(data stored in ACNUC7421 zone)

EMBL: EF215086

ID   EF215086; SV 1; linear; mRNA; HTC; MAM; 680 BP.
XX
AC   EF215086;
XX
DT   28-JUN-2007 (Rel. 92, Created)
DT   28-JUN-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Callithrix jacchus clone O07-52.1_H04_009.ab1 mitochondrial
DE   methylglutaconyl-CoA hydratase precursor-like protein mRNA, partial cds;
DE   nuclear gene for mitochondrial product.
XX
KW   HTC.
XX
OS   Callithrix jacchus (white-tufted-ear marmoset)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Platyrrhini; Cebidae;
OC   Callitrichinae; Callithrix; Callithrix.
XX
RN   [1]
RP   1-680
RX   DOI; 10.1186/1471-2164-8-190.
RX   PUBMED; 17592630.
RA   Datson N.A., Morsink M.C., Atanasova S., Armstrong V.W., Zischler H.,
RA   Schlumbohm C., Dutilh B.E., Huynen M.A., Waegele B., Ruepp A.,
RA   de Kloet E.R., Fuchs E.;
RT   "Development of the first marmoset-specific DNA microarray (EUMAMA): a new
RT   genetic tool for large-scale expression profiling in a non-human primate";
RL   BMC Genomics 8:190-190(2007).
XX
RN   [2]
RP   1-680
RA   Datson N.A., Dutilh B., Huynen M., Zischler H., Ruepp A., de Kloet E.R.,
RA   Fuchs E., Waegele B.A.;
RT   ;
RL   Submitted (10-JAN-2007) to the INSDC.
RL   Division of Medical Pharmacology, Leiden/Amsterdam Center for Drug Research
RL   (LACDR), Leiden University, Leiden, Netherlands
XX
DR   MD5; c817d7840e6da5780430b7226ab3d912.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..680
FT                   /organism="Callithrix jacchus"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /clone="O07-52.1_H04_009.ab1"
FT                   /tissue_type="hippocampus"
FT                   /db_xref="taxon:9483"
FT   CDS_pept        <1..197
FT                   /codon_start=3
FT                   /product="mitochondrial methylglutaconyl-CoA hydratase
FT                   precursor-like protein"
FT                   /note="similar to AUH"
FT                   /db_xref="GOA:A6MKI8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A6MKI8"
FT                   /protein_id="ABQ22579.1"
FT                   /translation="REFLPQGPVAVRVAKLAINQGMEVDLVTGLAIEEACYAQTIPTKD
FT                   RLEGLLAFKEKRPPRYKGE"
XX
SQ   Sequence 680 BP; 246 A; 104 C; 122 G; 208 T; 0 other;
     caagagagtt tttacctcag ggacctgttg cagtgagagt ggcaaaatta gcaattaatc        60
     aaggcatgga ggtcgattta gtaacagggt tagccataga agaagcttgt tatgctcaga       120
     ccattccaac gaaagacaga cttgaaggtc ttcttgcttt taaagagaaa aggccccctc       180
     gctataaagg agaataaaag gaacagaaat tcttaagatg ccagtgtaat aaatgtactt       240
     ctggaagtgt cttttggatc cactatatgc ctgagcacgt ggaatctcaa tgaccaaagt       300
     gaagagaaaa ttattcatat agtgtaatta gcatccggaa tggacccatc tgtgtacttc       360
     actcaaatat gtaaatgtca tattcattca gatttataaa gctagtagtg tatattgtca       420
     gaaaacaggc aaagttagat atacattttt aaatatttcc tgcataagag gctttctgtt       480
     cttaattttt taatgtgaat aatttatata ttgcacacta ggaaataata ttgattatat       540
     gtctactgtg ctgcattaat aaaataaaat aaaattattt ctctatacca aaaatgtgaa       600
     gttataccaa ataaagtttc taagtgattg atgcatatga acctatacag acacatacat       660
     ctaaacctga aaaacgaatt                                                   680
//

If you have problems or comments...

PBIL Back to PBIL home page