(data stored in ACNUC16935 zone)

EMBL: DQ067448

ID   DQ067448; SV 1; linear; mRNA; STD; MAM; 432 BP.
XX
AC   DQ067448;
XX
DT   14-JUN-2005 (Rel. 84, Created)
DT   14-JUN-2005 (Rel. 84, Last updated, Version 1)
XX
DE   Oryctolagus cuniculus nedd8 mRNA, complete cds.
XX
KW   .
XX
OS   Oryctolagus cuniculus (rabbit)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae; Oryctolagus.
XX
RN   [1]
RP   1-432
RA   Li Y., Li Y., Wang Z., Mai G.;
RT   "Neural precursor cell expressed, developmentally down-regulated gene 8
RT   (nedd8) in retina with circadian rhythm";
RL   Unpublished.
XX
RN   [2]
RP   1-432
RA   Li Y., Li Y., Wang Z., Mai G.;
RT   ;
RL   Submitted (18-MAY-2005) to the INSDC.
RL   Pathology, New York Medical College, Grasslands Reservation, Valhalla, NY
RL   10595, USA
XX
DR   MD5; 680fb8dc10ee32d5583a31cc6096f758.
DR   Ensembl-Gn; ENSOCUG00000002910; oryctolagus_cuniculus.
DR   Ensembl-Tr; ENSOCUT00000002907; oryctolagus_cuniculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..432
FT                   /organism="Oryctolagus cuniculus"
FT                   /mol_type="mRNA"
FT                   /country="New Zealand"
FT                   /tissue_type="retina with circadian rhythm"
FT                   /db_xref="taxon:9986"
FT   CDS_pept        34..279
FT                   /codon_start=1
FT                   /product="nedd8"
FT                   /note="neural precursor cell expressed developmentally
FT                   down-regulated gene 8"
FT                   /db_xref="GOA:Q4PLJ0"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038738"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4PLJ0"
FT                   /protein_id="AAY67833.1"
FT                   /translation="MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIY
FT                   SGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ"
XX
SQ   Sequence 432 BP; 112 A; 104 C; 120 G; 96 T; 0 other;
     tttatccgtg tgcagcccca aactgggaag aagatgctaa ttaaagtgaa gacgctgact        60
     ggaaaggaga ttgaaattga cattgaaccc acagacaagg tggagcgaat caaggagcgt       120
     gtggaggaga aagagggcat ccccccccaa cagcagcggc tcatctacag tggcaaacag       180
     atgaatgatg agaagacagc agcagattac aagatccttg gtgggtcagt cctccacctg       240
     gtgttggctc tgagaggagg aggtggtctt aggcagtgat ggacccttcc tccattttac       300
     ctccttaccc tgtcgctcat aatgaagcat catatattct gtcactctct gggacaccag       360
     agccactgcc ctgtcccctg gatgcccagt cttgtgtgtt ctactggtgg gagacttgtg       420
     agggccccag ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page