(data stored in ACNUC27125 zone)

EMBL: DQ335452

ID   DQ335452; SV 1; linear; mRNA; STD; HUM; 1809 BP.
XX
AC   DQ335452;
XX
DT   29-JAN-2006 (Rel. 86, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens BS69 variant 1 (ZMYND11) mRNA, complete cds, alternatively
DE   spliced.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1809
RX   DOI; 10.1074/jbc.M600573200.
RX   PUBMED; 16565076.
RA   Velasco G., Grkovic S., Ansieau S.;
RT   "New insights into BS69 functions";
RL   J Biol Chem 281(24):16546-16550(2006).
XX
RN   [2]
RP   1-1809
RA   Velasco G., Grkovic S., Ansieau S.;
RT   ;
RL   Submitted (16-DEC-2005) to the INSDC.
RL   INSERM U590, Centre Leon Berard, 28 rue Laennec, Lyon 69008, France
XX
DR   MD5; 1562bde97f5f2fe16dd57b1a8a123b88.
DR   Ensembl-Gn; ENSG00000015171; homo_sapiens.
DR   Ensembl-Tr; ENST00000381591; homo_sapiens.
DR   Ensembl-Tr; ENST00000381607; homo_sapiens.
DR   Ensembl-Tr; ENST00000397959; homo_sapiens.
DR   Ensembl-Tr; ENST00000397962; homo_sapiens.
DR   Ensembl-Tr; ENST00000509513; homo_sapiens.
DR   Ensembl-Tr; ENST00000558098; homo_sapiens.
DR   Ensembl-Tr; ENST00000602682; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1809
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..1809
FT                   /gene="ZMYND11"
FT   CDS_pept        1..1809
FT                   /codon_start=1
FT                   /gene="ZMYND11"
FT                   /product="BS69 variant 1"
FT                   /note="full-length BS69; alternatively spliced"
FT                   /db_xref="GOA:Q15326"
FT                   /db_xref="H-InvDB:HIT000342994.9"
FT                   /db_xref="HGNC:HGNC:16966"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR035505"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="PDB:4NS5"
FT                   /db_xref="PDB:5HDA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15326"
FT                   /protein_id="ABC72408.1"
FT                   /translation="MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVH
FT                   GMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCF
FT                   ECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLR
FT                   FIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQL
FT                   LLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNH
FT                   ELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRS
FT                   MGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGR
FT                   RNQSVEPKKEEPEPETEAVSSSQEIPTMPQPIEKVSVSTQTKKLSASSPRMLHRSTQTT
FT                   NDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAV
FT                   ANMQGEMDRKCKQVKEKCKEEFVEEIKKLATQHKQLISQTKKKQWCYNCEEEAMYHCCW
FT                   NTSYCSIKCQQEHWHAEHKRTCRRKR"
XX
SQ   Sequence 1809 BP; 586 A; 374 C; 467 G; 382 T; 0 other;
     atggcacgtt taacaaaaag acgacaggcg gatacaaaag ctatccagca tctttgggca        60
     gccattgaga ttatacggaa ccagaagcag attgccaaca ttgaccgtat tacaaagtat       120
     atgtctcgag tccacggtat gcaccctaaa gagaccaccc gtcagctgag cttagctgtg       180
     aaagatggtc ttattgtcga aactctaaca gtgggctgca aaggttcaaa agctggtatt       240
     gaacaagaag gatattggtt gccaggagat gagattgact gggaaacaga aaatcatgac       300
     tggtattgtt ttgaatgcca tttgcctgga gaggtgttga tatgtgacct gtgttttcgt       360
     gtgtatcatt ccaagtgttt gtctgatgag ttcaggctta gagacagcag tagtccctgg       420
     cagtgcccag tttgcaggag cattaagaag aagaatacaa acaaacagga gatgggcaca       480
     tacctcagat tcattgtctc ccgcatgaag gagagggcta tagatcttaa taaaaagggg       540
     aaggacaata aacacccgat gtacaggagg ctggtgcact cagctgtgga cgttcccacc       600
     attcaagaga aagtgaatga agggaaatac cgaagttatg aagagttcaa agctgatgcc       660
     caattgcttc tccacaatac cgtgattttc tatggagcag acagtgagca agctgacatt       720
     gcgaggatgc tatataaaga cacatgtcat gagctggatg aactgcagct ttgcaagaat       780
     tgcttttact tgtcaaatgc tcgtcctgac aactggttct gttatccttg tatacctaat       840
     catgagctgg tttgggctaa aatgaaaggt tttgggtttt ggccagccaa agtcatgcag       900
     aaagaagaca atcaagtcga cgttcgcttc tttggccacc accaccagag ggcctggatt       960
     ccttctgaaa acattcaaga tatcacagtc aacattcatc ggctgcacgt gaagcgcagt      1020
     atgggttgga aaaaggcctg tgatgagctg gagctgcatc agcgtttcct acgagaaggg      1080
     agattttgga aatctaagaa tgaggaccga ggtgaggaag aggcagaatc cagtatctcc      1140
     tccaccagta atgagcagct aaaggtcact caagaaccaa gagcaaagaa aggacgacgt      1200
     aatcaaagtg tggagcccaa aaaggaagaa ccagagcctg aaacagaagc agtaagttct      1260
     agccaggaaa tacccacgat gcctcagccc atcgaaaaag tctccgtgtc aactcagaca      1320
     aagaagttaa gtgcctcttc accaagaatg ctgcatcgga gcacccagac cacaaacgac      1380
     ggcgtgtgtc agagcatgtg ccatgacaaa tacaccaaga tcttcaatga cttcaaagac      1440
     cggatgaagt cggaccacaa gcgggagaca gagcgtgttg tccgagaagc tctggagaag      1500
     ctgcgttctg aaatggaaga agaaaagaga caagctgtaa ataaagctgt agccaacatg      1560
     cagggtgaga tggacagaaa atgtaagcaa gtaaaggaaa agtgtaagga ggaatttgta      1620
     gaagaaatca agaagctggc aacacagcac aagcaactga tttctcagac caagaagaag      1680
     cagtggtgct acaactgtga ggaggaggcc atgtaccact gctgctggaa cacatcctac      1740
     tgctccatca agtgccagca ggagcactgg cacgcggagc acaagcgcac ctgccgccgg      1800
     aaaagatga                                                              1809
//

If you have problems or comments...

PBIL Back to PBIL home page