(data stored in ACNUC16935 zone)

EMBL: EF146368

ID   EF146368; SV 1; linear; mRNA; STD; PLN; 813 BP.
XX
AC   EF146368;
XX
DT   02-DEC-2007 (Rel. 94, Created)
DT   25-MAR-2009 (Rel. 100, Last updated, Version 2)
XX
DE   Populus trichocarpa clone WS0117_J16 unknown mRNA.
XX
KW   FLI_CDNA.
XX
OS   Populus trichocarpa (black cottonwood)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-813
RX   DOI; 10.1186/1471-2164-9-57.
RX   PUBMED; 18230180.
RA   Ralph S.G., Chun H.J., Cooper D., Kirkpatrick R., Kolosova N., Gunter L.,
RA   Tuskan G.A., Douglas C.J., Holt R.A., Jones S.J., Marra M.A., Bohlmann J.;
RT   "Analysis of 4,664 high-quality sequence-finished poplar full-length cDNA
RT   clones and their utility for the discovery of genes responding to insect
RT   feeding";
RL   BMC Genomics 9:57-57(2008).
XX
RN   [2]
RP   1-813
RA   Ralph S.G., Chun H.J.E., Cooper D., Kirkpatrick R., Palmquist D.,
RA   Wynhoven B., Kolosova N., Oddy C., Jancsik S., Douglas C.J., Liu J.,
RA   Butterfield Y.S.N., Stott J., Yang G., Holt R.A., Siddiqui A.,
RA   Jones S.J.M., Marra M.A., Ritland K., Bohlmann J.;
RT   ;
RL   Submitted (28-NOV-2006) to the INSDC.
RL   Genome BC Forest Genomics Program, University of British Columbia, Michael
RL   Smith Laboratories, 2185 East Mall, Rm. 321, Vancouver, British Columbia
RL   V6T 1Z4, Canada
XX
DR   MD5; c7d9c6fa0cc29f52135fb11ee814d1e8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..813
FT                   /organism="Populus trichocarpa"
FT                   /cultivar="383-2499 (Nisqually-1)"
FT                   /mol_type="mRNA"
FT                   /sex="Female"
FT                   /clone_lib="PT-P-FL-A-2"
FT                   /clone="WS0117_J16"
FT                   /tissue_type="Phloem and cambium from 8 year old trees
FT                   harvested within the Boise Cascade region of Washington
FT                   state on May 15th, 2001."
FT                   /db_xref="taxon:3694"
FT   CDS_pept        68..532
FT                   /codon_start=1
FT                   /product="unknown"
FT                   /note="similar to Arabisopsis thaliana At1g31340"
FT                   /db_xref="GOA:A9PDJ4"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038738"
FT                   /db_xref="UniProtKB/TrEMBL:A9PDJ4"
FT                   /protein_id="ABK94447.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGTMIKVKTLTGKEIEIDIEPNDTIDRIKE
FT                   RVEEKEGIPPVQQRLIYAGKQLGDDKTARDYNIEGGSVLHLVLALRGGCL"
XX
SQ   Sequence 813 BP; 255 A; 147 C; 184 G; 227 T; 0 other;
     gggagagctc gagtgttttt ttagagaagt acaagtctga taagacaaga cagaaacgaa        60
     gaagaagatg cagatcttcg ttaagacttt gactggcaag accataactc tcgaggtcga       120
     gagtagcgac accatcgaca acgttaaagc caagattcag gacaaggaag gcatccctcc       180
     tgatcagcaa agattgattt ttgctggtaa acaattagaa gatgggcgaa ctcttgctga       240
     ttacaatatc cagaaggagt cgacgcttca cttggttttg aggctcaggg gaggaactat       300
     gatcaaggtg aagactctaa ctggaaaaga aattgaaatt gacattgaac caaatgatac       360
     cattgatagg attaaggaac gggttgagga gaaagaggga attcctccag tgcagcaaag       420
     gcttatttat gctggcaagc agcttggaga tgataagaca gctcgtgact acaatattga       480
     gggtggctct gtgcttcatc ttgttcttgc tctgaggggt ggttgtcttt gaattgaact       540
     cataacgtta caaaaatcta cctatccaag cttcttccat acaagtacag catggggtta       600
     tgagaatcca caataaatat cttcttataa tttttctaga cacaagattg ttcaattatc       660
     ttacactacc tccgcttgct gctttcttat gtttttgcaa ggttaaacca atgcctgctt       720
     tacttgttca ctcgtaccac gtcacatgta tttttgagct tttaaccggt agatatgcat       780
     gtgcatttgt ggtggcgaaa aaaaaaaaaa aaa                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page