(data stored in ACNUC16935 zone)

EMBL: EF688558

ID   EF688558; SV 1; linear; mRNA; STD; MAM; 894 BP.
XX
AC   EF688558;
XX
DT   28-AUG-2007 (Rel. 93, Created)
DT   28-AUG-2007 (Rel. 93, Last updated, Version 1)
XX
DE   Sus scrofa ubiquitin B (UBB) mRNA, complete cds.
XX
KW   .
XX
OS   Sus scrofa (pig)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae; Sus.
XX
RN   [1]
RP   1-894
RA   Xie S., Li J.;
RT   "Sus scrofa ubiquitin B gene";
RL   Unpublished.
XX
RN   [2]
RP   1-894
RA   Xie S., Li J.;
RT   ;
RL   Submitted (19-JUN-2007) to the INSDC.
RL   Animal Genetics, Breeding and Reproduction, College of Animal Science,
RL   South China Agricultural University, Wushan Road, Guangzhou, Guangdong
RL   510642, China
XX
DR   MD5; 5a9ab31eeb4332e37067abe66eae2663.
DR   Ensembl-Gn; ENSSSCG00000018033; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00000019628; sus_scrofa.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..894
FT                   /organism="Sus scrofa"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9823"
FT   gene            1..894
FT                   /gene="UBB"
FT   CDS_pept        89..778
FT                   /codon_start=1
FT                   /gene="UBB"
FT                   /product="ubiquitin B"
FT                   /db_xref="GOA:A7U5U2"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:A7U5U2"
FT                   /protein_id="ABU49130.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
FT                   LRLRGGC"
XX
SQ   Sequence 894 BP; 222 A; 237 C; 234 G; 201 T; 0 other;
     ggcattgttg gcggtttcgc tgttgcggtc gagggtgatt cgggtgtgat tggcttcaca        60
     gcgtctgtgc cttcactcac aggtcaaaat gcagatcttc gtgaagacct tgaccggcaa       120
     gaccatcacc ctggaggtgg agcccagtga caccatcgag aatgtgaagg ccaagatcca       180
     ggataaggag ggcattcccc ccgaccagca gaggctcatc tttgcaggca agcagctgga       240
     ggatggccgc actctttctg attacaacat ccagaaagag tccaccctcc atctggttct       300
     gcgtctgagg ggtggtatgc agatcttcgt gaagaccttg accggcaaga ccatcactct       360
     ggaggtggag cccagtgaca ccatcgagaa tgtgaaggcc aagatccagg ataaggaagg       420
     cattcccccc gaccagcaga ggctcatctt tgcaggcaag cagctggaag atggccgcac       480
     tctttctgat tacaacatcc agaaagagtc cactctccat ctggttctgc gtctgagggg       540
     tggtatgcag atcttcgtga agaccttgac cggcaagacc atcaccctgg aggtggagcc       600
     cagtgacacc atcgagaatg tgaaggccaa gatccaggat aaggaaggca ttccccctga       660
     ccagcagagg ctcatctttg caggcaagca gctggaagat ggccgcactc tttctgatta       720
     caacatccag aaagagtcca ctctccatct ggtcctccgt ctgaggggtg gctgctaatt       780
     ctccagtctt gcattcataa tgcccactga tggcattact ctgcactcta gccatttgcc       840
     ccaatttaag tttagaaatt acaagtttca gtaatagctg aacctgtcca aaat             894
//

If you have problems or comments...

PBIL Back to PBIL home page