(data stored in ACNUC10083 zone)

EMBL: DQ073465

ID   DQ073465; SV 1; linear; mRNA; STD; MAM; 3554 BP.
XX
AC   DQ073465;
XX
DT   21-JUN-2005 (Rel. 84, Created)
DT   21-JUN-2005 (Rel. 84, Last updated, Version 1)
XX
DE   Bos taurus chloride channel 7 (CLCN7) mRNA, complete cds.
XX
KW   .
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RP   1-3554
RA   Rae J.L.;
RT   "Ion channels in ocular epithelia";
RL   Unpublished.
XX
RN   [2]
RP   1-3554
RA   Rae J.L.;
RT   ;
RL   Submitted (24-MAY-2005) to the INSDC.
RL   Physiology and Biomedical Engineering, Mayo Clinic College of Medicine, 200
RL   1st Street SW, Rochester, MN 55905, USA
XX
DR   MD5; 580cd0863d6aa84cb580d8de27cfb2eb.
DR   Ensembl-Gn; ENSBTAG00000015889; bos_taurus.
DR   Ensembl-Tr; ENSBTAT00000021122; bos_taurus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3554
FT                   /organism="Bos taurus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="lens epithelium"
FT                   /db_xref="taxon:9913"
FT   gene            1..3554
FT                   /gene="CLCN7"
FT   CDS_pept        49..2478
FT                   /codon_start=1
FT                   /gene="CLCN7"
FT                   /product="chloride channel 7"
FT                   /note="CLC7; CLC-7"
FT                   /db_xref="GOA:Q4PKH3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR002249"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4PKH3"
FT                   /protein_id="AAY82470.1"
FT                   /translation="MANVSKKVSWSGRDLDDDEAAPLLRRAPRLGVPAGEAAPLLNGAG
FT                   PAAARASPHSAFFRIGQLSSVELDDELLDPDMDPPHPFPREIPHNEKLLSLKYESLDYD
FT                   NSENQLFLEEERRINHTAFRTVEIKRWVICAMVGILTGLVACFIDIVVEKLAGLKYRLV
FT                   KDNIDRFTEHGGLSFSLLLWAALNAAFVLLGSTIVAFIEPVAAGSGIPQIKCFLNGVKI
FT                   PHVVRLKTLVIKVSGVILSVVGGLAVGKEGPMIHSGSVIAAGISQGRSTSLKRDFKIFE
FT                   YFRRDTEKRDFVSAGAAAGVSAAFGAPVGGVLFSLEEGASFWNQFLTWRIFFASMISTF
FT                   TLNFVLSIYHGNAWDLSSPGLINFGRFDTETMVYVIHEIPIFIAMGVVGGILGAVFNAL
FT                   NYWLTMFRIRYVHRPCLQVVEATLVAAVTATAAFVLIYSSRDCQPLRGSSVSYPLQLFC
FT                   ADGEYNSMAVAFFNTPEKSVVSLFHDPPGSYNPMTLGLFTLVYFFLACWTYGLTVSAGV
FT                   FIPSLLIGAAWGRLFGISLSYITGAAVWADPGKYALMGAAAQLGGIVRMTLSLTVIMME
FT                   ATSSVTYGFPIMLVLMTAKIVGDVFIEGLYDMHIQLQSVPFLHWEAPVTSHSLTAREVM
FT                   STPVTCLRRREKVGVIVDVLSSTASNHNGFPVVEDADGTQPARLQGLILRSQLIVLLKH
FT                   KVFVERSSMGLLRRRLRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPSPYTVP
FT                   QEASLPRVFKLFRALGLRHLVVVDNCNQVVGLVTRKDLARYRLGKGGLEELSLAQT"
XX
SQ   Sequence 3554 BP; 607 A; 1110 C; 1128 G; 709 T; 0 other;
     agaacaaaca cggccgcggc gccggcggcc ggtccactgc ggccggacat ggccaacgtt        60
     tccaagaagg tgtcgtggtc cggccgcgac ctggacgacg acgaggcggc gccgctgctg       120
     cggagggcgc cgcggctcgg ggtgccggcc ggcgaggcgg cgccgctgct gaacggggct       180
     gggcccgcgg ccgcccgcgc gtcaccacac tcggcattct ttcggatcgg acagttgagc       240
     agcgtggagc tggatgatga gcttctggac cctgacatgg acccccctca ccccttcccc       300
     agggagatcc cacacaacga gaagctgctg tccctcaagt acgagagcct ggactacgac       360
     aacagtgaga accagctgtt cctggaggaa gagcggcgta tcaaccacac ggctttccgg       420
     acggtggaga tcaagcgctg ggtcatctgc gccatggtgg gcatcctcac gggtctcgtg       480
     gcctgcttca tcgacatcgt ggtggagaag ctggccggcc tcaagtacag gctcgtcaag       540
     gacaacatcg acaggttcac cgagcatggc ggactgtcct tctccctcct gctctgggcc       600
     gcactcaatg ccgccttcgt gctcctcggc tccaccatcg tcgccttcat agagccggtt       660
     gctgctggca gcgggatccc ccagatcaag tgcttcctca atggggtgaa gatcccccac       720
     gtggtcaggc tcaagaccct ggtgatcaaa gtgtctggcg tgatcctgtc agtggtgggg       780
     ggactggccg tggggaagga ggggccgatg atccactcgg gctcggtgat cgccgcgggc       840
