(data stored in ACNUC24361 zone)

EMBL: DQ977510

ID   DQ977510; SV 1; linear; genomic DNA; STD; MAM; 1985 BP.
XX
AC   DQ977510;
XX
DT   29-JAN-2007 (Rel. 90, Created)
DT   28-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Pongo pygmaeus ZNF394 (ZNF394) gene, partial cds.
XX
KW   .
XX
OS   Pongo pygmaeus (Bornean orangutan)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Pongo.
XX
RN   [1]
RP   1-1985
RX   DOI; 10.1534/genetics.108.090548.
RX   PUBMED; 18689901.
RA   Nickel G.C., Tefft D.L., Goglin K., Adams M.D.;
RT   "An empirical test for branch-specific positive selection";
RL   Genetics 179(4):2183-2193(2008).
XX
RN   [2]
RP   1-1985
RA   Nickel G.C., Tefft D.L., Trevarthen K., Funt J., Adams M.D.;
RT   "Positive Selection in Transcription Factor Genes on the Human Lineage";
RL   Unpublished.
XX
RN   [3]
RP   1-1985
RA   Nickel G.C., Tefft D.L., Trevarthen K., Funt J., Adams M.D.;
RT   ;
RL   Submitted (31-AUG-2006) to the INSDC.
RL   Dept. of Genetics, Case Western Reserve University, 10900 Euclid Ave,
RL   Cleveland, OH 44106, USA
XX
DR   MD5; 0aee87179e3ee193de8209287d79d011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1985
FT                   /organism="Pongo pygmaeus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9600"
FT   gene            <9..>1867
FT                   /gene="ZNF394"
FT   mRNA            <9..>464
FT                   /gene="ZNF394"
FT                   /product="ZNF394"
FT   CDS_pept        9..>464
FT                   /codon_start=1
FT                   /gene="ZNF394"
FT                   /product="ZNF394"
FT                   /db_xref="GOA:A2T7N4"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR038269"
FT                   /db_xref="UniProtKB/TrEMBL:A2T7N4"
FT                   /protein_id="ABM89312.1"
FT                   /translation="MNSSLTVQRRGSDAELGPWVMAARSKDAALSQRDGVLPVKVEEDS
FT                   PGSWEPSYPAAWPDPETSRLHFRQLRYQEVAGPEEALSRLRELCRRWLRPELLSKEQIL
FT                   ELLVLEQFLTILPEELQAWVREHXPESGEEAVAVVRALQRALDGTSPQ"
FT   exon            <9..464
FT                   /gene="ZNF394"
FT                   /number=1
FT   gap             499..598
FT                   /estimated_length=unknown
FT   mRNA            <765..>1867
FT                   /gene="ZNF394"
FT                   /product="ZNF394"
FT   CDS_pept        <765..1867
FT                   /codon_start=3
FT                   /gene="ZNF394"
FT                   /product="ZNF394"
FT                   /db_xref="GOA:A2T7N5"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A2T7N5"
FT                   /protein_id="ABM89313.1"
FT                   /translation="LESRVENKELIPMQQILEEVEPQGXXQEAFQGKHPLFXKCGSTXE
FT                   DRVEKQXGNPLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRCXXXVLCQ
FT                   HIPKAERPTDGEEHGNKCKQSFHMVAWHVLKPHKSDSGDSFHHSSFFETQRXXHEDRPY
FT                   KCGNCGKSFKQRSDLFRHQRIHTGEKPYGCQECGKSFSQSAALTKHQRTHTGEKPYTCL
FT                   KCGERFRQNSHLNRHQSTHSRDKHFKCEECGETCHISNLFRHQRLHKGERPYKCEECKK
