(data stored in ACNUC1829 zone)

EMBL: DQ972959

ID   DQ972959; SV 1; linear; mRNA; STD; MAM; 720 BP.
XX
AC   DQ972959;
XX
DT   03-OCT-2006 (Rel. 89, Created)
DT   03-OCT-2006 (Rel. 89, Last updated, Version 1)
XX
DE   Sus scrofa TNE5 mRNA, complete cds.
XX
KW   .
XX
OS   Sus scrofa (pig)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae; Sus.
XX
RN   [1]
RP   1-720
RA   Liu G.Y.;
RT   ;
RL   Submitted (25-AUG-2006) to the INSDC.
RL   College of Animal Science, Kunming 650201, China
XX
DR   MD5; d207c41cd2cb1698e7ba21e50844f786.
DR   Ensembl-Gn; ENSSSCG00000000735; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00000000798; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00000063353; sus_scrofa.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..720
FT                   /organism="Sus scrofa"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9823"
FT   CDS_pept        1..720
FT                   /codon_start=1
FT                   /product="TNE5"
FT                   /db_xref="GOA:Q06AA5"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06AA5"
FT                   /protein_id="ABI96195.1"
FT                   /translation="MARGCLCCLKYMMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFS
FT                   PSFPSLSAANLVIAIGTIVMVTGFLGCLGAIKENRCLLLSFFIVLLIILLAELILIILF
FT                   FVYMDKVNENARKDLKEGLLLYNSENNVGLKNAWNIIQAEMHCCGVTDYTDWYPVLGEN
FT                   TVPDRCCMENSQGCGRNSTTPLWKTGCYEKVKMWFDDNKHVLGTVGMCILIMQILGMAF
FT                   SMTLFQHIHRTGKKYDA"
XX
SQ   Sequence 720 BP; 146 A; 203 C; 198 G; 173 T; 0 other;
     atggccaggg gctgcctctg ctgcttgaag tacatgatgt tcctcttcaa tttgatattc        60
     tggctctgtg gctgtgggct gcttggagtg ggcatttggc tctccgtgtc ccaaggcaac       120
     tttgccacct tctcccccag cttcccctcg ctgtctgcag ccaacctcgt catcgccata       180
     ggcaccatcg tcatggtgac gggcttcctg ggctgcctgg gggccatcaa ggagaacagg       240
     tgcctcctcc tcagtttttt catcgtcctg ttgatcatcc tcctggcgga gctgatctta       300
     attatcctct tctttgtcta catggacaag gtgaacgaga atgccaggaa ggacctcaag       360
     gaaggtctgc tgctgtataa ctcggagaac aacgtggggc ttaagaacgc ctggaacatc       420
     atccaggccg agatgcactg ctgtggcgtt accgactata cagactggta ccccgtgctg       480
     ggggagaaca cggttcctga ccgctgttgc atggagaact cccagggctg cggccgcaac       540
     agcactaccc cgctttggaa gacgggctgc tacgaaaagg tgaagatgtg gtttgacgac       600
     aataagcacg tgcttggcac ggtgggcatg tgcatcctga tcatgcagat cctgggcatg       660
     gccttctcca tgaccctctt ccagcacatc caccggactg ggaaaaagta cgacgcctga       720
//

If you have problems or comments...

PBIL Back to PBIL home page