(data stored in SCRATCH zone)

EMBL: DQ250714

ID   DQ250714; SV 1; linear; genomic DNA; STD; PRO; 703 BP.
XX
AC   DQ250714;
XX
DT   14-NOV-2005 (Rel. 85, Created)
DT   16-JAN-2010 (Rel. 103, Last updated, Version 3)
XX
DE   Bacillus subtilis lipase gene, complete cds.
XX
KW   .
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-703
RA   Peerzada K., Johri S., Rasool S., Qazi G.N.;
RT   "Molecular characterization of a lipase from a strain of Bacillus
RT   subtilis";
RL   Unpublished.
XX
RN   [2]
RP   1-703
RA   Peerzada K., Johri S., Rasool S., Qazi G.N.;
RT   ;
RL   Submitted (20-OCT-2005) to the INSDC.
RL   Pharmacology, Regional Research Laboratory, Canal Road, Jammu, J and K
RL   180001, India
XX
DR   MD5; b735c25e3dc7fce98f344d2cc7838ba2.
DR   EuropePMC; PMC5253163; 27913840.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..703
FT                   /organism="Bacillus subtilis"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        65..703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="lipase"
FT                   /db_xref="GOA:P37957"
FT                   /db_xref="InterPro:IPR002918"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:1I6W"
FT                   /db_xref="PDB:1ISP"
FT                   /db_xref="PDB:1R4Z"
FT                   /db_xref="PDB:1R50"
FT                   /db_xref="PDB:1T2N"
FT                   /db_xref="PDB:1T4M"
FT                   /db_xref="PDB:2QXT"
FT                   /db_xref="PDB:2QXU"
FT                   /db_xref="PDB:3D2A"
FT                   /db_xref="PDB:3D2B"
FT                   /db_xref="PDB:3D2C"
FT                   /db_xref="PDB:3QMM"
FT                   /db_xref="PDB:3QZU"
FT                   /db_xref="PDB:5CRI"
FT                   /db_xref="PDB:5CT4"
FT                   /db_xref="PDB:5CT5"
FT                   /db_xref="PDB:5CT6"
FT                   /db_xref="PDB:5CT8"
FT                   /db_xref="PDB:5CT9"
FT                   /db_xref="PDB:5CTA"
FT                   /db_xref="PDB:5CUR"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37957"
FT                   /protein_id="ABB54395.1"
FT                   /translation="MKFVKRRIIALVTILMLSVTSLFALQPSVKAAEHNPVVMVHGIGG
FT                   ASFNFGGIKSYLVSHGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDI
FT                   VAHSMGGANTLYYIKNLDGGNKVANVVTVGGANRLTTGKALPGTDPNQKILYTSIYSSA
FT                   DMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN"
XX
SQ   Sequence 703 BP; 221 A; 130 C; 173 G; 179 T; 0 other;
     ccttacttaa ttaatttggt aacgtaatat aatggagaat ttgttacaaa aaaaggagga        60
     tattatgaaa tttgtaaaaa gaaggatcat tgcacttgta acaattttga tgctgtctgt       120
     tacatcgctg tttgcgttgc agccgtcagt aaaagccgct gaacacaatc cagtcgttat       180
     ggttcacggt attggagggg catcattcaa ttttggggga atcaaaagct atctcgtatc       240
     tcacggctgg tcgcgggaca agctgtatgc agttgatttt tgggacaaga caggcacaaa       300
     ttataacaat ggaccggtat tatcacgatt tgtgcaaaag gttttagatg aaacgggtgc       360
     gaaaaaagtg gatattgtcg ctcacagcat ggggggcgcg aacacacttt actacataaa       420
     aaatctggac ggcggaaata aagttgcaaa cgtcgtgacg gttggcggcg cgaaccgttt       480
     gacgacaggc aaggcgcttc cgggaacaga tccaaatcaa aagattttat acacatccat       540
     ttacagcagt gccgatatga ttgtcatgaa ttatttatca agattagacg gtgctagaaa       600
     cgttcaaatc catggcgttg gacacatcgg ccttctgtac agcagccaag tcaacagcct       660
     gattaaagaa gggctgaacg gcgggggcca gaatacaaac taa                         703
//

If you have problems or comments...

PBIL Back to PBIL home page