(data stored in ACNUC17492 zone)

EMBL: DQ150111

ID   DQ150111; SV 2; linear; mRNA; STD; MAM; 1265 BP.
XX
AC   DQ150111;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   25-MAY-2006 (Rel. 87, Last updated, Version 2)
XX
DE   Sus scrofa regulator of G-protein signaling 2 (RGS2) mRNA, RGS2-GOS8
DE   allele, complete cds.
XX
KW   .
XX
OS   Sus scrofa (pig)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae; Sus.
XX
RN   [1]
RP   1-1265
RA   Yao W.;
RT   ;
RL   Submitted (31-JUL-2005) to the INSDC.
RL   College of Life Science & Technology, Huazhong Agricultural University,
RL   Lion Street, Wuhan, Hubei 430070, China
XX
RN   [2]
RC   Sequence update by submitter
RP   1-1265
RA   Yao W.;
RT   ;
RL   Submitted (24-MAY-2006) to the INSDC.
RL   College of Life Science & Technology, Huazhong Agricultural University,
RL   Lion Street, Wuhan, Hubei 430070, China
XX
DR   MD5; 2d50e49feedb4188b19e20ec737cdefd.
DR   Ensembl-Gn; ENSSSCG00000037241; sus_scrofa.
DR   Ensembl-Gn; ENSSSCG00070012071; sus_scrofa_usmarc.
DR   Ensembl-Tr; ENSSSCT00000042452; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00070023534; sus_scrofa_usmarc.
DR   EuropePMC; PMC2904268; 20594294.
XX
CC   On May 24, 2006 this sequence version replaced gi:74026504.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1265
FT                   /organism="Sus scrofa"
FT                   /chromosome="10"
FT                   /map="10p"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9823"
FT   gene            1..1265
FT                   /gene="RGS2"
FT                   /allele="GOS8"
FT   CDS_pept        17..655
FT                   /codon_start=1
FT                   /gene="RGS2"
FT                   /allele="GOS8"
FT                   /product="regulator of G-protein signaling 2"
FT                   /note="Rgs2"
FT                   /db_xref="GOA:Q3S853"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="InterPro:IPR034947"
FT                   /db_xref="InterPro:IPR036305"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3S853"
FT                   /protein_id="AAZ94412.2"
FT                   /translation="MQSAMFLTVHHDCGPMDKSAGTGPKSEEKREKMKRTLLKDWKTRL
FT                   SYFLQNSSSPGKPKTGKKSKPQTFIKPSPEEAQLWAEAFDELLASKYGLAAFRAFLKSE
FT                   FCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQ
FT                   EATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCRKPPQITTEPHAT"
XX
SQ   Sequence 1265 BP; 361 A; 292 C; 328 G; 284 T; 0 other;
     gggagcgtag acgataatgc aaagtgctat gttcctgact gtccatcacg actgcggacc        60
     catggacaag agcgcaggca ccggccccaa aagcgaggag aagcgggaga agatgaagcg       120
     gaccctatta aaagattgga agacccgttt gagctacttc ttgcaaaact cctcctctcc       180
     tgggaagccc aaaaccggca agaaaagcaa accgcaaacc ttcatcaagc cttctcctga       240
     ggaagcacag ctgtgggcag aagcatttga tgagctgcta gccagcaaat atggtcttgc       300
     tgcattcaga gcttttttga aatctgaatt ctgtgaagaa aatattgaat tctggctggc       360
     ctgtgaagac ttcaaaaaaa caaagtcacc ccaaaagctg tcctccaaag ccaggaaaat       420
     atacactgac ttcatagaaa aagaagctcc aaaagagata aacatagact ttcaaaccaa       480
     aactctcatt gcccaaaaca tacaagaggc tacaagtggc tgctttacaa ctgcccagaa       540
     aagggtgtac agcttgatgg agaacaactc ttatccccgt ttcttggagt ctgaattcta       600
     ccaagacttg tgtaggaagc cgccgcagat caccacagag ccccatgcca catgagatgg       660
     aaacgggagc cccgcaacga ggacattgct ttttttcttt ttgtttccta gggggaaagg       720
     ctgtcacctg ccgaaaagac tgaccttgaa ttcagcctgg gtgttgagga aacattactc       780
     agaactattg attcggagtt agtgagtcag gaagccagga gcagtctagg agaagccggc       840
     actgggacag cttccagaac tgatggagca cagggaggca gtggccagga tgtggcgtgt       900
     ctcacgctgg gaaagcaggc acgcgagact gaagggtgac agtgtaacgc tatggtccaa       960
     gagcactgaa aatcaatagg tctgggatta tgtggcctta gctagctggc tgtacatact      1020
     tccctaactc agtccttgtc accccggagt ggtttagtgg tagcttttta gtcctaggtg      1080
     ccatgttact ctgtacaggg gtctcgacgt tcttacgact acaggtcctc agtactggcc      1140
     cgcgtgactc taaacctgaa acggtctgtg tttaaatggt cagttgctgt gtgtcacagg      1200
     atgagtgctg tggtgtagaa agcgacaatg tccgtgagga gtgccaaaaa ctgtcctgat      1260
     ggcag                                                                  1265
//

If you have problems or comments...

PBIL Back to PBIL home page