(data stored in ACNUC22857 zone)

EMBL: EF147704

ID   EF147704; SV 1; linear; mRNA; STD; PLN; 559 BP.
XX
AC   EF147704;
XX
DT   02-DEC-2007 (Rel. 94, Created)
DT   25-MAR-2009 (Rel. 100, Last updated, Version 2)
XX
DE   Populus trichocarpa clone WS0124_G21 unknown mRNA.
XX
KW   FLI_CDNA.
XX
OS   Populus trichocarpa (black cottonwood)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-559
RX   DOI; 10.1186/1471-2164-9-57.
RX   PUBMED; 18230180.
RA   Ralph S.G., Chun H.J., Cooper D., Kirkpatrick R., Kolosova N., Gunter L.,
RA   Tuskan G.A., Douglas C.J., Holt R.A., Jones S.J., Marra M.A., Bohlmann J.;
RT   "Analysis of 4,664 high-quality sequence-finished poplar full-length cDNA
RT   clones and their utility for the discovery of genes responding to insect
RT   feeding";
RL   BMC Genomics 9:57-57(2008).
XX
RN   [2]
RP   1-559
RA   Ralph S.G., Chun H.J.E., Cooper D., Kirkpatrick R., Palmquist D.,
RA   Wynhoven B., Kolosova N., Oddy C., Jancsik S., Douglas C.J., Liu J.,
RA   Butterfield Y.S.N., Stott J., Yang G., Holt R.A., Siddiqui A.,
RA   Jones S.J.M., Marra M.A., Ritland K., Bohlmann J.;
RT   ;
RL   Submitted (28-NOV-2006) to the INSDC.
RL   Genome BC Forest Genomics Program, University of British Columbia, Michael
RL   Smith Laboratories, 2185 East Mall, Rm. 321, Vancouver, British Columbia
RL   V6T 1Z4, Canada
XX
DR   MD5; 6816808bea74f49a55e742ba81e5c121.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..559
FT                   /organism="Populus trichocarpa"
FT                   /cultivar="383-2499 (Nisqually-1)"
FT                   /mol_type="mRNA"
FT                   /sex="Female"
FT                   /clone_lib="PT-GT-FL-A-3"
FT                   /clone="WS0124_G21"
FT                   /tissue_type="Young and mature leaves, along with green
FT                   stems, from 8 year old trees harvested within the Boise
FT                   Cascade region of Washington state on May 15th, 2001."
FT                   /db_xref="taxon:3694"
FT   CDS_pept        101..298
FT                   /codon_start=1
FT                   /product="unknown"
FT                   /note="similar to Arabisopsis thaliana At4g23460"
FT                   /db_xref="GOA:A9PH57"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR015151"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:A9PH57"
FT                   /protein_id="ABK95710.1"
FT                   /translation="MFFIAKRKHANQDVFYFSAKMPRGIPFLTELTTVVGIPGIKCAIK
FT                   TPNPEMASLFFEAIETLLKG"
XX
SQ   Sequence 559 BP; 146 A; 115 C; 101 G; 197 T; 0 other;
     cccgaggtcc cttcctgatt caaatgaggt ctcaaaggac ttcccaggca ttaccgtgaa        60
     tggtgtagaa gctactttag accggcttgc tgcatcaaac atgtttttta ttgcaaagcg       120
     aaagcatgca aaccaggatg tattctactt ctcagctaaa atgcctagag gaattccttt       180
     cttgaccgaa ctcacaacag ttgttggaat ccccgggatc aagtgtgcca tcaagactcc       240
     aaaccctgag atggcaagtc ttttctttga agccattgag accctcctta agggttgatt       300
     caaggttctg cgtcttcata tttttttctt ttcttttctt aaatatttac aatttttggt       360
     ttatatttgt aaaatccgta ttgtttagtg aggttttaat tgatcattct ggccgcctta       420
     gtttttttct tcactccacc ttgtattatt tcgcactcta ttctttggtt gtattgaatc       480
     tgttatatcg ccagggggac tcaaacttgt gtatttttta atcatccctg gaaacttgag       540
     tgcaaaaaaa aaaaaaaaa                                                    559
//

If you have problems or comments...

PBIL Back to PBIL home page