(data stored in ACNUC9306 zone)

EMBL: DQ916741

ID   DQ916741; SV 1; linear; mRNA; STD; HUM; 2558 BP.
XX
AC   DQ916741;
XX
DT   10-SEP-2007 (Rel. 93, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens radixin isoform e (RDX) mRNA, complete cds, alternatively
DE   spliced.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2558
RA   Ahmed Z.;
RT   "RDX is responsible for DFNB24";
RL   Unpublished.
XX
RN   [2]
RP   1-2558
RA   Ahmed Z.;
RT   ;
RL   Submitted (24-AUG-2006) to the INSDC.
RL   LMG, NIDCD, 5 Research Court, Rockville, MD 20850, USA
XX
DR   MD5; 6eefd8195797c31503277bcbfe191250.
DR   Ensembl-Gn; ENSG00000137710; homo_sapiens.
DR   Ensembl-Tr; ENST00000528498; homo_sapiens.
DR   Ensembl-Tr; ENST00000528900; homo_sapiens.
DR   Ensembl-Tr; ENST00000530301; homo_sapiens.
DR   Ensembl-Tr; ENST00000530749; homo_sapiens.
DR   Ensembl-Tr; ENST00000544551; homo_sapiens.
DR   Ensembl-Tr; ENST00000645495; homo_sapiens.
DR   Ensembl-Tr; ENST00000647231; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2558
FT                   /organism="Homo sapiens"
FT                   /chromosome="11"
FT                   /map="11q22.3"
FT                   /mol_type="mRNA"
FT                   /tissue_type="retina; inner ear"
FT                   /db_xref="taxon:9606"
FT   gene            1..2558
FT                   /gene="RDX"
FT   CDS_pept        311..2125
FT                   /codon_start=1
FT                   /gene="RDX"
FT                   /product="radixin isoform e"
FT                   /note="alternatively spliced"
FT                   /db_xref="GOA:P35241"
FT                   /db_xref="H-InvDB:HIT000468662.6"
FT                   /db_xref="HGNC:HGNC:9944"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR008954"
FT                   /db_xref="InterPro:IPR011174"
FT                   /db_xref="InterPro:IPR011259"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35241"
FT                   /protein_id="ABI34713.1"
FT                   /translation="MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFF
FT                   GLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFL
FT                   QVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKL
FT                   TKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDA
FT                   LGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRIL
FT                   ALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERI
FT                   EREKEELMERLKQIEEQTIKAQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEA
FT                   KSAIAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEK
FT                   TKEELKTVMSAPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRSEEERVTE
FT                   TQKNERVKKQLQALSSELAQARDETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQR
FT                   IDEFEAMWGPKLYALFQMRSCQSSIKQM"
XX
SQ   Sequence 2558 BP; 868 A; 538 C; 623 G; 529 T; 0 other;
     ttggcgctca gtccgcggcg cgaggacggc cggccggcag ggggaggcgg gggggcgccg        60
     ggcagccccg ccttttcccg cggaggcgcc gagcggccat attgcggagc tgtctgcggt       120
     ggcggcggcg cctctcgtct cccgcggccc agcgctcgca ccaccgcttc tccctccctg       180
     tcgcagccgc gccgccgcgc agcgccccag ccacacgccg gcgggcagaa gccgcccgct       240
