(data stored in ACNUC23119 zone)

EMBL: EF094467

ID   EF094467; SV 2; linear; mRNA; STD; INV; 1638 BP.
XX
AC   EF094467;
XX
DT   19-APR-2007 (Rel. 91, Created)
DT   23-NOV-2016 (Rel. 131, Last updated, Version 2)
XX
DE   Acyrthosiphon pisum vasa-like protein (vasa) mRNA, partial cds.
XX
KW   .
XX
OS   Acyrthosiphon pisum (pea aphid)
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota;
OC   Neoptera; Paraneoptera; Hemiptera; Sternorrhyncha; Aphidomorpha;
OC   Aphidoidea; Aphididae; Macrosiphini; Acyrthosiphon.
XX
RN   [1]
RP   1-1638
RX   DOI; 10.1007/s00427-007-0142-7.
RX   PUBMED; 17333259.
RA   Chang C.C., Lin G.W., Cook C.E., Horng S.B., Lee H.J., Huang T.Y.;
RT   "Apvasa marks germ-cell migration in the parthenogenetic pea aphid
RT   Acyrthosiphon pisum (Hemiptera: Aphidoidea)";
RL   Dev. Genes Evol. 217(4):275-287(2007).
XX
RN   [2]
RP   1-1638
RA   Chang C.C., Lin G.W.;
RT   ;
RL   Submitted (31-OCT-2006) to the INSDC.
RL   Department of Entomology, National Taiwan University, No. 27, Lane 113,
RL   Roosevelt Road, Sec. 4, Taipei 106, Taiwan
XX
RN   [3]
RC   Sequence update by database staff to remove vector contamination
RP   1-1638
RA   Chang C.C., Lin G.W.;
RT   ;
RL   Submitted (21-NOV-2016) to the INSDC.
RL   Department of Entomology, National Taiwan University, No. 27, Lane 113,
RL   Roosevelt Road, Sec. 4, Taipei 106, Taiwan
XX
DR   MD5; 3bc42167fc81f5858a9fa1cf1d2a6f5a.
XX
CC   On Nov 21, 2016 this sequence version replaced gi:126512823.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1638
FT                   /organism="Acyrthosiphon pisum"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:7029"
FT   gene            1..>1638
FT                   /gene="vasa"
FT   CDS_pept        157..>1638
FT                   /codon_start=1
FT                   /gene="vasa"
FT                   /product="vasa-like protein"
FT                   /note="ATP-dependent RNA helicase; Apvasa; similar to
FT                   Drosophila vasa"
FT                   /db_xref="GOA:A4UF97"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4UF97"
FT                   /protein_id="ABO15582.1"
FT                   /translation="MSDGGWDDESGSSNQRGRGRGGNRGGGRGRGNCNNRNNDDFDSAS
FT                   QGDSWGNGGGSSEWGTNDDGDRDGGSRGRGGRGGRGRGGRGGGRNMDRSNGDEDGGDGN
FT                   FGGDDGEAPVNDKPRPTYIPPEIDENDVYGIGVGSNFNKYENIEVKVSGDNVPKHIESF
FT                   KSSGLREVLIEKLVKCNYTTPTPIQKYCIPVIISGRDMMATAQTGSGKTAAFVLPIVHT
FT                   LLSQPQDLVFDRDYCEPQCIIMSPTRELAIQIRDVVFKLTNGTCIKQSILYGGTATGHQ
FT                   RGTLANGIHILVATPGRLNDFVGRGYVSFNSLRFFVLDEADRMLDMGFKPDIEKILNHE
FT                   TMVDVNTRQTLLFSATLADDIQMLSKAYLKPNYVFVAVGEIGGACKDVKQEIREVTKFE
FT                   KKKELIKVLESLGDCKGTMVFVEQKRNADFIAAFLSEKDYPTTSIHGDREQPEREQALR
FT                   DFKNNRMKILVATAVAARGLDIKGVNCVINFDMPSS"
XX
SQ   Sequence 1638 BP; 502 A; 262 C; 396 G; 478 T; 0 other;
     atttcgtttt ggctcttccg cagacacgca ccctttcacg gtccggcatt cgttccacgc        60
     tctacagacc gcttccgcgt ttttcctgcg ctgcgagccc taacaaccga ttttattttt       120
     ccgtttgttt gcgttgccac ctagactcga tttataatgt ctgacggtgg ttgggatgat       180
     gaatctggtt cttcgaatca gagaggccgt ggccgtggtg gaaatcgtgg aggaggtcgt       240
     ggcagaggta actgcaataa tagaaacaat gacgacttcg actcagcttc acaaggtgat       300
     agttggggaa atggaggtgg ttctagtgaa tggggcacta atgatgatgg agatcgcgat       360
     ggtggatccc gcggccgtgg tggtcggggt ggaagaggaa gaggaggcag aggtggaggc       420
     cgaaatatgg atagaagtaa tggtgatgaa gatggtggtg atggaaattt tggcggtgat       480
     gatggagaag caccagttaa tgataaacca agaccaacat atatacctcc agaaattgat       540
     gaaaatgatg tctatggaat tggagttgga agcaatttca ataaatatga aaatattgaa       600
     gtcaaagtta gcggtgataa tgttcccaaa catattgaat cctttaagag ttcaggtttg       660
     cgtgaagttt tgatcgaaaa gttggtaaaa tgcaattaca ccacacctac tccgattcag       720
     aagtattgta ttcctgttat tattagtgga cgagatatga tggctactgc ccaaactggt       780
     tctggtaaaa ctgctgcatt tgttttgcca attgtgcata ctttactttc tcaaccacaa       840
     gatttagttt ttgatcggga ttactgtgaa cctcaatgta ttattatgtc accaacccga       900
     gaattagcta ttcaaattcg ggatgttgta tttaaattga caaatggaac ttgtattaaa       960
     caatcaattc tctatggtgg cactgcaaca ggacatcaaa gagggacact agctaatggt      1020
     attcatatat tagtagcaac acctggacgc ttaaatgatt ttgtgggtcg aggatacgta      1080
     tcatttaatt ctttaaggtt ctttgtgttg gacgaagcag atagaatgtt agatatgggt      1140
     ttcaagccgg atattgagaa aatattaaac cacgaaacaa tggtcgatgt taataccaga      1200
     caaacactcc tattttctgc cacgttagca gatgatattc aaatgttatc aaaagcttat      1260
     ttaaagccaa actatgtatt tgtcgctgtg ggtgaaattg gaggagcatg caaagatgta      1320
     aaacaagaaa ttagagaggt cactaagttt gaaaaaaaga aagaactaat aaaagttcta      1380
     gaatccttag gtgattgtaa aggaaccatg gtttttgtgg aacagaaaag gaatgctgat      1440
     tttattgctg cgttcttaag tgagaaagac tatcctacga ctagtattca tggtgatcgt      1500
     gaacaaccag agagagaaca agcattaaga gattttaaga ataatagaat gaaaattttg      1560
     gttgccactg cagttgctgc tagaggcctg gatataaaag gtgttaattg cgttataaat      1620
     tttgatatgc ctagctct                                                    1638
//

If you have problems or comments...

PBIL Back to PBIL home page