(data stored in ACNUC18020 zone)

EMBL: DQ207609

ID   DQ207609; SV 1; linear; mRNA; STD; VRT; 269 BP.
XX
AC   DQ207609;
XX
DT   01-AUG-2006 (Rel. 88, Created)
DT   01-AUG-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Gallus gallus beta-actin mRNA, partial cds.
XX
KW   .
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-269
RA   Ferreira H.L., Spilki F.R., Cardoso T.C., Arns C.W.;
RT   "Chicken embryo continuous related cell line has mammalian phenotype";
RL   Unpublished.
XX
RN   [2]
RP   1-269
RA   Ferreira H.L., Spilki F.R., Cardoso T.C., Arns C.W.;
RT   ;
RL   Submitted (15-SEP-2005) to the INSDC.
RL   Department of Microbiology and Immunology, Biology Institute, State
RL   University of Campinas (UNICAMP), Campinas, SP 13081-970, Brazil
XX
DR   MD5; 50001851fc6b220d064ab41d4058d2ac.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..269
FT                   /organism="Gallus gallus"
FT                   /mol_type="mRNA"
FT                   /clone="CEF; chicken embryo fibroblast"
FT                   /cell_type="primary embryo fibroblast"
FT                   /db_xref="taxon:9031"
FT   CDS_pept        <1..>269
FT                   /codon_start=1
FT                   /product="beta-actin"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniProtKB/TrEMBL:Q0QWA1"
FT                   /protein_id="ABC41741.1"
FT                   /translation="MFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYE
FT                   GYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRD"
XX
SQ   Sequence 269 BP; 57 A; 80 C; 67 G; 65 T; 0 other;
     atgtttgaga ccttcaacac cccagccatg tatgtagcca tccaggctgt gctgtccctg        60
     tatgcctctg gtcgtaccac tggtattgtg atggactctg gtgatggtgt tacccacact       120
     gtgcccatct atgaaggcta cgccctcccc catgccatcc tgcgtctgga tctggctggc       180
     cgtgacctga cggactacct catgaagatc ctgacagaga gaggctacag cttcaccacc       240
     acagccgaga gagaaattgt gcgtgacat                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page