(data stored in ACNUC8465 zone)

EMBL: DQ446313

ID   DQ446313; SV 1; linear; mRNA; STD; PLN; 918 BP.
XX
AC   DQ446313;
XX
DT   16-APR-2006 (Rel. 87, Created)
DT   16-APR-2006 (Rel. 87, Last updated, Version 1)
XX
DE   Arabidopsis thaliana clone pENTR221-At1g32320 mitogen-activated protein
DE   kinase kinase (At1g32320) mRNA, complete cds.
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-918
RA   Underwood B.A., Xiao Y., Moskal W., Monaghan E., Wang W., Redman J.,
RA   Wu H.C., Utterback T., Town C.D.;
RT   ;
RL   Submitted (14-MAR-2006) to the INSDC.
RL   Plant Genomics, The Institute for Genomic Research, 9712 Medical Center
RL   Drive, Rockville, MD 20850, USA
XX
DR   MD5; 02ccee467d9175d450194bbc0230d9ea.
XX
CC   This clone is in the Gateway(TM) pENTR221 recombination vector and
CC   has been donated to the Arabidopsis Biological Resource Center.
CC   Shine-Dalgarno and Kozak consensus sequences for protein expression
CC   are included between the attL1 site and the start codon. Locus
CC   assignment based on TIGR Annotation 01-21-2004.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..918
FT                   /organism="Arabidopsis thaliana"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="pENTR221-At1g32320"
FT                   /db_xref="taxon:3702"
FT   gene            1..918
FT                   /locus_tag="At1g32320"
FT   CDS_pept        1..918
FT                   /codon_start=1
FT                   /locus_tag="At1g32320"
FT                   /product="mitogen-activated protein kinase kinase"
FT                   /note="MAPKK; putative; MKK10"
FT                   /db_xref="GOA:Q9LQM8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LQM8"
FT                   /protein_id="ABE65677.1"
FT                   /translation="MTLVRERRHQEPLTLSIPPLIYHGTAFSVASSSSSSPETSPIQTL
FT                   NDLEKLSVLGQGSGGTVYKTRHRRTKTLYALKVLRPNLNTTVTVEADILKRIESSFIIK
FT                   CYAVFVSLYDLCFVMELMEKGSLHDALLAQQVFSEPMVSSLANRILQGLRYLQKMGIVH
FT                   GDIKPSNLLINKKGEVKIADFGASRIVAGGDYGSNGTCAYMSPERVDLEKWGFGGEVGF
FT                   AGDVWSLGVVVLECYIGRYPLTKVGDKPDWATLFCAICCNEKVDIPVSCSLEFRDFVGR
FT                   CLEKDWRKRDTVEELLRHSFVKNR"
XX
SQ   Sequence 918 BP; 258 A; 180 C; 227 G; 253 T; 0 other;
     atgacacttg ttagagaacg acgtcaccaa gaacctctca cactctctat tccaccactt        60
     atttaccacg gcaccgcctt ctccgtggca tcttcttcat cgtcaagccc tgaaacatcg       120
     ccgattcaaa ccttaaacga tctcgagaaa ctctccgttt taggacaagg aagcggtggg       180
     acagtctaca aaacccgtca ccggagaacc aaaacgcttt acgccttaaa agtcctccgg       240
     ccaaatctca acaccacggt caccgtcgaa gccgacatcc tcaagcgaat cgaatcgagt       300
     tttatcatta aatgctatgc cgtttttgtt agtttatacg atctctgttt cgtgatggag       360
     cttatggaga aaggatctct ccatgacgcg ttacttgctc aacaagtttt ctccgagcca       420
     atggtatcga gtctcgctaa cagaatcctc caagggttac gttatctgca aaaaatggga       480
     atagttcatg gagacataaa gccttcaaat ctccttatta ataagaaagg agaggtcaag       540
     attgcggatt ttggagcaag taggatagta gccggaggag actatggatc gaatgggaca       600
     tgtgcttata tgagtcctga acgtgtagat ctagagaaat ggggttttgg aggagaagtt       660
     ggatttgcag gagatgtgtg gtcattagga gttgtggttc ttgagtgtta cattggaaga       720
     tatccattga ccaaagttgg ggataaaccg gattgggcga cattattttg tgcaatttgc       780
     tgcaatgaga aggtggatat tccagtgagt tgttcgttgg agtttagaga ttttgttggg       840
     agatgtttgg agaaggattg gaggaagaga gacactgtgg aagagcttct tcgtcattct       900
     tttgtgaaaa acagatga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page