(data stored in ACNUC16935 zone)

EMBL: DQ216244

ID   DQ216244; SV 1; linear; mRNA; HTC; VRT; 713 BP.
XX
AC   DQ216244;
XX
DT   28-SEP-2005 (Rel. 85, Created)
DT   22-AUG-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Taeniopygia guttata clone 0058P0008C01 putative ubiquitin C variant 4 mRNA,
DE   complete cds.
XX
KW   HTC.
XX
OS   Taeniopygia guttata (zebra finch)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Passeriformes; Passeroidea; Estrildidae;
OC   Estrildinae; Taeniopygia.
XX
RN   [1]
RP   1-713
RX   DOI; 10.1073/pnas.0607098103.
RX   PUBMED; 17018643.
RA   Wada K., Howard J.T., McConnell P., Whitney O., Lints T., Rivas M.V.,
RA   Horita H., Patterson M.A., White S.A., Scharff C., Haesler S., Zhao S.,
RA   Sakaguchi H., Hagiwara M., Shiraki T., Hirozane-Kishikawa T., Skene P.,
RA   Hayashizaki Y., Carninci P., Jarvis E.D.;
RT   "A molecular neuroethological approach for identifying and characterizing a
RT   cascade of behaviorally regulated genes";
RL   Proc. Natl. Acad. Sci. U.S.A. 103(41):15212-15217(2006).
XX
RN   [2]
RP   1-713
RA   Wada K., Jarvis E.D.;
RT   ;
RL   Submitted (21-SEP-2005) to the INSDC.
RL   Neurobiology, Duke University Medical Center, Box 3209, Durham, NC 27710,
RL   USA
XX
DR   MD5; d9601d51db768ddd0966859e9af78452.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..713
FT                   /organism="Taeniopygia guttata"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="adult"
FT                   /clone_lib="normalized (50 mix pooled juveniles + adults)"
FT                   /clone="0058P0008C01"
FT                   /tissue_type="whole brain"
FT                   /note="common: zebra finch; authority: Taeniopygia guttata
FT                   Vieillot (1817); synonym: Poephila guttata"
FT                   /db_xref="taxon:59729"
FT   CDS_pept        185..646
FT                   /codon_start=1
FT                   /product="putative ubiquitin C variant 4"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:B5G2P7"
FT                   /protein_id="ACH45558.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGN"
XX
SQ   Sequence 713 BP; 200 A; 195 C; 182 G; 136 T; 0 other;
     tgaggtggag cccagtgaca ccatcgaaaa tgtcaaggcc aagatccagg acaaggaagg        60
     tatccctcca gatcagcaga ggctgatttt cgctggcaag cagctggaag atgggcgcac       120
     cctctccgac tacaacatcc agaaggaatc tactctgcac cttgtcctgc gcctgcgggg       180
     tgggatgcag atctttgtga aaaccctgac aggcaagacc atcactctgg aagtcgagcc       240
     cagtgacacc atcgagaatg tcaaggccaa gatccaggac aaggaaggca tccctcctga       300
     ccagcagagg ctgatctttg ctggcaagca gctggaagat gggcgtaccc tctccgacta       360
     caacatccag aaggaatcta ctctgcacct cgtgctgcgc ctcagaggtg ggatgcagat       420
     ctttgtgaag accctgactg gcaagactat cactctggaa gtcgagccca gtgacaccat       480
     tgagaatgtc aaggccaaga tccaggacaa ggaaggcatc cctcctgacc agcagaggct       540
     gattttcgct ggcaagcagc tggaagatgg gcgaaccctc tctgactaca acatccagaa       600
     ggaatctact ctgcaccttg tcctgcgcct gcggggtggt aactaaacca gcacgttgct       660
     gcttccaaat aaaaggttcc ctgcacttgt tcattccaaa aaaaaaaaaa aaa              713
//

If you have problems or comments...

PBIL Back to PBIL home page