(data stored in ACNUC8465 zone)

EMBL: EF666056

ID   EF666056; SV 1; linear; mRNA; STD; PLN; 1020 BP.
XX
AC   EF666056;
XX
DT   16-JUL-2007 (Rel. 92, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Oryza sativa (indica cultivar-group) mitogen-activated protein kinase
DE   kinase 10-2 mRNA, complete cds.
XX
KW   .
XX
OS   Oryza sativa Indica Group (long-grained rice)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade;
OC   Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
XX
RN   [1]
RP   1-1020
RX   DOI; 10.1016/j.plaphy.2008.05.014.
RX   PUBMED; 18619847.
RA   Kumar K., Rao K.P., Sharma P., Sinha A.K.;
RT   "Differential regulation of rice mitogen activated protein kinase kinase
RT   (MKK) by abiotic stress";
RL   Plant Physiol. Biochem. 46(10):891-897(2008).
XX
RN   [2]
RP   1-1020
RA   Kumar K., Sinha A.K.;
RT   ;
RL   Submitted (11-JUN-2007) to the INSDC.
RL   National Institute for Plant Genome Research, Aruna Asaf Ali Marg, New
RL   Delhi 110067, India
XX
DR   MD5; 92e6f12eac7369d0d9db4f95328f0128.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1020
FT                   /organism="Oryza sativa Indica Group"
FT                   /cultivar="Pusa Basmati-1"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:39946"
FT   CDS_pept        1..1020
FT                   /codon_start=1
FT                   /product="mitogen-activated protein kinase kinase 10-2"
FT                   /note="OsMKK10-2"
FT                   /db_xref="GOA:A2XE35"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A2XE35"
FT                   /protein_id="ABS10819.1"
FT                   /translation="MALVRQRRHLPHLTLPLDHFALRPPPAPQQQQQPAVAPSTSSDVR
FT                   LSDFERISVLGHGNGGTVYKARHRRGCPAQQPLALKLFASGDLSAAREAEILRLAADAP
FT                   HVVRLHAVVPSAAGGVEEPAALALELMPGGSLAGLLRRLGRPMGERPIAAVARQALLGL
FT                   EALHALRIVHRDLKPSNLLLGADGEVKIADFGAGKVLRRRLDPCASYVGTAAYMSPERF
FT                   DPEAYSGDYDPYAADVWSLGVAILELYLGHFPLLPVGQRPDWAALMCAICFGEAPEMPA
FT                   AASEEFRDFVSRCLEKKAGRRASVGELLEHPFIAERDAADAQRSLAALVAEAEQSGDL"
XX
SQ   Sequence 1020 BP; 123 A; 392 C; 356 G; 149 T; 0 other;
     atggctctcg tccgccagcg acgccacctg ccgcacctca ccctcccgct cgatcacttc        60
     gccctccgcc cgccgccggc gccgcagcag cagcagcagc ccgcagtcgc gccgtccacc       120
     tcctctgacg tccgcctctc ggacttcgag aggatctccg tcctcggcca cggcaacggc       180
     gggacggtgt acaaggcgcg ccaccgacgg ggttgccccg cgcagcagcc gctcgcgctc       240
     aagctcttcg cctccgggga cctctccgcg gcgcgggagg ccgagatact caggctcgcg       300
     gcggatgccc cgcacgtcgt gaggctccac gcggtggtcc cgtcggccgc cggtggggtg       360
     gaggagcccg ccgcgctggc gctcgagctc atgcccgggg gttccctggc tgggttgctt       420
     cgccgtctcg ggcgcccgat gggggagcgc cccatcgccg ccgtggcgag gcaggcgcta       480
     ctcgggctcg aggcccttca cgcgctccgc atcgtgcacc gcgacctcaa gccgtcgaac       540
     ctgctcctcg gcgccgacgg cgaggtcaag atcgccgact tcggcgcggg caaggtcctg       600
     cggcggcggc tcgacccctg cgcgtcctac gtcgggacgg cggcctacat gtccccggag       660
     aggttcgacc cggaggccta ctccggcgac tacgacccgt acgccgccga cgtgtggagc       720
     ctcggggtag cgatccttga gctgtacctc ggccacttcc cgcttctccc cgtggggcag       780
     cgccccgact gggcggcgct catgtgcgcc atatgcttcg gcgaggcgcc ggagatgccg       840
     gccgccgcgt cggaggagtt ccgggacttc gtgtcgcggt gcctcgagaa gaaggccggg       900
     cggcgcgcgt cggtcggcga gctgctcgag cacccgttca tcgccgagcg ggacgccgcc       960
     gatgcgcagc gctcgctcgc cgcgctcgtc gccgaggcgg agcagagcgg cgatctataa      1020
//

If you have problems or comments...

PBIL Back to PBIL home page