(data stored in ACNUC16935 zone)

EMBL: DQ216235

ID   DQ216235; SV 1; linear; mRNA; HTC; VRT; 1305 BP.
XX
AC   DQ216235;
XX
DT   28-SEP-2005 (Rel. 85, Created)
DT   22-AUG-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Taeniopygia guttata clone 0058P0048G02 putative ubiquitin C variant 1 mRNA,
DE   complete cds.
XX
KW   HTC.
XX
OS   Taeniopygia guttata (zebra finch)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Passeriformes; Passeroidea; Estrildidae;
OC   Estrildinae; Taeniopygia.
XX
RN   [1]
RP   1-1305
RX   DOI; 10.1073/pnas.0607098103.
RX   PUBMED; 17018643.
RA   Wada K., Howard J.T., McConnell P., Whitney O., Lints T., Rivas M.V.,
RA   Horita H., Patterson M.A., White S.A., Scharff C., Haesler S., Zhao S.,
RA   Sakaguchi H., Hagiwara M., Shiraki T., Hirozane-Kishikawa T., Skene P.,
RA   Hayashizaki Y., Carninci P., Jarvis E.D.;
RT   "A molecular neuroethological approach for identifying and characterizing a
RT   cascade of behaviorally regulated genes";
RL   Proc. Natl. Acad. Sci. U.S.A. 103(41):15212-15217(2006).
XX
RN   [2]
RP   1-1305
RA   Wada K., Jarvis E.D.;
RT   ;
RL   Submitted (21-SEP-2005) to the INSDC.
RL   Neurobiology, Duke University Medical Center, Box 3209, Durham, NC 27710,
RL   USA
XX
DR   MD5; 3f9157a32c5815a954f686af6bcc9b48.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1305
FT                   /organism="Taeniopygia guttata"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="PH67"
FT                   /clone_lib="normalized (50 mix pooled juveniles + adults)"
FT                   /clone="0058P0048G02"
FT                   /tissue_type="whole brain"
FT                   /note="common: zebra finch; authority: Taeniopygia guttata
FT                   Vieillot (1817); synonym: Poephila guttata"
FT                   /db_xref="taxon:59729"
FT   CDS_pept        69..806
FT                   /codon_start=1
FT                   /product="putative ubiquitin C variant 1"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:B5G2N9"
FT                   /protein_id="ACH45550.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDDNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKXVNSAPC
FT                   PAPERWHADLCEDPDWQDHHPGS"
XX
SQ   Sequence 1305 BP; 353 A; 332 C; 338 G; 281 T; 1 other;
     gagatccgag gttcagcacc ggtggataca ttttacagat ttatcgctcg gggccgcaga        60
     cgtcaacaat gcagatcttt gtgaagaccc tgaccggcaa gaccatcacc cttgaggtgg       120
     agcccagtga caccattgaa aatgtgaagg ccaagatcca ggacaaggag ggcattcccc       180
     cagaccagca gaggctgatc tttgctggca agcagctgga ggatgggcgc accctctccg       240
     acgacaacat ccagaaagag tcaactctcc acctggtgct gcgcctcaga ggtgggatgc       300
     agatcttcgt gaaaaccctg actggcaaga ccatcactct cgaggtggag cccagtgaca       360
     ccatcgagaa tgtcaaggcc aagatccagg acaaggaagg tattcctcct gaccagcaga       420
     ggctgatctt tgctggcaag cagctggaag atgggcgcac cctgtctgac tacaacatcc       480
     agaaggaatc caccctgcac ctggtgctgc gcctcagagg tgggatgcag atcttcgtca       540
     agaccctgac gggcaagacc atcaccctgg aagttgagcc cagtgacacc atcgagaacg       600
     tcaaggccaa gatccaggac aaggaaggta tccctccaga tcagcagagg ctgatctttg       660
     ctggcaagca gctggaggat gggcgcaccc tgtccgacta caacattcag aaangagtca       720
     actctgcacc ttgtcctgcg cctgagaggt ggcatgcaga tctttgtgaa gaccctgact       780
     ggcaagacca tcaccctgga agttgagccc agcgacacca ttgaaaatgt gaaggccaag       840
     atccaggaca aggagggcat tcccccagac cagcagaggc tgatttttgc tggcaagcag       900
     ctggaagatg ggcgcaccct ctccgactat aacatccaga aggaatccac cctgcacctg       960
     gtgctgcgcc tcaggggtgg ctgttaagtt cttgtgcatc ttgcttgaca ccagggttgc      1020
     cagtggcaca tgtgtttgca ctgtagttct tcaatgtctt aatattaagt taatgcaagc      1080
     ttgagtaact gctgaaccaa ctctgaaatg ctaataaagt tttctgttgc acattacacc      1140
     ctgtagtctg tctcagttca agcaggtgaa actggtgtgt taagtgaaat gctttagctt      1200
     cttaccttgg cagttcaagc ctctttgcat gtatgatgag gaccaacctt gtggttaaaa      1260
     tggatctgga ttaaaatctt aagtgctaat aaaaaaaaaa aaaaa                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page