(data stored in ACNUC1829 zone)

EMBL: DQ440169

ID   DQ440169; SV 1; linear; mRNA; HTC; INV; 708 BP.
XX
AC   DQ440169;
XX
DT   08-MAY-2006 (Rel. 87, Created)
DT   22-MAY-2008 (Rel. 95, Last updated, Version 2)
XX
DE   Aedes aegypti clone AET-12092 tetraspanin mRNA, complete cds.
XX
KW   HTC.
XX
OS   Aedes aegypti (yellow fever mosquito)
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota;
OC   Neoptera; Holometabola; Diptera; Nematocera; Culicoidea; Culicidae;
OC   Culicinae; Aedini; Aedes; Stegomyia.
XX
RN   [1]
RP   1-708
RX   DOI; 10.1186/1471-2164-8-6.
RX   PUBMED; 17204158.
RA   Ribeiro J.M., Arca B., Lombardo F., Calvo E., Phan V.M., Chandra P.K.,
RA   Wikel S.K.;
RT   "An annotated catalogue of salivary gland transcripts in the adult female
RT   mosquito, Aedes aegypti";
RL   BMC Genomics 8:6-6(2007).
XX
RN   [2]
RP   1-708
RA   Ribeiro J.M.C., Chandra P.K., Calvo E., Pham V.M., Wikel S.K.;
RT   ;
RL   Submitted (08-MAR-2006) to the INSDC.
RL   Section of Vector Biology, Laboratory of Malaria and Vector Research,
RL   National Institute of Allergy and Infectious Diseases, 12735 Twinbrook
RL   Parkway Room 2E32D, Rockville, MD 20852, USA
XX
DR   MD5; e3f3010d33882c60b420c2dc968ed383.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..708
FT                   /organism="Aedes aegypti"
FT                   /mol_type="mRNA"
FT                   /clone="AET-12092"
FT                   /db_xref="taxon:7159"
FT   CDS_pept        1..708
FT                   /codon_start=1
FT                   /product="tetraspanin"
FT                   /db_xref="GOA:Q1HRC5"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="UniProtKB/TrEMBL:Q1HRC5"
FT                   /protein_id="ABF18202.1"
FT                   /translation="MGLGGRMDCCGQCVKYSMFVSNFIIFIGGAIVFGLGVWTVVDKNF
FT                   INELLGTNLFSGAVYVLIATSALVCLLSFFGCIGAAKEYKCMLLTYFILIFLIFVTMLI
FT                   GGILGYVFREKVSQTMQQEMHSSMTFYGAYGKRSITQAWDMTQERLKCCGVKHYNDWRG
FT                   SIPQSCCQKTFTDYKPCQDHPTPENIYIQGCLDITSNLIRDNAAFIGASGIIVAILLIF
FT                   GMIFSCSLFRMIE"
XX
SQ   Sequence 708 BP; 149 A; 174 C; 196 G; 189 T; 0 other;
     atgggactgg gcggcagaat ggactgctgc gggcagtgtg tcaagtatag catgttcgtc        60
     tccaatttca tcattttcat tggtggtgcc atcgttttcg gactcggtgt gtggaccgta       120
     gtggataaga actttatcaa tgagctgctc ggaacgaatt tgttttccgg ggcggtctat       180
     gtgctgattg cgacatcggc gctggtgtgt ttgctgtcct ttttcgggtg cattggcgcg       240
     gcgaaggagt acaaatgcat gctattgacg tatttcattt tgattttcct tattttcgtg       300
     acgatgctta tcggaggcat cctgggttac gtgttccgcg aaaaggtgtc ccaaaccatg       360
     cagcaggaaa tgcactcgtc gatgacgttc tacggcgcct acggaaagcg ctcgatcacc       420
     caggcttggg acatgaccca ggagaggctc aagtgctgcg gtgttaaaca ctacaacgac       480
     tggcgcggtt cgatcccaca gtcttgctgt cagaagacct tcacggacta caaaccctgc       540
     caggaccatc cgacgccgga gaacatctac atccagggct gcctggacat cacttccaat       600
     ctgatacggg acaatgcggc gttcattgga gcgtccggaa tcatcgtggc catcctgctc       660
     atattcggca tgatcttctc gtgctcactg ttccggatga tcgaatag                    708
//

If you have problems or comments...

PBIL Back to PBIL home page