(data stored in ACNUC16935 zone)

EMBL: DQ216242

ID   DQ216242; SV 1; linear; mRNA; HTC; VRT; 806 BP.
XX
AC   DQ216242;
XX
DT   28-SEP-2005 (Rel. 85, Created)
DT   22-AUG-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Taeniopygia guttata clone 0058P0038G08 putative ubiquitin C variant 4 mRNA,
DE   complete cds.
XX
KW   HTC.
XX
OS   Taeniopygia guttata (zebra finch)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Passeriformes; Passeroidea; Estrildidae;
OC   Estrildinae; Taeniopygia.
XX
RN   [1]
RP   1-806
RX   DOI; 10.1073/pnas.0607098103.
RX   PUBMED; 17018643.
RA   Wada K., Howard J.T., McConnell P., Whitney O., Lints T., Rivas M.V.,
RA   Horita H., Patterson M.A., White S.A., Scharff C., Haesler S., Zhao S.,
RA   Sakaguchi H., Hagiwara M., Shiraki T., Hirozane-Kishikawa T., Skene P.,
RA   Hayashizaki Y., Carninci P., Jarvis E.D.;
RT   "A molecular neuroethological approach for identifying and characterizing a
RT   cascade of behaviorally regulated genes";
RL   Proc. Natl. Acad. Sci. U.S.A. 103(41):15212-15217(2006).
XX
RN   [2]
RP   1-806
RA   Wada K., Jarvis E.D.;
RT   ;
RL   Submitted (21-SEP-2005) to the INSDC.
RL   Neurobiology, Duke University Medical Center, Box 3209, Durham, NC 27710,
RL   USA
XX
DR   MD5; de7a155646ebcc99475db909d5442f9d.
DR   Ensembl-Gn; ENSTGUG00000004987; taeniopygia_guttata.
DR   Ensembl-Tr; ENSTGUT00000005176; taeniopygia_guttata.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..806
FT                   /organism="Taeniopygia guttata"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="PH5"
FT                   /clone_lib="normalized (50 mix pooled juveniles + adults)"
FT                   /clone="0058P0038G08"
FT                   /tissue_type="whole brain"
FT                   /note="common: zebra finch; authority: Taeniopygia guttata
FT                   Vieillot (1817); synonym: Poephila guttata"
FT                   /db_xref="taxon:59729"
FT   CDS_pept        18..707
FT                   /codon_start=1
FT                   /product="putative ubiquitin C variant 4"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:B5G2P5"
FT                   /protein_id="ACH45556.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
FT                   LRLRGGN"
XX
SQ   Sequence 806 BP; 226 A; 219 C; 204 G; 157 T; 0 other;
     cgctgggtga gggaaaaatg cagatcttcg tcaaaaccct gactggcaag accatcaccc        60
     ttgaggtgga gcccagtgac accatcgaaa atgtcaaggc caagatccag gacaaggaag       120
     gtatccctcc agatcagcag aggctgattt tcgctggcaa gcagctggaa gatgggcgca       180
     ccctctccga ctacaacatc cagaaggaat ctactctgca ccttgtcctg cgcctgcggg       240
     gtgggatgca gatctttgtg aaaaccctga caggcaagac catcactctg gaagtcgagc       300
     ccagtgacac catcgagaat gtcaaggcca agatccagga caaggaaggc atccctcctg       360
     accagcagag gctgatcttt gctggcaagc agctggaaga tgggcgtacc ctctccgact       420
     acaacatcca gaaggaatct actctgcacc tcgtgctgcg cctcagaggt gggatgcaga       480
     tctttgtgaa gaccctgact ggcaagacta tcactctgga agtcgagccc agtgacacca       540
     ttgagaatgt caaggccaag atccaggaca aggaaggcat ccctcctgac cagcagaggc       600
     tgattttcgc tggcaagcag ctggaagatg ggcgaaccct ctctgactac aacatccaga       660
     aggaatctac tctgcacctt gtcctgcgcc tgcggggtgg taactaaacc agcacgttgc       720
     tgcttccaaa taaaaggttc cctgcacttg ttcattccaa taaagctctt gcatctgtaa       780
     aaaaaaaaaa aaaagagcct tggatc                                            806
//

If you have problems or comments...

PBIL Back to PBIL home page