(data stored in ACNUC18020 zone)

EMBL: DQ525915

ID   DQ525915; SV 1; linear; mRNA; STD; VRT; 683 BP.
XX
AC   DQ525915;
XX
DT   21-JUL-2006 (Rel. 88, Created)
DT   21-JUL-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Gallus gallus semaphorin 7A-2 variant mRNA, partial cds.
XX
KW   .
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-683
RX   DOI; 10.1002/dvdy.20882.
RX   PUBMED; 16804892.
RA   Bao Z.Z., Jin Z.;
RT   "Sema3D and Sema7A have distinct expression patterns in chick embryonic
RT   development";
RL   Dev. Dyn. 235(8):2282-2289(2006).
XX
RN   [2]
RP   1-683
RA   Jin Z., Bao Z.-Z.;
RT   ;
RL   Submitted (03-MAY-2006) to the INSDC.
RL   Medicine and Cell Biology, University of Massachusetts Medical School, 364
RL   Plantation St., Worcester, MA 01605, USA
XX
DR   MD5; 5607f6967183421b360a09a6405ac588.
DR   EuropePMC; PMC1564195; 16804892.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..683
FT                   /organism="Gallus gallus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9031"
FT   CDS_pept        <1..>683
FT                   /codon_start=1
FT                   /product="semaphorin 7A-2 variant"
FT                   /note="contains SEMA domain"
FT                   /db_xref="GOA:Q0Q5V3"
FT                   /db_xref="InterPro:IPR001627"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR027231"
FT                   /db_xref="InterPro:IPR036352"
FT                   /db_xref="UniProtKB/TrEMBL:Q0Q5V3"
FT                   /protein_id="ABF71885.1"
FT                   /translation="GLLFLKASLICVDPATKGNFNWLQDVFFVPASNWRDSKVYGLFTN
FT                   TWGSSAVCVYSFGDIDNVFRTSKLKGYNGPNPEIKPGQCVPSGQHTPSETFKIADSHPE
FT                   VEDRVEPLAPTRSPLFHNKHRYQKIGVHEVSASDGRQYTVLYLATDKGSIHKVVELPGG
FT                   VHNIMELQVFSKKDPIQSMILDHERAMLYVGSTSKVVEIPMDMCGVYRNNCESCLLARD
FT                   PYCGW"
XX
SQ   Sequence 683 BP; 168 A; 179 C; 192 G; 144 T; 0 other;
     ggactacttt tcttaaaggc cagcttgatt tgtgtcgacc cggccaccaa gggcaacttc        60
     aactggctgc aggatgtctt ctttgtccct gcaagtaact ggagggactc caaagtctac       120
     ggactcttca caaacacctg gggaagctct gctgtttgtg tctattcttt tggggacatt       180
     gacaacgtgt ttcggacatc caagctcaaa ggctataatg gtcccaaccc ggagatcaag       240
     cctgggcagt gtgttccctc tggacagcac acccccagtg agaccttcaa gatagctgac       300
     agccacccag aagtagagga tcgggtggag cccctggctc ccaccaggag ccctttattc       360
     cacaacaagc atcgctacca gaagatcggg gtgcacgagg tctctgcaag tgatggacgc       420
     caatacacag tgctttatct ggcaacagac aagggatcca tccacaaggt agtggagctg       480
     ccagggggag tgcataacat catggagctc caggtgttct cgaagaagga cccgatccag       540
     tccatgatcc tggaccacga gagggcgatg ctgtacgtgg gctcgaccag caaagtggtg       600
     gagataccca tggatatgtg tggggtgtac cgcaacaact gcgagagctg cctgctggcg       660
     agagatccat actgcggatg gga                                               683
//

If you have problems or comments...

PBIL Back to PBIL home page