(data stored in ACNUC24361 zone)

EMBL: DQ977338

ID   DQ977338; SV 1; linear; genomic DNA; STD; MAM; 4263 BP.
XX
AC   DQ977338;
XX
DT   30-JAN-2007 (Rel. 90, Created)
DT   28-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Pan troglodytes ZNF483 (ZNF483) gene, partial cds.
XX
KW   .
XX
OS   Pan troglodytes (chimpanzee)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Pan.
XX
RN   [1]
RP   1-4263
RX   DOI; 10.1534/genetics.108.090548.
RX   PUBMED; 18689901.
RA   Nickel G.C., Tefft D.L., Goglin K., Adams M.D.;
RT   "An empirical test for branch-specific positive selection";
RL   Genetics 179(4):2183-2193(2008).
XX
RN   [2]
RP   1-4263
RA   Nickel G.C., Tefft D.L., Trevarthen K., Funt J., Adams M.D.;
RT   "Positive Selection in Transcription Factor Genes on the Human Lineage";
RL   Unpublished.
XX
RN   [3]
RP   1-4263
RA   Nickel G.C., Tefft D.L., Trevarthen K., Funt J., Adams M.D.;
RT   ;
RL   Submitted (31-AUG-2006) to the INSDC.
RL   Dept. of Genetics, Case Western Reserve University, 10900 Euclid Ave,
RL   Cleveland, OH 44106, USA
XX
DR   MD5; 478edb478fc62409442a23b30ae1d542.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4263
FT                   /organism="Pan troglodytes"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9598"
FT   gene            <96..>4099
FT                   /gene="ZNF483"
FT   mRNA            join(<96..510,1016..>1104)
FT                   /gene="ZNF483"
FT                   /product="ZNF483"
FT   CDS_pept        join(96..510,1016..>1104)
FT                   /codon_start=1
FT                   /gene="ZNF483"
FT                   /product="ZNF483"
FT                   /db_xref="GOA:A2T6Z3"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR038269"
FT                   /db_xref="UniProtKB/TrEMBL:A2T6Z3"
FT                   /protein_id="ABM91948.1"
FT                   /translation="MQAVVPLNKMTAISPEPQTLASTEQNEVPRVVTSGEQEAILRGNA
FT                   ADAESFRQRFRWFCYSEVAGPRKALSQLWELCNQWLRPDIHTKEQILELLVFEQFLTIL
FT                   PGEIRIWVKSQHPESSEEVVTLIEDLTQMLEEKEDPVSQDSTVSQEENSKEDKMVTVCP
FT                   NTESC"
FT   exon            <96..510
FT                   /gene="ZNF483"
FT                   /number=1
FT   gap             626..725
FT                   /estimated_length=unknown
FT   exon            1016..1104
FT                   /gene="ZNF483"
FT                   /number=2
FT   gap             1300..1399
FT                   /estimated_length=unknown
FT   mRNA            join(<1990..2082,2586..>4099)
FT                   /gene="ZNF483"
FT                   /product="ZNF483"
FT   CDS_pept        join(<1990..2082,2586..4099)
FT                   /codon_start=3
FT                   /gene="ZNF483"
FT                   /product="ZNF483"
FT                   /db_xref="GOA:A2T6Z4"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A2T6Z4"
FT                   /protein_id="ABM91949.1"
FT                   /translation="FPVSKLELISQLKWVELPWLLEEVSKGSRLDESALDKIIERCLRD
FT                   DDHGLMEESQQYCGSSEEDHGNQGNSKGRVAQNKTLGSGSRGKKFDPDKSPFGHNFKET
FT                   SDLIKHLRVYLRKKSRRYNESKKPFSFHSDLVLNRKEKTAGEKSRKSNDGGKVLSHSSA
FT                   LTEHQKRQKIHLGDRSQKCSKCGIIFIRRSTLSRRKTPMCEKCRKDSCQEAALNKDEGN
