(data stored in ACNUC16935 zone)

EMBL: EF688559

ID   EF688559; SV 1; linear; genomic DNA; STD; MAM; 1551 BP.
XX
AC   EF688559;
XX
DT   28-AUG-2007 (Rel. 93, Created)
DT   28-AUG-2007 (Rel. 93, Last updated, Version 1)
XX
DE   Sus scrofa ubiquitin B (UBB) gene, complete cds.
XX
KW   .
XX
OS   Sus scrofa (pig)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae; Sus.
XX
RN   [1]
RP   1-1551
RA   Xie S., Li J.;
RT   "Sus scrofa ubiquitin B gene";
RL   Unpublished.
XX
RN   [2]
RP   1-1551
RA   Xie S., Li J.;
RT   ;
RL   Submitted (19-JUN-2007) to the INSDC.
RL   Animal Genetics, Breeding and Reproduction, College of Animal Science,
RL   South China Agricultural University, Wushan Road, Guangzhou, Guangdong
RL   510642, China
XX
DR   MD5; ffb06831e0ecfbd986afc373fa064303.
DR   Ensembl-Gn; ENSSSCG00000018033; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00000019628; sus_scrofa.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1551
FT                   /organism="Sus scrofa"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9823"
FT   gene            <746..>1435
FT                   /gene="UBB"
FT   mRNA            <746..>1435
FT                   /gene="UBB"
FT                   /product="ubiquitin B"
FT   CDS_pept        746..1435
FT                   /codon_start=1
FT                   /gene="UBB"
FT                   /product="ubiquitin B"
FT                   /db_xref="GOA:A7U5U2"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:A7U5U2"
FT                   /protein_id="ABU49131.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
FT                   LRLRGGC"
XX
SQ   Sequence 1551 BP; 349 A; 378 C; 473 G; 351 T; 0 other;
     ggcattgttg gcggtttcgc tgttgcggtc gagggtgatt cgggtgtgat tggcttcaca        60
     gcgtctgtgc cttcactcac aggtactgag ccttcgcccg tgagcgtggg gagcagtgga       120
     gaggggttcc cggggcgggc gacccggcgg gtctcaggcg gggcggggtg ggggagggga       180
     ggcgcgctga cgcggcgccg gcctttgcgg aagagcgggc cttgtttacg tgtggggcgc       240
     gggggcgctt ggcgcgggcg cccgcagagg tcaacggaca cttgagggag attccatcgt       300
     gtctgcccca ggggggaagg tgggaaagag gtagtgtagc cgggcttctg gaaaccttgt       360
     tctgaatcct gacgtggaga gggtgtcgca cccacctccc aacgggaatt tcaatgctac       420
     cgtcattagg ttagggggac gttgggggct ggcggcggcg aacctaacga agtatctgga       480
     gcagttgaga aagatttgga tcctcgtctg ggcaagcagt tgcgattatt ctccaccctg       540
     ctttgattga catcttgact aaggaatcgt gtgttcggtg gcttcattct cgcgtagtgt       600
     agtcaaaatc gggggaggtt tgtgagggac cttgacctct tcaaggcatt ttggagtaat       660
     aggtcgttcc aaagaactgg ttatatacga atagtgaaac atcgtgaggt gatacagtac       720
     gttttcttga actctatagg tcaaaatgca gatcttcgtg aagaccttga ccggcaagac       780
     catcaccctg gaggtggagc ccagtgacac catcgagaat gtgaaggcca agatccagga       840
     taaggagggc attccccccg accagcagag gctcatcttt gcaggcaagc agctggagga       900
     tggccgcact ctttctgatt acaacatcca gaaagagtcc accctccatc tggttctgcg       960
     tctgaggggt ggtatgcaga tcttcgtgaa gaccttgacc ggcaagacca tcactctgga      1020
     ggtggagccc agtgacacca tcgagaatgt gaaggccaag atccaggata aggaaggcat      1080
     tccccccgac cagcagaggc tcatctttgc aggcaagcag ctggaagatg gccgcactct      1140
     ttctgattac aacatccaga aagagtccac tctccatctg gttctgcgtc tgaggggtgg      1200
     tatgcagatc ttcgtgaaga ccttgaccgg caagaccatc accctggagg tggagcccag      1260
     tgacaccatc gagaatgtga aggccaagat ccaggataag gaaggcattc cccctgacca      1320
     gcagaggctc atctttgcag gcaagcagct ggaagatggc cgcactcttt ctgattacaa      1380
     catccagaaa gagtccactc tccatctggt cctccgtctg aggggtggct gctaattctc      1440
     cagtcttgca ttcataatgc ccactgatgg cattactctg cactctagcc atttgcccca      1500
     atttaagttt agaaattaca agtttcagta atagctgaac ctgtccaaaa t               1551
//

If you have problems or comments...

PBIL Back to PBIL home page