(data stored in ACNUC24361 zone)

EMBL: DQ976875

ID   DQ976875; SV 1; linear; genomic DNA; STD; MAM; 1308 BP.
XX
AC   DQ976875;
XX
DT   14-JAN-2007 (Rel. 90, Created)
DT   28-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Macaca mulatta ZNF38 (ZNF38) gene, partial cds.
XX
KW   .
XX
OS   Macaca mulatta (Rhesus monkey)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini;
OC   Cercopithecidae; Cercopithecinae; Macaca.
XX
RN   [1]
RP   1-1308
RX   DOI; 10.1534/genetics.108.090548.
RX   PUBMED; 18689901.
RA   Nickel G.C., Tefft D.L., Goglin K., Adams M.D.;
RT   "An empirical test for branch-specific positive selection";
RL   Genetics 179(4):2183-2193(2008).
XX
RN   [2]
RP   1-1308
RA   Nickel G.C., Tefft D.L., Trevarthen K., Funt J., Adams M.D.;
RT   "Positive Selection in Transcription Factor Genes on the Human Lineage";
RL   Unpublished.
XX
RN   [3]
RP   1-1308
RA   Nickel G.C., Tefft D.L., Trevarthen K., Funt J., Adams M.D.;
RT   ;
RL   Submitted (31-AUG-2006) to the INSDC.
RL   Dept. of Genetics, Case Western Reserve University, 10900 Euclid Ave,
RL   Cleveland, OH 44106, USA
XX
DR   MD5; 49a5064fc5ab7b360441f423ab92e493.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1308
FT                   /organism="Macaca mulatta"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9544"
FT   gene            <293..>1193
FT                   /gene="ZNF38"
FT   mRNA            <293..>485
FT                   /gene="ZNF38"
FT                   /product="ZNF38"
FT   CDS_pept        <293..>485
FT                   /codon_start=1
FT                   /gene="ZNF38"
FT                   /product="ZNF38"
FT                   /db_xref="UniProtKB/TrEMBL:A2D668"
FT                   /protein_id="ABM55161.1"
FT                   /translation="VSTPPNEQKPVWEKISSSGTAKESPSSVQPQPLETSHKYESWGPL
FT                   YIQETGEEQEFTQDPRKTR"
FT   exon            293..485
FT                   /gene="ZNF38"
FT                   /number=2
FT   gap             582..681
FT                   /estimated_length=unknown
FT   mRNA            <682..>1193
FT                   /gene="ZNF38"
FT                   /product="ZNF38"
FT   CDS_pept        <682..1193
FT                   /codon_start=3
FT                   /gene="ZNF38"
FT                   /product="ZNF38"
FT                   /db_xref="GOA:A2D669"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A2D669"
FT                   /protein_id="ABM55162.1"
FT                   /translation="YVCTKCGKAFSHSSNLTLHYRTHLVDRPYDCKCGKAFGQSSDLLK
FT                   HQRMHTEEAPYQCKDCGKAFSGKGSLIRHYRIHTGEKPYQCNECGKSFSQHAGLSSHQR
FT                   LHTGEKPYKCKECGKAFNHSSNFNKHHRIHTGEKPYWCHHCGKTFCSKSNLSKHQRVHT
FT                   GEGEAL"
FT   exon            <682..>1193
FT                   /gene="ZNF38"
FT                   /number=3
XX
SQ   Sequence 1308 BP; 322 A; 291 C; 296 G; 296 T; 103 other;
     ggtaggcggg aagacctttg ttattctagg agattgggag ccaaacattc taggcaggaa        60
     caagggtttg tccatacagt aagcttcgct gaatggaaat ttctactgaa ttagaccttg       120
     tttcctccta tatttctctg tcatccaaaa ctaactttta gccttgggaa tggaacagga       180
     tgggtgtttt ccttttctct ttcctagagg ttctgtatag ctctcctggg attttcattc       240
     ttgttcttaa agtgagccat gcacaaaccc agccattcct aattgttttt aggtctcaac       300
     tcctccaaat gaacagaagc cggtatggga gaagatatcc tcctcgggaa ccgcaaagga       360
     atccccgagc agcgtgcagc cacagccctt ggagaccagt cacaaatacg agtcttgggg       420
     gcccctgtac atccaagaga ctggtgagga gcaggagttc actcaagatc cgagaaagac       480
     ccgaggtgag gaccagccgt tagactcctg ttcagtgccc cnnncctctg tggttggaga       540
     agcagaataa tttgtaattc tttgttgtga ggtgatttca tnnnnnnnnn nnnnnnnnnn       600
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn ncttacgtgt gcaccaagtg tgggaaagct ttcagccaca       720
     gctcaaacct caccctccac tacagaacac acttggtgga ccggccctac gactgtaagt       780
     gtggaaaagc ctttgggcag agctcagacc ttcttaaaca tcagagaatg cacaccgagg       840
     aggcgccgta tcagtgcaaa gattgtggca aggctttcag tgggaaaggc agcctcattc       900
     gtcactatcg gatccacact ggggagaagc cttatcagtg taacgaatgt gggaagagct       960
     tcagtcagca cgcgggcctc agctcccacc agagacttca caccggagag aagccatata      1020
     agtgtaagga gtgtgggaaa gccttcaacc acagctccaa cttcaataaa caccacagaa      1080
     tccacactgg ggaaaagccc tactggtgtc atcactgtgg aaagaccttc tgtagcaagt      1140
     ccaatctttc caaacatcag cgagtccaca ctggagaggg agaagcactg taactgccac      1200
     gtgcgctcgt gttgtcgtgg ttgttttaaa ctttagcatc tgaacaccag gaagaagtct      1260
     tgtcgttgca gcagcattga ttccagtgat agagtttgtg tcactcaa                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page