggactgg cgggcagtac cgtgctggat gccaaagcgc
     1201 cgatggtgat ggaccgcaac ttcaagccgg gcttccgtat tgatctgcat attaaggatc
     1261 tggcgaatgc gctggatact tctcacggcg tcggcgcaca actgccgctc acagctgcgg
     1321 ttatggagat gatgcaggca ctgcgagcag atggtttagg aacggcggat catagcgccc
     1381 tggcgtgcta ctacgaaaaa ctggcgaaag tcgaagttac tcgttaatga cgtcgtgccc
     1441 ggatggcgta ttgcaatccg ggcctggaat ccaggccgaa taagagaaac gccctccggc
     1501 gtcatgtggt aacaggcata ggtatgaaaa tcgtaatcgc cccagactct tataaagaaa
     1561 gtttatctgc cagcgaggtt gcgcaggcga tagaaaaagg atttcgggaa atttttcctg
     1621 atgcacagta cgtttctgtt ccggttgccg acggtggcga aggaacggtg gaagcgatga
     1681 ttgcagccac ccagggggct gaacgtcacg cctgggttac agggccgctg ggcgagaaag
     1741 tgaatgccag ttgggggatc tccggcgatg gcaaaaccgc gtttattgaa atggcggcgg
     1801 ccagtgggct ggagctggta cctgcggaaa aacgcgatcc actcgtgacc acttcacgcg
     1861 gcacaggcga gttaatcctg caggcgctgg agagcggtgc gacaaacatt attatcggca
     1921 ttggcggcag cgctacaaat gatggcggcg caggcatggt acaggcgctg ggggcgaaat
     1981 tatgcgacgc caacggcaat gaaattggtt ttggcggcgg tagtcttaat actctgaatg
     2041 atattgatat ttccggcctc gatccgcgct taaaagattg cgtcattcgc gtcgcttgtg
     2101 atgtcaccaa tccgctggtg ggcgataacg gcgcatcgcg catctttggc ccacaaaagg
     2161 gagccagtga agcgatgatt gttgagctgg acaataacct ctctcactat gccgaggtca
     2221 ttaaaaaagc gctgcatgtt gatgtgaaag atgtccccgg tgcaggagct gcgggtggta
     2281 tgggcgcggc gctaatggcg tttcttggtg cggaactgaa aagtggtatt gaaatcgtca
     2341 ctacggcgct gaatctggag gaacatattc acgattgtac gctggtgatc accggtgaag
     2401 ggcgtattga cagccagagt attcacggga aggtaccgat tggtgtcgca aacgtggcga
     2461 agaagtacca taaaccggtg attggcattg cgggtagcct gaccgatgat gttggcgttg
     2521 tacatcagca tggcattgat gcggtcttca gcgtattgac cagcataggt acgttggacg
     2581 aagcattccg cggggcttat gacaatatct gccgtgcttc acgtaatatc gccgcgacac
     2641 tggcgattgg aatgcgcaac gcggggtgac aagggcgcgc aaaccctcta tactgcgcgc
     2701 cgaagctgac cagacagtcg ccgcttcgtc gtcgtcctct tcgggggaga cgggcggagg
     2761 ggaggaaagt ccgggctcca tagggcaggg tgccaggtaa cgcctggggg ggaaacccac
     2821 gaccagtgca acagagagca aaccgccgat ggcccgcgca agcgggatca ggtaagggtg
     2881 aaagggtgcg gtaagagcgc accgcgcggc tggtaacagt ccgtggcacg gtaaactcca
     2941 cccggagcaa ggccaaatag gggttcataa ggtacggccc gtactgaacc cgggtaggct
     3001 gcttgagcca gtgagcgatt gctggcctag atgaatgact gtccacgaca gaacccggct
     3061 tatcggtcag tttcacctga tttacgtaaa aacccgcttc ggcgggtttt tgcttttgga
     3121 ggggcagaaa gatgaatgac tgtccacgac gctataccca aaagaaagcg gcttatcggt
     3181 cagtttcacc tggtttacgt aaaaacccgc ttcggcgggt ttttgctttt ggaggggcag
     3241 aaagatgaat gactgtccac gacactatac ccaaaagaaa gcggcttatc ggtcagtttc
     3301 acctgtttta cgtaaaaacc cgcttcggcg ggttttactt ttggaggggc agaaagatga
     3361 atgactgtcc acgacactat acccaaaaga aagcggctta tcggtcagtt ttacctgatg
     3421 tacgtaataa accgttccgg cgggtttcag attgttgagt gcgctttatt catgccggat
     3481 gcggcgtgaa cgccttatcc tgcctacaaa agcacgcaaa ttcaatatat tgcagagatg
     3541 gcgtaggcct gataagcgta gcgcatcagg catttttgcg gttgccatca gtttcaaacc
     3601 cgcgtcagtg agtttttgct tttggtgcac agggtaagat gaataaatat ctacggtatt
     3661 aataatagac tttgtaagaa gttattaagt ctatattgca tttaaaaggt cgtaatcata
     3721 cgtatagtcc tctctggtaa aatattgctt ctctgagtta tatgcttcat atgtgttata
     3781 ttccccgacc tcaaagccat tgtccggaga attttcgtct ttctcgaggg tattatctga
     3841 aagtaactct tctgagctag agtcttctat gtttaaatcc atagtataat taatttgggg
     3901 gacgaccaga taagcatttt ctttggtatt ttcataatct tcaatgatta tatcgatgta
     3961 atcatatatt ttttctgatg agaattcttt catctctgtt aatttaattc tgttcaagca
     4021 attgatgatt ttcgatgagc ttttatatat ttcttttgtt aattcatttt ctaatttatc
     4081 tgtaagagtt gcccttggta tagattttat aattgcaaat ctcataattt ttaattgttc
     4141 ttcggtaatg tctccaggct catttaaaca actttcgaca aacttgattt tttcttcaga
     4201 atacatatcg ctaatgctta ttaaaacagg cgttattttt agtaaataat cccaggagat
     4261 tgtggcgttt tgtgttgaac taacaaaatt aacctgaaac atgttggcat tagtaaaatt
     4321 tgttgaattc aatttaaaag gatttaaaat agtattagcc atatgtttat ctgtgaaatc
     4381 ataataatct aaatcgacat tacgtaagtc cagagaggat agatcaacga tatc
//

If you have problems or comments...

PBIL Back to PBIL home page