(data stored in ACNUC18020 zone)

EMBL: EU309691

ID   EU309691; SV 1; linear; mRNA; STD; VRT; 261 BP.
XX
AC   EU309691;
XX
DT   25-DEC-2007 (Rel. 94, Created)
DT   25-DEC-2007 (Rel. 94, Last updated, Version 1)
XX
DE   Gallus gallus parathyroid gland beta-actin mRNA, partial cds.
XX
KW   .
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-261
RA   Deng G., Qiao J., He G., Wu B.;
RT   "Cloning and expression of CaSR in chicken";
RL   Unpublished.
XX
RN   [2]
RP   1-261
RA   Deng G., Qiao J., He G., Wu B.;
RT   ;
RL   Submitted (29-NOV-2007) to the INSDC.
RL   College of Veterinary Medicine, China Agricultural University, Yuan Ming
RL   Yuan West Street, Beijing 100094, China
XX
DR   MD5; a1ef16df39f7d3d6371bff4dda493721.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..261
FT                   /organism="Gallus gallus"
FT                   /mol_type="mRNA"
FT                   /country="China"
FT                   /tissue_type="parathyroid gland"
FT                   /note="breed: White Leghorn"
FT                   /db_xref="taxon:9031"
FT   CDS_pept        <1..>261
FT                   /codon_start=1
FT                   /product="beta-actin"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniProtKB/TrEMBL:A9YXX3"
FT                   /protein_id="ABY28110.1"
FT                   /translation="HGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
FT                   KMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGV"
XX
SQ   Sequence 261 BP; 58 A; 75 C; 66 G; 62 T; 0 other;
     cacggtattg tcaccaactg ggatgacatg gagaagatct ggcaccacac cttctacaat        60
     gagttgcgtg ttgctccaga ggagcaccct gtcctgctta ctgaggcccc gctgaaccct       120
     aaagccaaca gggagaagat gacccagatc atgtttgaga ccttcaacac tccagctatg       180
     tacgtggcca tccaggctgt gctgtccctt tatgcctctg gtcgcaccac cggcatcgtc       240
     atggactctg gtgatggtgt t                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page