(data stored in ACNUC16935 zone)

EMBL: DQ793132

ID   DQ793132; SV 1; linear; mRNA; STD; PLN; 777 BP.
XX
AC   DQ793132;
XX
DT   01-JUL-2007 (Rel. 92, Created)
DT   01-JUL-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Arabidopsis thaliana ubiquitin (UBQ10) mRNA, partial cds.
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-777
RA   Fu H.;
RT   "Functional Differentiation of Ubiquitin-interacting Factors from
RT   Arabidopsis";
RL   Unpublished.
XX
RN   [2]
RP   1-777
RA   Fu H.;
RT   ;
RL   Submitted (22-JUN-2006) to the INSDC.
RL   Institute of Plant and Microbial Biology, Academia Sinica, 128 sec 2
RL   Academia Rd, Nankang, Taipei, Taiwan 11529, ROC
XX
DR   MD5; 76ab913fd9f7bc2d16109150fd9264e0.
DR   EuropePMC; PMC5733009; 29312363.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..777
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="IV"
FT                   /ecotype="Col-0"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:3702"
FT   gene            <1..777
FT                   /gene="UBQ10"
FT                   /locus_tag="At4g05320"
FT   CDS_pept        <1..661
FT                   /codon_start=2
FT                   /gene="UBQ10"
FT                   /locus_tag="At4g05320"
FT                   /product="ubiquitin"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:A6XI99"
FT                   /protein_id="ABH08753.1"
FT                   /translation="KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
FT                   LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
FT                   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD
FT                   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF"
XX
SQ   Sequence 777 BP; 206 A; 174 C; 200 G; 197 T; 0 other;
     aaagaccatc actttggagg tggagagttc tgacaccatt gataacgtga aagccaagat        60
     ccaggacaaa gagggtatcc caccggacca gcagagattg atcttcgccg gaaagcaact       120
     tgaagatgga agaactttgg ctgactacaa cattcagaag gagtccacac ttcacttggt       180
     cttgcgtctg cgtggaggta tgcagatctt cgtgaagact ctcaccggaa agactatcac       240
     tttggaggta gagagctctg acaccattga caacgtgaag gccaagatcc aggataagga       300
     aggaatccct ccggaccagc agaggttgat ctttgccgga aaacaattgg aggatggtcg       360
     tactttggcg gattacaaca tccagaagga gtcgaccctt cacttggtgt tgcgtctgcg       420
     tggaggtatg cagatcttcg tcaagacttt gaccggaaag accatcaccc ttgaagtgga       480
     aagctccgac accattgaca acgtcaaggc caagatccag gacaaggaag gtattcctcc       540
     ggaccagcag cgtctcatct tcgctggaaa gcagcttgag gatggacgta ctttggccga       600
     ctacaacatc cagaaggagt ctactcttca cttggtcctg cgtcttcgtg gtggtttcta       660
     aatctcgtct ctgttatgct taagaagttc aatgtttcgt ttcatgtaaa actttggtgg       720
     tttgtgtttt ggggccttgt ataatccctg atgaataagt gttctactat gtttccg          777
//

If you have problems or comments...

PBIL Back to PBIL home page