(data stored in ACNUC16935 zone)

EMBL: EF437347

ID   EF437347; SV 1; linear; mRNA; HTC; MUS; 214 BP.
XX
AC   EF437347;
XX
DT   31-JAN-2008 (Rel. 94, Created)
DT   31-JAN-2008 (Rel. 94, Last updated, Version 1)
XX
DE   Mus musculus isolate NTA2L17 ubiquitin A-52 residue ribosomal protein
DE   fusion product 1 (Uba52) mRNA, partial cds.
XX
KW   HTC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-214
RA   Tkatchenko T.V., Tkatchenko A.V., Moreno R., Molkentin J., Markwald R.R.;
RT   "Periostin controls the outflow tract formation through Notch1 sygnaling
RT   pathway";
RL   Unpublished.
XX
RN   [2]
RP   1-214
RA   Tkatchenko T.V., Tkatchenko A.V., Moreno R., Molkentin J., Markwald R.R.;
RT   ;
RL   Submitted (14-FEB-2007) to the INSDC.
RL   Anatomy and Cell Biology, Wayne State University, 540 E. Canfield Ave.,
RL   Scott Hall, Room 7133, Detroit, MI 48201, USA
XX
DR   MD5; 575759c2eadbac24bcf6049d63bbad07.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..214
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /isolate="NTA2L17"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryonic stage E12.5"
FT                   /tissue_type="whole hearts"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>214
FT                   /gene="Uba52"
FT   CDS_pept        <1..>214
FT                   /codon_start=1
FT                   /gene="Uba52"
FT                   /product="ubiquitin A-52 residue ribosomal protein fusion
FT                   product 1"
FT                   /db_xref="GOA:B0LAC2"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:B0LAC2"
FT                   /protein_id="ABS83516.1"
FT                   /translation="EPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ
FT                   KESTLHLVLRLRGGIIEPSLRQLAQK"
XX
SQ   Sequence 214 BP; 55 A; 66 C; 57 G; 36 T; 0 other;
     gagcccagtg acaccatcga gaatgtcaag gccaagatcc aagacaagga aggcatccca        60
     cctgaccagc agaggctgat attcgcgggc aaacagctgg aggatggccg caccctgtcc       120
     gactacaaca tccagaaaga gtccaccttg cacctggtgc tgcgtctgcg cggtggcatc       180
     attgagccat cccttcgtca gcttgcccag aagt                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page