(data stored in ACNUC8465 zone)

EMBL: EF433291

ID   EF433291; SV 1; linear; mRNA; STD; VRT; 2787 BP.
XX
AC   EF433291;
XX
DT   01-MAR-2008 (Rel. 95, Created)
DT   01-MAR-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Danio rerio mitogen-activated protein kinase kinase 2 (map2k2) mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-2787
RA   Cheng C.H., Chen G.D., Huang K.Y., Huang F.L., Huang C.J.;
RT   ;
RL   Submitted (29-JAN-2007) to the INSDC.
RL   Institute of Biological Chemistry, Academia Sinica, 128 Sec 2 Academia Rd.,
RL   Nankang, Taipei 115, Taiwan
XX
DR   MD5; 48f7cc5f9ccfae281e5c3d193e116ba6.
DR   Ensembl-Gn; ENSDARG00000006609; danio_rerio.
DR   Ensembl-Tr; ENSDART00000010048; danio_rerio.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2787
FT                   /organism="Danio rerio"
FT                   /chromosome="19"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:7955"
FT   gene            1..2787
FT                   /gene="map2k2"
FT   CDS_pept        513..1706
FT                   /codon_start=1
FT                   /gene="map2k2"
FT                   /product="mitogen-activated protein kinase kinase 2"
FT                   /note="MAP2K2"
FT                   /db_xref="GOA:Q1LY62"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q1LY62"
FT                   /db_xref="ZFIN:ZDB-GENE-041027-1"
FT                   /protein_id="ABQ95652.1"
FT                   /translation="MAPKRRPVPLIITPTGEGQSTNIDAAAEANLEALQRKLGELDLDE
FT                   QQRKRLEAFLTQKAQVGELKDEDFEPICELGAGNGGVVHKVRHKPSRLVMARKLIHLEI
FT                   KPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEARRIP
FT                   EEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMAN
FT                   SFVGTRSYMSPERLQGTHYSVQSDVWSMGLSLVELAIGRYPIPPPDAKELEAIFGRPVL
FT                   DAGGAEGHSMSPRPRPPGRPVSGHGMDSRPAMAIFELLDYIVNEPPPKLPHGVFTTDFE
FT                   EFVTKCLIKNPADRADLKMLMGHTFIKRAEVEEVDFAGWLCKTMGLHQPSTPTHSAE"
XX
SQ   Sequence 2787 BP; 706 A; 634 C; 650 G; 797 T; 0 other;
     gcgatgacgc aagttctctg gcggcagttc tcgcgagatc gagcaaacgc ttcctcttgg        60
     ttggttagcg gcttcctggc cggacttttt ccccctcctt ttttcttggg ggaaatttca       120
     acttctgttt tcgcggctcc tccgagccaa actatttcgg acagcgtttc tcgcccggtc       180
     ctgaggctgt gaacgatagg cctaacttgt cttttgccgc cttttgtctg tgggagcgct       240
     cgcgagtcag aggccgtgcc ggagagacat tccagcgatg cacgcgctta aataaactgc       300
     atttcctgca cttttacctc tgagccactc gctttttcat ttgacacttt aatttcacct       360
     ggagcagctt ttgagagcat gattgggtgt tgaaatttgg ggcttgctaa tctcagaaac       420
     ttccactaca agggtttgtg tatcagtttg aagtattgga tgtcagtaga gacaacctgg       480
     ttgctttctt tgaaattgat aactttgcaa gtatggcacc aaaaagaaga ccagtcccct       540
     tgattataac ccccactgga gagggacagt caaccaacat tgatgcagca gcagaggcca       600
     acctggaggc cttgcagagg aagttaggtg agctggattt ggatgaacag cagaggaagc       660