FT                   ESGEKTHKCSKCGKAFGYSASLTKHRRIHTGEKPYMCNECGKAFSDSSSLTPHHRTHSG
FT                   EKPFKCDDCGKGFTLSAHLIKHQRIHTGEKPYKCKDCGRPFSDSSSLIQHQRIHTGEKP
FT                   YTCSNCGKSFSHSSSLSKHQRIHTGEKPYKCGECGKAFRQNSCLTRHQRIHTGEKPYLC
FT                   NDCGMTFSHFTSVIYHQRLHSGEKPYKCNQCEKAFPTHSLLSRHQRIHTGVKPYKCKEC
FT                   GKSFSQSSSLNEHHRIHTGEKPYECNYCGATFSRSSILVEHLKIHTGRREYECNECEKT
FT                   FKSNSGLIRHRGFHSAE"
FT   exon            1990..2082
FT                   /gene="ZNF483"
FT                   /number=4
FT   gap             2267..2366
FT                   /estimated_length=unknown
FT   exon            2586..>4099
FT                   /gene="ZNF483"
FT                   /number=5
XX
SQ   Sequence 4263 BP; 1232 A; 712 C; 880 G; 1134 T; 305 other;
     ctttgatatt cctggctgtg tatagtgcct gttggtggac tgtactgata ctcaactaga        60
     gtgtgaaggg actggattcc tgcccctgag acacaatgca agctgtagtg cccttgaaca       120
     agatgacagc catctcacca gaacctcaaa ctctggcctc gactgaacaa aatgaggtcc       180
     caagagtggt tacttctggg gaacaagaag ctattttaag aggaaatgct gctgatgcag       240
     agtctttcag acagaggttt aggtggtttt gttactcaga agtagctgga cccaggaaag       300
     ctctgagtca actctgggag ctctgcaatc agtggctgag accagacatt cacacgaaag       360
     aacagatttt agagcttctg gtgtttgagc agttcctgac cattttgcct ggggagatca       420
     ggatttgggt aaagtcacaa catcctgaga gtagtgagga agtggtgacc ctaatagaag       480
     atttgaccca gatgcttgaa gaaaaagaag gtgagattta tagatggagg gaggaagcgg       540
     gagacattgc ctcaaagtcc gaaagtaaat tcctcaaaag aaggcaattt actgctaaag       600
     aggagtctga ggttagaagt tgggannnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnaacct ttgggaactg atgctatctc caggtagata gcgttagaaa tgaattagag       780
     gacacccagc tggtgcctgc tggggagtcc aacacagaat tgcctgctgg gtgtggggga       840
     aacaccccca catatctgga gtcacagaat tattttgtgt tgtgagtata gtaggagaaa       900
     ctgacttagt ttttttcctg tttatcactt agaagtgtat atatatatat atataaagat       960
     ttttagtctg aggaatctgt atgaacgact ggactggttt tctccccttt cctagatcca      1020
     gtctctcaag attctactgt ttcccaagag gagaactcaa aagaggataa aatggtcact      1080
     gtttgtccca atactgagtc ctgtgtaagt ttcctttgat ggtttttatt cctaagtgaa      1140
     tacttaattg agctcctact gagtggtata aagatataaa aataaaaggc taggcacggt      1200
     ggcttacacc tgtaatccca gcactttggg aggctgaggc aggaagatcg cttgagccca      1260
     agagttcagg gttgcagtga gctacatggt catagctgtn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nnnnnnnnna aaaaaaaaaa agtacttagg ttctatttgg gaataatcca      1440
     atacaaaaga gctgtttggt gttctaggaa tctataacat tgaaggatgt agctgtgacc      1500
     ttttcaagag gagagtggaa gaagctggag ccttttcaaa aggagctata taaggaagtg      1560
     ctactggaaa acctcaggaa cctagaattn nngggtaaag acaccttttc ttcattacct      1620
     agcgtttaac cttgggtctc tttttgttcc cttttattga aaggtaagtg ctatgtgaag      1680
     tacttggttt tggctgggga cccagggact gataggacta atcctaaaaa ctggttctga      1740
     aaatgtgctt ttctgcagtg tatcttctag aaaaggtctt tgcttcattg aattggaaat      1800
     gtgaagcatc attttgattt catcagtgga ataccttttc ccatttttgt ctcaagttcc      1860
     agtatttatg tctgtgtatt ttggtagcat gtttttatct tccttggaga accaaaggct      1920
     atatgtgaat gctgggatat ctttactcta tgcaaaacag caattttctg ttcttttctc      1980