     atctcccagg gcaggtccac gtcgctgaag cgggacttca agatcttcga gtactttcgc       900
     agagacacag agaagcggga cttcgtctcg gcaggagctg cagctggagt gtccgcagcc       960
     tttggggccc ctgtgggtgg ggtgctgttc agcttggagg agggcgcgtc cttctggaac      1020
     cagttcctga cgtggagaat cttctttgct tccatgatct ccactttcac cttgaacttc      1080
     gtcctgagta tttaccatgg gaacgcgtgg gacctgtcca gccctgggct catcaacttt      1140
     ggaagatttg atactgagac catggtgtac gtgatccacg agatccccat cttcatcgcc      1200
     atgggtgttg tggggggcat tctcggagct gtgttcaacg ccttgaatta ctggctgacg      1260
     atgtttcgaa tcaggtacgt ccaccggccc tgcctccagg tggtcgaggc cacgctggtc      1320
     gccgccgtca ccgccacggc cgccttcgtg ctcatctact catcccggga ctgtcagcct      1380
     ctgcggggga gctccgtgtc ctaccccctc cagctcttct gtgctgatgg ggagtacaac      1440
     tcgatggccg tggccttctt caacaccccg gagaagagcg tggtcagcct tttccacgac      1500
     cccccaggct cctacaaccc catgacgctc ggcctgttta ccctggtcta cttcttcctg      1560
     gcctgctgga cctacgggct cacggtgtca gccggcgtct tcattccgtc cctcctcatt      1620
     ggggctgcct ggggccggct gttcggcatc tccctgtcct acatcacggg ggctgcggtc      1680
     tgggcggacc ctggcaagta cgccctaatg ggagccgctg cgcagctggg tgggatcgtg      1740
     aggatgacgc tgagcctgac ggtcatcatg atggaggcca ccagcagtgt gacctacggc      1800
     ttccccatca tgctggtgct catgaccgcc aagatcgtgg gggacgtctt catcgagggc      1860
     ctgtatgaca tgcacatcca gctgcagagc gtgcccttct tgcactggga ggcccctgtc      1920
     acctcgcact cactcaccgc cagggaggtg atgagcacgc cggtcacctg cctgcggagg      1980
     agggagaagg tgggcgtcat cgtggacgtg ctgagcagca cggcgtccaa tcacaacggc      2040
     ttccccgtgg tggaggatgc tgacggcacg cagccagctc ggctccaggg cttgatcctg      2100
     cgctctcagc tcatcgtcct actcaagcac aaggtgttcg tggagcgctc cagcatgggc      2160
     ctgctgcgac gccggctgcg gctgaaggac ttccgtgacg cctacccacg cttcccccca      2220
     atccagtcca tccacgtgtc acaggatgag cgggagtgca ccatggacct gtctgagttc      2280
     atgaacccct cgccctacac ggtgccccag gaggcgtccc tcccacgggt gttcaagctg      2340
     ttccgggccc tgggcctccg gcacctggtg gtggtggaca attgcaatca ggtggtcggg      2400
     ttggtgacca ggaaggacct cgccaggtac cggcttggaa aggggggcct ggaggagctc      2460
     tctctggccc agacgtgagg ctctggcgcc tgcacctccc ccagggccct gccccactcc      2520
     ctggcagcag atccagtgac cgcaagacgt tggggatggc ctggccagtg tgtggcgcac      2580
     atggacgctc tgtgttctca gtgttccctc ccccaatctc acccctgggg tcccacaccc      2640
     agcctcctgt tcctgattct ttaggaatct gtgcaactgc tgttttcttc ccaagagccc      2700
     gtgagcacgc atgtctgcgt gtgtgcgagg ggacagctgg cgagcagggg cccgtgggtc      2760
     tgagtgctgc agccccacga cgggctggtt cctaggcctg cgccctgagc accaccagcg      2820
     gctgcagcag acacccctgg ccctggccct cgggcctcgg ctcggttggt ggccgtcagg      2880
     ttttgggtct ggacagagac ccgaactgga ggcacagagg cgaaggcttg gggagcagga      2940
     ccaccctgga gcgcagaccc cagagccgga ctcctagact cacctctgca gccctggctt      3000
     cacccccctc agtgcagtgg ggtctgcgcc ggggtctggg cccaggggga gacctgagac      3060
     cctcgttcag gcctggaccc ccgagtcaaa ccacgcctct gttaccacgc cctttgtgga      3120
     caccgctggg aaggcggatc ttcttggcac atggcgcccc aatggccctg agtgatactc      3180
     tatagcagct ctgcttccag gattgggggc aggggctttc tgggatgagt cagcgagccc      3240
     agagcaggga cgcacccttc ccaggtcggg caggcccaga gctgggatgc tgtgtccctg      3300
     aggccccacc ggacttttct tctgcaggga ctggcgtccc tgacccactc tggtggcagc      3360
     catggatggc tctgtggtgg gttggcaggc gttccagctg tgtttcagcc cctttaaagg      3420
     gggtggggcc tcagaaggtg gctctcttgc tggtggggaa gccctccgtg gggggcacgg      3480
     gggtctgatt gtggggatct gaatggaaga aataaaggaa tggtactgat aaaaaaaaaa      3540
     aaaaaaaaaa aaaa                                                        3554
//

If you have problems or comments...

PBIL Back to PBIL home page