(data stored in ACNUC17492 zone)

EMBL: DQ285660

ID   DQ285660; SV 1; linear; genomic DNA; STD; MAM; 3892 BP.
XX
AC   DQ285660;
XX
DT   05-DEC-2005 (Rel. 86, Created)
DT   08-DEC-2005 (Rel. 86, Last updated, Version 4)
XX
DE   Sus scrofa regulator of G protein signaling 2 (RGS2) gene, RGS2-GOS8
DE   allele, complete cds.
XX
KW   .
XX
OS   Sus scrofa (pig)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae; Sus.
XX
RN   [1]
RP   1-3892
RA   Yao W., Yang Z.;
RT   ;
RL   Submitted (08-NOV-2005) to the INSDC.
RL   College of Life Science and Technology, Huazhong Agricultural University,
RL   Lion Street, Wuhan, Hubei 430070, China
XX
DR   MD5; f9eff2563ab00dea56ebd589c4818b75.
DR   Ensembl-Gn; ENSSSCG00000037241; sus_scrofa.
DR   Ensembl-Gn; ENSSSCG00070012071; sus_scrofa_usmarc.
DR   Ensembl-Tr; ENSSSCT00000042452; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00070023534; sus_scrofa_usmarc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3892
FT                   /organism="Sus scrofa"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9823"
FT   gene            <609..>3223
FT                   /gene="RGS2"
FT                   /allele="GOS8"
FT   mRNA            join(<609..718,1780..1881,1982..2043,2574..2740,
FT                   3026..>3223)
FT                   /gene="RGS2"
FT                   /allele="GOS8"
FT                   /product="regulator of G protein signaling 2"
FT   CDS_pept        join(609..718,1780..1881,1982..2043,2574..2740,3026..3223)
FT                   /codon_start=1
FT                   /gene="RGS2"
FT                   /allele="GOS8"
FT                   /product="regulator of G protein signaling 2"
FT                   /db_xref="GOA:Q3S853"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="InterPro:IPR034947"
FT                   /db_xref="InterPro:IPR036305"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3S853"
FT                   /protein_id="ABB89038.1"
FT                   /translation="MQSAMFLTVHHDCGPMDKSAGTGPKSEEKREKMKRTLLKDWKTRL
FT                   SYFLQNSSSPGKPKTGKKSKPQTFIKPSPEEAQLWAEAFDELLASKYGLAAFRAFLKSE
FT                   FCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFIEKEAPKEINIDSQTKTLIAQNIQ
FT                   EATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCRKPPQITTEPHAT"
XX
SQ   Sequence 3892 BP; 934 A; 965 C; 1009 G; 984 T; 0 other;
     gtgggtagcg ggcgtgcagt tgtgtgtgcg ggtggctgga ggtcgggcgg ttctatgctt        60
     gtgcggtgtt gtattcgctg tacgtgcgtg gcgtgcggtt tggcctgcgt ggtcgcctgg       120
     tacctggttg tggtttcccc cctctctcct gggcttcgct gttctcgggt ctcgtgggcg       180
     tatgtgcgct gttgttggtg ttttgtgatg tttctgtctg gcgcccttcg gtctctgcag       240
     tccacctcgc cccacgcgtc ccaagctctg ccaccccgcc gtccgcccca agccgtcaga       300
     gtcctccggc gtctgcccgt atagggatac tcctcggccc ccaccagcag ccccagcgcc       360
     tcgccgcggg gggctcgcct gcgcacgacg ctgcggccgc aaacgtcagc ggcgccctcc       420
     cttccagacc cttcggcggt gcccgggact gcgcagactc cgccccaggc ccggagccag       480
     ccggccaatc ggcacccgct gaaggcgggc ccagcgtcgt gaggcgccgc ccacgagcct       540
     ccgactctta taaataccgc ggcgcgctcc tggcagcaga gagcgggcac ccgggagcgt       600
     agacgataat gcaaagtgct atgttcctga ctgtccatca cgactgcgga cccatggaca       660
     agagcgcagg caccggcccc aaaagcgagg agaagcggga gaagatgaag cggaccctgt       720
     aagtacggct ttcttctctc ccctgccagc cccgcggacc tagctgtccc gggcggctgc       780
     aaacgcggta catccgcgct tggcttccac cctggagcgg tgcctccatc tctgcagggg       840
     aaaacattgt gtaaaaggta cacttgctag gtagggttaa atctatgtgg tgggtccttt       900
     gtgatgtaac cgaaggactc gagggtagag tcgaggaact gcggcaaatt cgtgatgcag       960
     aggcggtggt agatgagctg aggaatcgca ggttgggttt ttatctcccc gcatcgaaaa      1020
     tgacaccaga gaatcctgca gcccaggcgc gtccccagca ttcgtacgtt gcattgtaaa      1080
