(data stored in ACNUC26070 zone)

EMBL: DQ192292

ID   DQ192292; SV 1; linear; mRNA; STD; HUM; 515 BP.
XX
AC   DQ192292;
XX
DT   05-JAN-2006 (Rel. 86, Created)
DT   05-JAN-2006 (Rel. 86, Last updated, Version 1)
XX
DE   Homo sapiens cardiac voltage-gated potassium channel accessory subunit
DE   isoform 3b (KCNE3) mRNA, partial cds, alternatively spliced.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-515
RX   DOI; 10.1016/j.ygeno.2005.09.004.
RX   PUBMED; 16303284.
RA   Lundquist A.L., Turner C.L., Ballester L.Y., George A.L.Jr.;
RT   "Expression and transcriptional control of human KCNE genes";
RL   Genomics 87(1):119-128(2006).
XX
RN   [2]
RP   1-515
RA   Lundquist A.L., George A.L.Jr.;
RT   ;
RL   Submitted (05-SEP-2005) to the INSDC.
RL   Genetic Medicine, Vanderbilt University, 2215 Garland Avenue, 529 Light
RL   Hall, Nashville, TN 37232-0275, USA
XX
DR   MD5; 6ed70d3b870d2d1e23c7a1857b8b5b0c.
DR   Ensembl-Gn; ENSG00000175538; homo_sapiens.
DR   Ensembl-Tr; ENST00000532569; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..515
FT                   /organism="Homo sapiens"
FT                   /chromosome="11"
FT                   /map="11q13-q14"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..>515
FT                   /gene="KCNE3"
FT   5'UTR           1..217
FT                   /gene="KCNE3"
FT   CDS_pept        218..>515
FT                   /codon_start=1
FT                   /gene="KCNE3"
FT                   /product="cardiac voltage-gated potassium channel accessory
FT                   subunit isoform 3b"
FT                   /note="MIRP2; alternatively spliced"
FT                   /db_xref="GOA:Q2N1I1"
FT                   /db_xref="H-InvDB:HIT000342393.10"
FT                   /db_xref="HGNC:HGNC:6243"
FT                   /db_xref="InterPro:IPR000369"
FT                   /db_xref="InterPro:IPR005426"
FT                   /db_xref="UniProtKB/TrEMBL:Q2N1I1"
FT                   /protein_id="ABB00305.1"
FT                   /translation="METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEE
FT                   RRASLPGRDDNSYMYILFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNR"
XX
SQ   Sequence 515 BP; 113 A; 146 C; 132 G; 124 T; 0 other;
     cttttctgcc ttctctcctg ctttctagct ctgggctttc ccagctccga agtcaatact        60
     gagatcccag atgtgtccag agacatcctg aagaggctcg ggggtggagg agccttagtg       120
     tgtccacaaa gggactcctg aaactgactg agagccagtg gatttgccag cagtctgagc       180
     ttctaccgag tcttccccca cctcaatccc tgttgctatg gagactacca atggaacgga       240
     gacctggtat gagagcctgc atgccgtgct gaaggctcta aatgccactc ttcacagcaa       300
     tttgctctgc cggccagggc cagggctggg gccagacaac cagactgaag agaggcgggc       360
     cagcctacct ggccgtgatg acaactccta catgtacatt ctctttgtca tgtttctatt       420
     tgctgtaact gtgggcagcc tcatcctggg atacacccgc tcccgcaaag tggacaagcg       480
     tagtgacccc tatcatgtgt atatcaagaa ccgtg                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page