(data stored in ACNUC16935 zone)

EMBL: EF580991

ID   EF580991; SV 1; linear; mRNA; STD; MUS; 228 BP.
XX
AC   EF580991;
XX
DT   29-MAY-2007 (Rel. 91, Created)
DT   29-MAY-2007 (Rel. 91, Last updated, Version 1)
XX
DE   Mus musculus ubiqutin subunit 1 mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-228
RA   Drexler I., Gasteiger G., Sutter G.;
RT   ;
RL   Submitted (25-APR-2007) to the INSDC.
RL   Institute for Molecular Virology, GSF, Schneckenburgerstr. 8, Munich 81675,
RL   Germany
XX
DR   MD5; f4745377e59783e91bbb47b8ded777eb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..228
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /cell_line="B16F1"
FT                   /cell_type="melanoma"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        1..>228
FT                   /codon_start=1
FT                   /product="ubiqutin subunit 1"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:98889"
FT                   /db_xref="UniProtKB/TrEMBL:A5JUZ1"
FT                   /protein_id="ABQ52426.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGG"
XX
SQ   Sequence 228 BP; 63 A; 67 C; 63 G; 35 T; 0 other;
     atgcagatct tcgtgaagac cctgacaggc aagaccatca ccctggaggt cgagcccagt        60
     gacaccatag agaatgtcaa ggcaaagatc caggacaagg agggcatccc ccctgaccag       120
     cagaggctga tctttgcagg caagcagctg gaagatggcc gcaccctgtc agactacaac       180
     atccagaaag agtccaccct gcacctggtc cttcgcctga gaggtggg                    228
//

If you have problems or comments...

PBIL Back to PBIL home page