     gcctcgaagc tttcctcacc cagaaagccc aggtgggcga gctcaaggat gaagatttcg       720
     aacccatatg tgaacttggc gctggtaatg gtggagtggt tcataaagtc cgtcacaaac       780
     cctcgagact ggttatggcc aggaagctta tacacttgga aatcaaacca gccatcagga       840
     accagattat tcgagagctg caggttctac acgagtgtaa ctcaccgtac attgtagggt       900
     tttacggcgc cttctacagt gatggagaaa tcagcatctg tatggagcac atggatggag       960
     gctctttgga tcaagtgctc aaagaagcca gaagaatccc tgaggaaatt ttgggcaaag      1020
     ttagcatagc tgtactcaga ggtttggcgt atcttcggga gaagcaccaa ataatgcaca      1080
     gagacgttaa gccctccaac atcctggtga actcgcgcgg tgagatcaaa ctgtgcgact      1140
     ttggtgtgag tggccagctc atcgactcta tggccaactc cttcgttgga acacggtcgt      1200
     acatgtcgcc ggagagactc cagggcacgc actactcggt tcagtcggat gtgtggagca      1260
     tgggcctatc actggttgag cttgctattg gacgctaccc catcccccct cccgatgcta      1320
     aggaactgga ggccatattt ggccggccag tgctggatgc aggtggggca gaaggtcaca      1380
     gcatgtctcc aagacccagg cctccaggac gaccagttag tggacacgga atggacagca      1440
     ggccagcaat ggctatattt gagctactgg actacattgt caatgagcct ccacccaagc      1500
     tcccccatgg cgtcttcacc acagactttg aggagtttgt gacaaaatgc ctcataaaga      1560
     accctgctga cagagctgac ctcaagatgc taatgggtca cacgttcatc aagcgggctg      1620
     aggttgagga ggtggatttt gctggatggt tgtgtaaaac catgggcctt caccagccta      1680
     gcacacccac tcatagcgct gaatgaatgc tggctcatac cgttgccacc catgccatcc      1740
     tccactctac ttctgtcctc tttgctctca caggcctgta tgcttgtaag cctccgacac      1800
     accgctgtgc actcttttgc cgttctctgc ttgctcttcc cttccgctgc agtgcgttct      1860
     gggggcattg ttttatagga gcctctggtg ttggaacact tggtcatttg aacgaatatg      1920
     gagatttata gtcacttaag tgaagtggct gtatttttaa cgaccagctt attcaggaat      1980
     gtgtccaaaa tggttaagat caactgggtt ttggttttgt ataacagcat tttcattagc      2040
     tttatgatgc ttttcttttc accgtctgtt tattaattaa tcacaatcac aatctctgtt      2100
     gctaatgtgc cattcgttgg caattagcat tacactgtgt taagatgtat agcctggttc      2160
     aatggcaagc atttcattat gaatcaactg ccgtttaaaa caagataaaa gaatgagaga      2220
     aaaccaaaga gggctactat ggattataca ctatggttgg tttattacta attataaggc      2280
     gattattata aatgcaggat ggccaaatca ccaatttatc aagcacatgt gtacaagttt      2340
     ttaacttgtg ctttgcatgg ccagtcacac caacaaatgg ccatgccgtg agtttgcaca      2400
     cattaccaca tattaaaaaa agctatatta aagttcctgt atcagatgcc cttagttctg      2460
     ctgtgcctgt taaaaagatc tcttttagta ttcatatttg gtttgaacac catttgatcc      2520
     ccttaacatt ggcccttaaa aatgtttcat cgcatctttc tcaagtatag tttaaatcat      2580
     gcttgactca tttttgcgac cagtgcttga acggttttct tagaacgtgc tttattgaaa      2640
     taatctgtag aaaagtatat ttgggtaaaa ttattgtttg taatttatgc tgtaatgtct      2700
     ttgatttaag tttgagtaca accagagttg cacagtgctt tttccatgga ctctatgaat      2760
     ttgaacacat ccaaatgact ccaacta                                          2787
//

If you have problems or comments...

PBIL Back to PBIL home page