     tatgagcaga ctttccagtt tcaaaattag agttgatttc ccagctaaag tgggttgaat      2040
     tgccatggct gctggaagaa gtctcaaaag gctcccgact aggtgagttg gtgaaaaata      2100
     cacaacgaaa ttaaagcagt tgtttagcaa gtctgttgag aagactcttt gaaatgttgg      2160
     gctgcctaga tactaaaata caaagatgat tagaatagag cccttgcctt cctgaaatgt      2220
     tcattttagt gggggagact tggtttgggt cctctgaata gatgccnnnn nnnnnnnnnn      2280
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2340
     nnnnnnnnnn nnnnnnnnnn nnnnnnataa agcacaaact tttcatcttt nncaatgttt      2400
     ttcttaacgc atgtgtttac attgtttccc tatattgcct tttccttttc tattttacaa      2460
     agctcttttt gagaaccatg gaaactatat tccttatagt tattaatgtg ttcctatttc      2520
     agacccaaaa tacaatagct tcctttcttg caaacaggaa atattctatt tcttatatct      2580
     tttagatgaa tcagctttag ataaaataat agaaaggtgc ctcagggatg atgatcatgg      2640
     cttgatggaa gaatcccagc aatattgtgg cagctcagag gaggatcacg gtaatcaggg      2700
     aaattcaaaa ggaagagtcg cacaaaacaa aactcttggg agtggcagta ggggtaagaa      2760
     atttgaccca gataaaagcc cctttggaca taatttcaaa gaaacttcag acttaattaa      2820
     acatctgaga gtctacttga ggaagaaatc tcggaggtat aatgaaagca agaaaccctt      2880
     cagttttcat tcagaccttg ttctgaaccg caaggagaaa accgccggag aaaagtcacg      2940
     gaaatctaat gatggtggga aagtcctgag tcactcttca gctcttactg aacatcagaa      3000
     acgtcagaag attcatttgg gggataggtc ccaaaaatgc agtaagtgtg ggataatctt      3060
     tattagaaga tcaactcttt ctaggagaaa aacccctatg tgtgagaaat gtcggaaaga      3120
     ttcatgtcaa gaagcagcct taaataaaga tgagggaaat gagagtggag aaaaaactca      3180
     taaatgtagt aagtgtggaa aagcctttgg ctatagcgcc tcactcacca aacatcggag      3240
     aattcacact ggagaaaaac cctatatgtg taatgaatgt ggaaaagctt ttagtgatag      3300
     ttcatcgctc acgccacatc atagaactca tagtggagag aaacccttca aatgtgatga      3360
     ctgtgggaaa ggtttcaccc taagtgctca cctcattaaa catcagagaa ttcatactgg      3420
     agaaaaacct tataaatgta aagactgtgg gagacccttt agtgacagtt catctcttat      3480
     tcaacatcag cgaattcata ctggagaaaa accctataca tgtagcaatt gtggaaaatc      3540
     cttcagtcat agctcatccc tttccaaaca tcagagaatt catactggag agaaacccta      3600
     taaatgtggc gaatgtggaa aagcctttag gcagaattca tgccttaccc ggcatcagag      3660
     aattcacact ggagaaaaac catatttgtg taatgattgc ggaatgactt ttagccattt      3720
     tacgtctgtg atttatcatc aaagacttca ttcaggagaa aaaccctaca aatgtaacca      3780
     gtgtgagaaa gctttcccaa cccattcact gctaagtcgt catcagagaa ttcatactgg      3840
     tgtaaaacct tataaatgta aagaatgtgg gaagtccttc agtcagagtt catctcttaa      3900
     tgagcaccac cgaattcata caggagagaa accctatgag tgtaactatt gtggtgcaac      3960
     ctttagtcga agctcaatcc ttgtagaaca cctaaaaatt cataccggaa ggagagaata      4020
     tgaatgtaac gaatgtgaga agacatttaa aagtaattca ggcctcatta gacatcgggg      4080
     atttcactct gcagagtaat cctggaacta cattaaagtg gggggaattt aattcaaatt      4140
     gtcagttact gaaaccctgg gatgtaaact tacagtattg atcagtagct gcagctttcg      4200
     taaattggca gttaggaaaa atattctttt gcccattcat ccctcttctt ttcaaggatg      4260
     gca                                                                    4263
//

If you have problems or comments...

PBIL Back to PBIL home page