FT                   SFKQRSDLFKHHRIHTGEKPYGCSVCGKRFNQXATLIKHQRIHXGEKPYKXXECGERFX
FT                   QSTHLIRHQRIHQNKMLSVGRGGSRL"
FT   exon            765..>1867
FT                   /gene="ZNF394"
FT                   /number=3
XX
SQ   Sequence 1985 BP; 491 A; 416 C; 489 G; 343 T; 246 other;
     ggagaaagat gaattccagc ttgaccgtcc agaggcgcgg cagtgacgcc gagttgggac        60
     cctgggtgat ggctgcgagg tccaaggacg cggcgctgtc ccaacgcgac ggagttttgc       120
     ccgtgaaagt ggaggaagac tcacccggaa gttgggagcc cagctatccc gcggcttggc       180
     ctgaccccga aacttctcga ctgcacttta ggcagctgcg ttaccaggag gtggctggac       240
     cggaagaggc gctgagccgg ctccgagaac tctgtcgtcg gtggctgagg cccgagctgc       300
     tctccaagga gcagatcctg gagctgctgg tgctggagca gttcctcacc atcctgcccg       360
     aggagctcca agcctgggtg cgagagcacn gcccagagag cggggaggag gcggtggccg       420
     tggtgcgggc tctgcagcga gcgctcgatg gaacctcacc ccaggtgaga agcgaaaggc       480
     ccgttctgga ggtgggagnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnac       600
     tgcactcccg cctggtgaca aagcgagaca ccgtctcaaa aaattaatta attaattaaa       660
     ataaaaagta aaaggggttt gagggtttaa cattctgcca gcacttgctt atttctgtgt       720
     tgcacaggga tgcaatggca ggaatttgta ttttcatgtt tcaggtttgg aaagcagagt       780
     ggagaacaaa gagttgattc caatgcaaca aattttagaa gaagtggagc cacaggggca       840
     nnnncaagaa gcgttccagg ggaagcaccc cctgtttnnn aagtgtggca gtacccntga       900
     ggacagggtg gaaaagcagt nnggaaaccc cttgcnnnnn nnnnnngann nnnnnnnnnn       960
     nnnnnnagnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnc caggtgttnc nnnnntgttc tatgtcagca      1080
     catcccaaaa gcagagaggc ccactgacgg tgaggaacac gggaacaagt gcaagcagag      1140
     tttccacatg gtggcgtggc acgtgctgaa acctcacaag tctgacagtg gagacagttt      1200
     ccatcattcc agcttttttg agacccagag gnanntccat gaagacagac cttataaatg      1260
     tggtaactgt gggaagagtt tcaaacaacg ctctgacctc tttagacacc agagaatcca      1320
     cacaggtgag aaaccctatg gctgccaaga atgtgggaaa agcttcagcc agagcgctgc      1380
     cctgaccaag caccagagaa cacacacagg cgagaagccg tacacctgtc tgaaatgtgg      1440
     ggagcgcttc aggcagaatt cacacctaaa tcgtcatcaa agtacccaca gtagagacaa      1500
     acattttaaa tgtgaggaat gcggggaaac ctgtcatatt tccaaccttt ttagacatca      1560
     gagactacat aaaggggaga gaccctataa gtgtgaagaa tgtaagaaga gcttcaaaca      1620
     gcgntctgac ctctttaaac accacagaat ccacactggg gagaagccct atggatgttc      1680
     cgtctgtggg aaacgcttca atcagngtgc aaccctcatt aaacaccaga gaattcacan      1740
     tggggaaaag ccttacaaat gnnncgaatg tggggaaaga tttnnncaaa gtacacacct      1800
     tatccgacac caaagaattc atcaaaataa aatgctatcg gttgggcgcg gtggctcacg      1860
     cctgtaatcc cagcnntttg ggaggccaag gcaggcngat cntttgngat caggagtttg      1920
     aaaccagcct ggccaacatg gtaaaacccc atctctnnta caaatacaaa aatgagccgg      1980
     gcgtg                                                                  1985
//

If you have problems or comments...

PBIL Back to PBIL home page