(data stored in ACNUC19913 zone)

EMBL: EU128170

ID   EU128170; SV 1; linear; mRNA; STD; MAM; 2668 BP.
XX
AC   EU128170;
XX
DT   19-SEP-2007 (Rel. 93, Created)
DT   19-SEP-2007 (Rel. 93, Last updated, Version 1)
XX
DE   Macaca mulatta coagulation factor IX protein mRNA, complete cds.
XX
KW   .
XX
OS   Macaca mulatta (Rhesus monkey)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini;
OC   Cercopithecidae; Cercopithecinae; Macaca.
XX
RN   [1]
RP   1-2668
RA   Wang J., Ding Y., Cheng J.;
RT   ;
RL   Submitted (30-AUG-2007) to the INSDC.
RL   West China Hospital, Sichuan University, Key Laboratory of Transplant
RL   Engineering and Immunology, No.4 Ke Yuan Street, High-Tech Zone, Chengdu,
RL   Sichuan 610041, China
XX
DR   MD5; 6e351f322fc1343b71824b36df08faf7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2668
FT                   /organism="Macaca mulatta"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9544"
FT   CDS_pept        30..1415
FT                   /codon_start=1
FT                   /product="coagulation factor IX protein"
FT                   /db_xref="GOA:A8CZ27"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000294"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR012224"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR017857"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="InterPro:IPR035694"
FT                   /db_xref="InterPro:IPR035972"
FT                   /db_xref="UniProtKB/TrEMBL:A8CZ27"
FT                   /protein_id="ABV25020.1"
FT                   /translation="MQRVNMIMAESPGLITICLLGYLLSAECTVFLDHENANKILNRPK
FT                   RYNSGKLEEFVQGNLERECMEEKCNFEEAREVFENTEKTTEFWKQYVDGDQCESNPCLN
FT                   GGSCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCKQFCKNTADNKVVCSCTEGYRL
FT                   AENQRSCEPAVPFPCGRVSVSQTSTLTRAETVFPDVEYVNSTEAETILDNITQSTQSFN
FT                   DFTRVVGGEDAKPGQFPWQVVLNGKVDAFCGGSIVNEKWVVTAAHCVETDAKITVVAGE
FT                   HNIEETEHTEQKRNVIRIIPHHNYNATINKYNHDIALLELDEPLVLNSYVTPICIADKE
FT                   YTNIFLKFGSGYVSGWGRVFNKGRSASVLQYLRVPLVDRATCLRSTKFTIYNNMFCAGF
FT                   HEGGRDSCQGDSGGPHVTEVEGTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKT
FT                   KLT"
XX
SQ   Sequence 2668 BP; 838 A; 516 C; 531 G; 783 T; 0 other;
     accacttgca caatcagcta gcaaaggtta tgcagcgtgt gaacatgatc atggcagaat        60
     caccaggcct catcaccatc tgccttttag gatatctact cagtgctgaa tgtacagttt       120
     ttcttgatca tgaaaatgcc aacaaaattc tgaatcggcc aaagaggtat aattcaggta       180
     aattggaaga gtttgttcaa gggaaccttg agagagaatg tatggaagaa aagtgtaatt       240
     ttgaagaagc acgagaagtt tttgaaaaca ctgaaaaaac aactgaattt tggaagcagt       300
     atgttgatgg agatcagtgt gagtccaatc catgtttaaa tggtggcagt tgtaaggatg       360
     acattaattc ctatgaatgt tggtgtccat ttggattcga aggaaagaac tgtgaattag       420
     atgtaacatg taacattaag aatggcagat gcaagcagtt ttgtaaaaat actgctgata       480
     acaaggtggt ttgctcctgt accgagggat atcgacttgc agagaaccag aggtcctgtg       540
