(data stored in ACNUC16935 zone)

EMBL: DQ793134

ID   DQ793134; SV 1; linear; mRNA; STD; PLN; 800 BP.
XX
AC   DQ793134;
XX
DT   01-JUL-2007 (Rel. 92, Created)
DT   01-JUL-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Arabidopsis thaliana ubiquitin (UBQ11) mRNA, partial cds.
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-800
RA   Fu H.;
RT   "Functional Differentiation of Ubiquitin-interacting Factors from
RT   Arabidopsis";
RL   Unpublished.
XX
RN   [2]
RP   1-800
RA   Fu H.;
RT   ;
RL   Submitted (22-JUN-2006) to the INSDC.
RL   Institute of Plant and Microbial Biology, Academia Sinica, 128 sec 2
RL   Academia Rd, Nankang, Taipei, Taiwan 11529, ROC
XX
DR   MD5; 52118936b374dd4a6315e644ed5d2162.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..800
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="IV"
FT                   /ecotype="Col-0"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:3702"
FT   gene            <1..800
FT                   /gene="UBQ11"
FT                   /locus_tag="At4g05050"
FT   CDS_pept        <1..667
FT                   /codon_start=2
FT                   /gene="UBQ11"
FT                   /locus_tag="At4g05050"
FT                   /product="ubiquitin"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:A6XIA1"
FT                   /protein_id="ABH08755.1"
FT                   /translation="TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
FT                   PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
FT                   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF"
XX
SQ   Sequence 800 BP; 204 A; 191 C; 200 G; 205 T; 0 other;
     caccggaaag actatcaccc tcgaggtgga aagctctgac accatcgaca acgttaaggc        60
     caagatccag gataaggaag gtattcctcc ggatcagcag aggcttatct tcgccggaaa       120
     gcagttggag gatggccgca cgttggcgga ttacaatatc cagaaggaat ccaccctcca       180
     cttggttctc aggctccgtg gtggtatgca gattttcgtt aaaaccctaa cgggaaagac       240
     gattactctt gaggtggaga gctctgacac cattgacaac gtcaaggcca agatccaaga       300
     taaggagggt attcctccgg accagcagag gttgatcttc gccggaaagc aacttgagga       360
     cggcagaact ttggcggatt acaacatcca gaaggagtct acgcttcatt tggtcttgcg       420
     tctgcgtgga ggtatgcaga tcttcgtaaa gactttgacc ggaaagacca tcactcttga       480
     agttgagagc tccgacacca ttgataacgt gaaggctaag atccaggaca aggaaggcat       540
     tcctccggac cagcagcgtc tcatcttcgc tggaaagcag cttgaggatg gacgtacttt       600
     ggccgactac aacatccaga aggagtctac tcttcacttg gtcctccgtc tccgtggtgg       660
     tttctaaacc ttgtctctct ctcttatggt tactgaacca agttcatgta tcgtttcatc       720
     tagtactttg gtggtttatg ttttggggcc atgtacagcc tctgataaat aattgatcga       780
     ctatgtttcc gtttctttca                                                   800
//

If you have problems or comments...

PBIL Back to PBIL home page