     ctccggaaag tgataacaga attcattgaa gtggagaatt tttaaagaag gtaacaaaaa       300
     gagaaagaaa atgccgaaac caatcaacgt aagagtaact acaatggatg ctgagctgga       360
     atttgccatt cagcccaata caactggcaa acaacttttt gaccaggtgg tgaaaacagt       420
     tggtttgcgt gaggtctggt tttttgggct gcagtatgta gacagcaaag gttattctac       480
     atggcttaaa ctaaataaaa aggtaacaca gcaggatgtt aaaaaagaga atcctttaca       540
     gttcaagttt agagctaaat tctttcctga agatgtttct gaggaattaa ttcaagaaat       600
     aacccagaga ctcttcttct tgcaagttaa agaagccatc ttaaatgatg agatatattg       660
     cccgccagaa actgcagttc ttttggcttc ctatgctgtc caagccaagt atggagatta       720
     caataaagag attcataagc caggctacct ggctaatgat agactcctac cccagcgtgt       780
     attggaacaa cacaaactaa caaaagaaca gtgggaagaa agaatacaga actggcatga       840
     agaacataga ggaatgttaa gggaggattc tatgatggaa tacctgaaga ttgcacaaga       900
     tctagaaatg tatggagtca actattttga aataaaaaat aaaaaaggaa ctgaattgtg       960
     gctaggtgtt gatgctttgg gtctgaatat ttatgagcat gacgacaagt taacacctaa      1020
     aattggtttt ccctggagtg aaatcagaaa tatttcattt aatgacaaaa aatttgttat      1080
     aaagccaatc gacaaaaagg cacctgattt tgtgttttat gcacctcgtc tgagaatcaa      1140
     taagcggatt ttggccttat gtatgggaaa ccatgaacta tacatgcgaa gaaggaagcc      1200
     tgatactatt gaagtacaac agatgaaggc tcaggctagg gaggagaaac atcagaagca      1260
     gttggaaagg gcacaattag agaatgaaaa gaagaaaaga gaaatagcag aaaaggaaaa      1320
     ggaaagaata gaacgtgaaa aggaagagct aatggaacgt ctaaaacaaa ttgaagagca      1380
     gacaattaaa gctcagaaag aactagaaga acagactcga aaagctctag aactggatca      1440
     agaacgaaaa cgagcaaaag aagaagcaga acgacttgaa aaggagcgtc gagctgctga      1500
     agaggcaaag tctgccatag caaaacaagc tgccgaccag atgaagaatc aggagcagct      1560
     agcagcagaa cttgctgaat tcactgccaa gattgcactt ctagaggaag ccaagaagaa      1620
     aaaggaagag gaagctactg agtggcaaca caaagctttt gcagcccagg aagacttgga      1680
     aaagaccaaa gaagagttaa aaactgtgat gtctgccccc cctccacctc caccaccacc      1740
     agtcattcct ccaacagaaa acgaacatga tgaacacgat gagaataatg ctgaagctag      1800
     tgctgaatta tcaaatgaag gggtaatgaa ccatagaagc gaggaagaac gtgtaaccga      1860
     aacacagaaa aatgagcgtg ttaagaagca acttcaggca ttaagttcag aattagccca      1920
     agccagagat gaaaccaaga aaacacaaaa tgatgttctt catgctgaga atgttaaagc      1980
     aggccgtgat aagtacaaga ctctgcgaca gattcgacaa ggcaatacaa agcagcgtat      2040
     cgatgagttt gaagcaatgt ggggacccaa actgtatgca ttgttccaga tgcgctcttg      2100
     ccaaagcagc ataaagcaaa tgtaaccctt aggaagaagg ctccctccct cactaggcca      2160
     ctgctgcagg acagtgaagc tgacttaaaa tgcccctgcc ctgggctaca aagaatgcta      2220
     gagtggagac aagagtccag actctgaaat aacctccttt ggacacagaa gctaccactg      2280
     ttgcttatca gacgcagcgg gccctgggtt tttctggggc cttaagcagt gaaccctggt      2340
     cagctggcct gagtcccaac ccaagcccat caccacaagc ctcaagacag gaagatctca      2400
     gtgaaacctt tcctctaatc caagtgacat cattgtcgca ggtgtttgta catgaaagca      2460
     gagtgatgaa ggtgtgtggg tccacggaag aagtaaaaat acagcactag ttcatatttt      2520
     tcctagtctc tccctgttcc caggtaaagt tatagcat                              2558
//

If you have problems or comments...

PBIL Back to PBIL home page