(data stored in ACNUC16935 zone)

EMBL: DQ793133

ID   DQ793133; SV 1; linear; mRNA; STD; PLN; 880 BP.
XX
AC   DQ793133;
XX
DT   01-JUL-2007 (Rel. 92, Created)
DT   01-JUL-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Arabidopsis thaliana ubiquitin (UBQ3) mRNA, partial cds.
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-880
RA   Fu H.;
RT   "Functional Differentiation of Ubiquitin-interacting Factors from
RT   Arabidopsis";
RL   Unpublished.
XX
RN   [2]
RP   1-880
RA   Fu H.;
RT   ;
RL   Submitted (22-JUN-2006) to the INSDC.
RL   Institute of Plant and Microbial Biology, Academia Sinica, 128 sec 2
RL   Academia Rd, Nankang, Taipei, Taiwan 11529, ROC
XX
DR   MD5; 4e75816f73a4bc9ec8d4ea7dd7277886.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..880
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="V"
FT                   /ecotype="Col-0"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:3702"
FT   gene            <1..880
FT                   /gene="UBQ3"
FT                   /locus_tag="At5g03240"
FT   CDS_pept        <1..664
FT                   /codon_start=2
FT                   /gene="UBQ3"
FT                   /locus_tag="At5g03240"
FT                   /product="ubiquitin"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:A6XIA0"
FT                   /protein_id="ABH08754.1"
FT                   /translation="KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
FT                   LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
FT                   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD
FT                   TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGSF"
XX
SQ   Sequence 880 BP; 237 A; 195 C; 201 G; 247 T; 0 other;
     caagaccatt actttggagg ttgagagctc tgacactatt gacaacgtca aagcaaagat        60
     ccaggacaag gaaggaatcc ctccggatca gcagagactt atctttgccg gtaagcagct       120
     tgaagacgga agaactcttg ctgactacaa cattcaaaag gagtcgaccc ttcatttggt       180
     gcttcgtctc agaggtggta tgcaaatctt tgtcaagacc ctcactggta aaacaatcac       240
     ccttgaggtt gagagttcag acaccattga caatgtcaaa gctaagatcc aagataaaga       300
     gggaattcct ccggatcagc agaggcttat ctttgccggt aagcagctcg aagatggacg       360
     cacccttgca gattacaaca tccaaaagga gtcgacactt catcttgtgc ttcgtctccg       420
     tggtggtatg cagatctttg tgaagaccct taccggaaag accattactc tggaggttga       480
     aagctcagac accatcgata atgtcaaggc taagattcag gacaaggaag ggatcccacc       540
     agaccaacag agactcatct tcgctggaaa acagcttgag gatggtcgca cacttgcaga       600
     ttacaacatc cagaaggagt cgactcttca cttggttctt cgtcttcgtg gtggaagctt       660
     ctaagctttt tgtgatctga tgataagtgg ttggttcgtg tctcatgcac ttgggaggtg       720
     atctatttca cctggtgtag tttgtgtttc cgtcagttgg aaaaacttat ccctatcgat       780
     ttcgttttca ttttctgctt ttcttttatg taccttcgtt tgggcttgta acgggccttt       840
     gtatttcaac tctcaataat aatccaagtg catgttaaac                             880
//

If you have problems or comments...

PBIL Back to PBIL home page