     aaccagcagt gccatttcca tgtggaagag tttctgtttc acaaacttct acactcaccc       600
     gtgctgagac tgtttttcct gatgtggaat atgtaaattc tactgaagct gaaaccattt       660
     tggataacat cactcaaagc acccaatcat ttaatgactt cactcgggtt gttggtggag       720
     aagatgccaa accaggtcaa ttcccttggc aggtcgtttt gaatggtaaa gttgatgcat       780
     tctgtggagg ctctatcgtt aatgaaaaat gggttgtaac tgctgcccac tgtgttgaaa       840
     ctgatgctaa aattacagtt gtcgcaggtg aacataacat tgaggagaca gaacatacag       900
     agcaaaagcg aaatgtgatt cgaattattc ctcatcacaa ctacaatgca actattaata       960
     agtacaacca tgacattgcc cttctggaac tggatgaacc cttagtgcta aacagctatg      1020
     ttacacctat ttgcattgct gacaaggaat acacgaacat cttcctcaaa tttggatctg      1080
     gctatgtgag tggctgggga agagtcttca acaaaggaag atcagcttca gttcttcagt      1140
     accttagagt tccacttgtt gaccgagcca catgtcttcg atctacaaag ttcaccatct      1200
     ataacaacat gttctgtgct ggcttccatg aaggaggtag agattcatgt caaggagata      1260
     gtgggggacc ccatgttact gaagtggaag ggaccagttt cttaactgga attattagct      1320
     ggggtgaaga gtgtgcaatg aaaggcaaat atggaatata taccaaggta tcccggtatg      1380
     tcaactggat taaggaaaaa acaaagctca cttaatgaaa gatggatttc caaggttaat      1440
     tgattggcaa tgaaaattaa cagggcctct cactaatcac tttcccatct cattatattt      1500
     gaatatatac attctatgat tattgctttt tctctttaca gggaaaattt catgttttac      1560
     ctagcaaatt gattagaaaa tggaatcact agaggaatat aatgtgctag gaaattatag      1620
     ccatttctaa gggcccagcc cttgacaaaa ttgtgaagtg aaattctcca ctctgtccct      1680
     cagatactat ggttctccac tatagcaact aactcatctg attttccctc cttagcagat      1740
     tccatcttcc cgatcttctt tgcttctcca accaaaacat caatgtttat tagttctgta      1800
     tacagtacag catatttggt ctactctatc acaagaccag taccacactc atgaagaaag      1860
     aacacaggag tagctgagag gctaaaactc atcaaataca ctactccttt tcctctatcc      1920
     tattcctgaa tcttttacct ttttcaaatc ccaatcccca aagcagtttt tatctttctt      1980
     actccctctc tcccttttac cctccacagt cattaaagga gagatgggga gcatcattct      2040
     gttatacttc tgtacgcagt tatacatgtc tatcaaaccc agacttgctt tcatagtgga      2100
     gacttgcttt tcagaacata gggatgaagc aacgtgcctg aaaattttgg gggaaaagtt      2160
     tctttcggag agttattata tatatatata catacacaca cacacacaca cacatataca      2220
     cacatataat ggaagcaata agtcattcta agagcttgta tggttatgga aaaaaagctg      2280
     acattgacgc agatatattg tactctttct aaaaattaat aataataatg ctaacagaaa      2340
     gaagagtcta caactagtag agactttgag gaagaattca acagcgtgtc ttcagcagtg      2400
     ttcagagtca agaaagaagt tgaagttgcc tagaccagag gacataagta acatgtctcc      2460
     tttaactggc atgcccctga agtggagaag ggtgcagcag gctcgaagac ataagtcatt      2520
     ccaatcagcc aactaagttg tccttttctg gtttcatgtt caccgtggaa cattttgatt      2580
     atagttaatc cttctatctt gaattttcta gagagttgct gaccaacaga cgtatgtttc      2640
     ccttcgtgaa ttaataaact ggtgttct                                         2668
//

If you have problems or comments...

PBIL Back to PBIL home page