(data stored in ACNUC9306 zone)

EMBL: DQ916740

ID   DQ916740; SV 1; linear; mRNA; STD; HUM; 1814 BP.
XX
AC   DQ916740;
XX
DT   10-SEP-2007 (Rel. 93, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens radixin isoform d (RDX) mRNA, complete cds, alternatively
DE   spliced.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1814
RA   Ahmed Z.;
RT   "RDX is responsible for DFNB24";
RL   Unpublished.
XX
RN   [2]
RP   1-1814
RA   Ahmed Z.;
RT   ;
RL   Submitted (24-AUG-2006) to the INSDC.
RL   LMG, NIDCD, 5 Research Court, Rockville, MD 20850, USA
XX
DR   MD5; 288bc2cedfbb8e39b8615850fc2b9407.
DR   Ensembl-Gn; ENSG00000137710; homo_sapiens.
DR   Ensembl-Tr; ENST00000528498; homo_sapiens.
DR   Ensembl-Tr; ENST00000528900; homo_sapiens.
DR   Ensembl-Tr; ENST00000530301; homo_sapiens.
DR   Ensembl-Tr; ENST00000530749; homo_sapiens.
DR   Ensembl-Tr; ENST00000544551; homo_sapiens.
DR   Ensembl-Tr; ENST00000645495; homo_sapiens.
DR   Ensembl-Tr; ENST00000647231; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1814
FT                   /organism="Homo sapiens"
FT                   /chromosome="11"
FT                   /map="11q22.3"
FT                   /mol_type="mRNA"
FT                   /tissue_type="retina; inner ear"
FT                   /db_xref="taxon:9606"
FT   gene            1..1814
FT                   /gene="RDX"
FT   CDS_pept        405..1178
FT                   /codon_start=1
FT                   /gene="RDX"
FT                   /product="radixin isoform d"
FT                   /note="alternatively spliced"
FT                   /db_xref="GOA:P35241"
FT                   /db_xref="H-InvDB:HIT000468661.6"
FT                   /db_xref="HGNC:HGNC:9944"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR008954"
FT                   /db_xref="InterPro:IPR011174"
FT                   /db_xref="InterPro:IPR011259"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35241"
FT                   /protein_id="ABI34712.1"
FT                   /translation="MERLKQIEEQTIKAQKELEEQTRKALELDQERKRAKEEAERLEKE
FT                   RRAAEEAKSAIAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEATEWQHKAFA
FT                   AQEDLEKTKEELKTVMSAPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRS
FT                   EEERVTETQKNERVKKQLQALSSELAQARDETKKTQNDVLHAENVKAGRDKYKTLRQIR
FT                   QGNTKQRIDEFEAMWGPKLYALFQMRSCQSSIKQM"
XX
SQ   Sequence 1814 BP; 573 A; 436 C; 435 G; 370 T; 0 other;
     ttggcgctca gtccgcggcg cgaggacggc cggccggcag ggggaggcgg gggggcgccg        60
     ggcagccccg ccttttcccg cggaggcgcc gagcggccat attgcggagc tgtctgcggt       120
     ggcggcggcg cctctcgtct cccgcggccc agcgctcgca ccaccgcttc tccctccctg       180
     tcgcagccgc gccgccgcgc agcgccccag ccacacgccg gcgggcagaa gccgcccgct       240
     ctccggaaag tgataacaga attcattgaa gtggagaatt tttaaagaag gtaacaaaaa       300
     gagaaagaaa atgccgaaac caggcacaat tagagaatga aaagaagaaa agagaaatag       360
     cagaaaagga aaaggaaaga atagaacgtg aaaaggaaga gctaatggaa cgtctaaaac       420
     aaattgaaga gcagacaatt aaagctcaga aagaactaga agaacagact cgaaaagctc       480
     tagaactgga tcaagaacga aaacgagcaa aagaagaagc agaacgactt gaaaaggagc       540
     gtcgagctgc tgaagaggca aagtctgcca tagcaaaaca agctgccgac cagatgaaga       600
     atcaggagca gctagcagca gaacttgctg aattcactgc caagattgca cttctagagg       660
     aagccaagaa gaaaaaggaa gaggaagcta ctgagtggca acacaaagct tttgcagccc       720
     aggaagactt ggaaaagacc aaagaagagt taaaaactgt gatgtctgcc ccccctccac       780
     ctccaccacc accagtcatt cctccaacag aaaacgaaca tgatgaacac gatgagaata       840
     atgctgaagc tagtgctgaa ttatcaaatg aaggggtaat gaaccataga agcgaggaag       900
     aacgtgtaac cgaaacacag aaaaatgagc gtgttaagaa gcaacttcag gcattaagtt       960
     cagaattagc ccaagccaga gatgaaacca agaaaacaca aaatgatgtt cttcatgctg      1020
     agaatgttaa agcaggccgt gataagtaca agactctgcg acagattcga caaggcaata      1080
     caaagcagcg tatcgatgag tttgaagcaa tgtggggacc caaactgtat gcattgttcc      1140
     agatgcgctc ttgccaaagc agcataaagc aaatgtaacc cttaggaaga aggctccctc      1200
     cctcactagg cccctggcta ctgacttatg ggaagcttta ggataaggac atacctggtg      1260
     ttctgaatgt gtatatcccc caaagtctgc aatctcagct ggaactggat ggaccagtat      1320
     tccattaccc agggccctgg ctcatggttc tctcctcttc tcagtttact gttggatttc      1380
     cctttcttgc tattctcttt ctctccagac ccctctcaat tgcctttcct aaagacagac      1440
     cttagcaaga tgggccagga cttgggactt cgcacagcac cctgcagtcc caagccagca      1500
     tctactgcac cccatcttca ggactctatc ccccaaacat gctggaaggc atcagcttat      1560
     gagaacccac ttttttctgc atgactagct tgtaaggaag aatctatgga caggatttcc      1620
     aagaatttcg cactttttca aaaaatgtat gtgacttata tttggcttca atccaagagc      1680
     aaactcagtg gtgaacagct ccatttctgt gcacatgttg gtggaatctg cagaaatcga      1740
     tgcaacattt ctttcctgtc tgggctgttt gtataattgt atataaatgt agcaataaat      1800
     atattctaac atca                                                        1814
//

If you have problems or comments...

PBIL Back to PBIL home page