     ttctcatcaa cttacacagc tgctgggatg gaaatatttt tgttagctct gaatatatta      1140
     ttttaaaatc tttttttttt ccagttgaac aacagatctc acccacccag cactaaggaa      1200
     caaataattg ttctgcatca tctggttaaa atgagtgttg tagttgcgat cacacacgcg      1260
     cgcacacacg cacacgcacc tcacctcatt gttcacagct tctagagtgg tccagatcct      1320
     cctgctctaa gggtggaagg gaaataccca tggctggctc cgggcagttc cactgtccgt      1380
     ttcatcaagt gtgaaatgtc tcagaattgt aattaacatt gcagaactgc tgctgccttt      1440
     tgtgggccag aaatagcatc tgccttttga actatgccag ctaaattcat taaatgccct      1500
     ataattgtag gttatcctgc gcgtagttat aaaactagca gttatgttca gatgagtaga      1560
     tgaaactgtt ccaggcatag gtgctgggtt tatattttaa aggggtaaga ctgacttgaa      1620
     ggaggactgt tttgtcttac ttcattgtct gtagctactg ggagtgactt tatttggttt      1680
     aaaaaaaaaa aaaaaaaacc tttagctgca gtggtgtggc catttcaagt gttggcactt      1740
     agtaaaagtc tttttttttt tttttttttc ttctttaaga ttaaaagatt ggaagacccg      1800
     tttgagctac ttcttgcaaa attcctcctc tcctgggaag cccaaaaccg gcaagaaaag      1860
     caaaccgcaa accttcatca agtaagttga aaatctcagt ccttgcaaag ctaggccacc      1920
     agctgctgaa cagaaggggg aaacagacag gtgtgagctg acgtgtgacc gtctcttgca      1980
     ggccttctcc tgaggaagca cagctgtggg cagaagcatt tgatgagctg ctagccagca      2040
     aatgtgagtt aaccccttga gtttggtcct tttcaaggag cccaagcgtc tagaaaggag      2100
     gagcatccgg ccccagggag tttgacttta ctgtctccag catctgaggc ctgtttcttc      2160
     ccccgccgtt tcccggggat tatccctgga aacgcagggc ttattcactc caggtgggat      2220
     gcaaaatcag cgccaaactg gaatgcccct tggtgtaagc ttgaaccagc ttttccattg      2280
     catacagtgt tctcaagagg cttagttcac acagagaacc aaagctcccc cgtaaacggc      2340
     tgggtcaaca gcaaagctga gcacagcagg gcgccacctt aagcattttg cagactggct      2400
     tcttcgtctc tgaagagctc agttctaaag cgggagtgaa atctagaaac cttgctttca      2460
     tctagagata agaaaattag ggggccaggg ccagggaggc ctaggagaaa agtgaaggga      2520
     ttatgaggtc cctcagttca cgttcttcat gcttcctctc ctctgccccc cagatggtct      2580
     tgctgcattc agagcttttt tgaaatccga attctgtgaa gaaaatattg aattctggct      2640
     ggcctgtgaa gacttcaaaa aaaccaagtc accccaaaag ctgtcctcca aagccaggaa      2700
     aatatacact gacttcatag aaaaagaagc tccaaaagag gtaaggagga aaaaaaaatg      2760
     tccttgtttc cgtatctgtt gaacattctt agcaccagag tgaaacgaaa gaatagaaga      2820
     gtcctcaagc taaaaggagg ggtaaatatt ttcccctctg gctttcagcg agatgaatga      2880
     cctttctacg ggggcggctg gggcacctct tccgcccctc atggttttgg aggtcttttg      2940
     cttgttcatt tgctttcatg tatcgcatag acgtcagtct ccacctctga atatgcagta      3000
     aaccgctatt cttgtttcat ttcagataaa catagactct caaaccaaaa ctctcattgc      3060
     ccaaaacata caagaggcta caagtggctg ctttacaact gcccagaaaa gggtgtacag      3120
     cttgatggag aacaactctt atccccgttt cttggagtct gaattctacc aagacttgtg      3180
     taggaagccg ccgcagatca ccacagagcc ccatgccaca tgagatggaa acgggagccc      3240
     cgcaacgagg acattgcttt ttttcttttt gtttcctagg gggaaaggct gtcacctgcc      3300
     gaaaagactg accttgaatt cagcctgggt gttgaggaaa cattactcag aactattgat      3360
     tcggagttag tgagtcagga agccaggagc agtctaggag aagccggcac tgggacagct      3420
     tccagaactg atggagcaca gggaggcagt ggccaggatg tggcgtgtct cacgctggga      3480
     aagcaggcac gcgagactga agggtgacag tgtaacgcta tggtccaaga gcactgaaaa      3540
     tcaataggtc tgggattatg tggccttagc tagctggctg tacatacttc cctaactcag      3600
     tccttgtcac cccggagtgg tttagtggta gctttttagt cctaggtgcc atgttactct      3660
     gtacaggggt ctcgacgttc ttacgactac aggtcctcag tactggcccg cgtgactcta      3720
     aacctgaaac ggtctgtgtt taaatggtca gttgctgtgt gtcacaggat gagtgctgtg      3780
     gtgtagaaag cgacaatgtc cgtgaggagt gccaaaaact gtcctgatgg cagctacact      3840
     ttgacatggt ctttgaagac ttttaataaa tttattttga taaataccat ta              3892
//

If you have problems or comments...

PBIL Back to PBIL home page