(data stored in ACNUC23059 zone)

EMBL: DQ213781

ID   DQ213781; SV 1; linear; mRNA; HTC; VRT; 1145 BP.
XX
AC   DQ213781;
XX
DT   28-SEP-2005 (Rel. 85, Created)
DT   22-AUG-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Taeniopygia guttata clone 0064P0015B04 putative cyclin-dependent kinase
DE   2-associated protein 1 mRNA, complete cds.
XX
KW   HTC.
XX
OS   Taeniopygia guttata (zebra finch)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Passeriformes; Passeroidea; Estrildidae;
OC   Estrildinae; Taeniopygia.
XX
RN   [1]
RP   1-1145
RX   DOI; 10.1073/pnas.0607098103.
RX   PUBMED; 17018643.
RA   Wada K., Howard J.T., McConnell P., Whitney O., Lints T., Rivas M.V.,
RA   Horita H., Patterson M.A., White S.A., Scharff C., Haesler S., Zhao S.,
RA   Sakaguchi H., Hagiwara M., Shiraki T., Hirozane-Kishikawa T., Skene P.,
RA   Hayashizaki Y., Carninci P., Jarvis E.D.;
RT   "A molecular neuroethological approach for identifying and characterizing a
RT   cascade of behaviorally regulated genes";
RL   Proc. Natl. Acad. Sci. U.S.A. 103(41):15212-15217(2006).
XX
RN   [2]
RP   1-1145
RA   Wada K., Jarvis E.D.;
RT   ;
RL   Submitted (21-SEP-2005) to the INSDC.
RL   Neurobiology, Duke University Medical Center, Box 3209, Durham, NC 27710,
RL   USA
XX
DR   MD5; 39c1187aec24532ce52a9c4a720acf1c.
DR   Ensembl-Gn; ENSTGUG00000005436; taeniopygia_guttata.
DR   Ensembl-Tr; ENSTGUT00000005644; taeniopygia_guttata.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1145
FT                   /organism="Taeniopygia guttata"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="PH47"
FT                   /clone_lib="subtracted (single juvenile learning minus
FT                   single male silent control)"
FT                   /clone="0064P0015B04"
FT                   /tissue_type="whole brain"
FT                   /note="common: zebra finch; authority: Taeniopygia guttata
FT                   Vieillot (1817); synonym: Poephila guttata"
FT                   /db_xref="taxon:59729"
FT   CDS_pept        88..456
FT                   /codon_start=1
FT                   /product="putative cyclin-dependent kinase 2-associated
FT                   protein 1"
FT                   /db_xref="GOA:B5FY46"
FT                   /db_xref="InterPro:IPR017266"
FT                   /db_xref="UniProtKB/TrEMBL:B5FY46"
FT                   /protein_id="ACH43957.1"
FT                   /translation="MSLGMSYKPNLNAHIPGTPLNPAGGVHSPSTSMATSAQYRQLIND
FT                   YGPPSLGYTQGMQGTSSSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIH
FT                   ARGLVRECLAETERNARS"
XX
SQ   Sequence 1145 BP; 350 A; 257 C; 211 G; 327 T; 0 other;
     ggctactgct gtaaacaacc caaagtgtct gggagacacg gagacgcttc gctgaatttc        60
     aggacgcttc tcctcctccc gctggccatg tctctgggaa tgtcttacaa gcccaacttg       120
     aacgcccaca tccccgggac tcccctcaac ccggctgggg gtgttcactc tccctccaca       180
     agtatggcaa catcggcaca atacagacag ctcataaacg actatggccc cccatctcta       240
     ggctatacac aagggatgca gggcaccagc agcagtcaag taccacagag caaatatgca       300
     gaacttctag ctatcataga agaattagga aaagagatta gacctacata tgctgggagt       360
     aaaagtgcga tggagaggct aaaaagaggc attatccatg ctagaggatt agttcgggaa       420
     tgcctggccg agacggaacg aaatgcgaga tcttagccca gtggttcagc tgcaaggtcc       480
     tccatctcct catgaagaaa aagtaacact tattcttttt gactcttgaa acattcagac       540
     aaactccttt attttgaatg ttttaccctt cttgttttgc ccttgcaaaa atgtacagtt       600
     aaaatgaaaa aaaataacaa ggatttttca acttactgag ggtttgcatt ttctaaggac       660
     gttaaaaccc cctaaaatgt ttctaaaata tggaaactga agtgcatgca gaagaatgct       720
     ctttctctcc caggctatat ttcagttctc ttcttatcca gccacagcct cattctgttt       780
     tttctttcct ttgactatgt tcagttatcc ccaaaacgtc aatctttcaa agtttgacat       840
     aagctctaag gatttttttt aataaaagca gaatagcatg ctgtacctag tagtctgcta       900
     agtcacaatt tgtcatacag catagaccct gcttagaaat aaccttcccc ttctcttatt       960
     ttttcctttt tttgttcact ttgcataaac atttgcatga ctgttagtgc tttgaagtcc      1020
     acttaaagtg catgagctat atggaaaata gggaaaccta ttaaataata acaaagtcct      1080
     ggaaagctaa tttctacatt aaggctggag atttcatttt aaagtttgca aaaaaaaaaa      1140
     aaaaa                                                                  1145
//

If you have problems or comments...

PBIL Back to PBIL home page