(data stored in ACNUC10243 zone)

EMBL: EU346758

ID   EU346758; SV 1; linear; mRNA; STD; INV; 598 BP.
XX
AC   EU346758;
XX
DT   04-NOV-2008 (Rel. 97, Created)
DT   04-NOV-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Acyrthosiphon pisum actin mRNA, partial cds.
XX
KW   .
XX
OS   Acyrthosiphon pisum (pea aphid)
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota;
OC   Neoptera; Paraneoptera; Hemiptera; Sternorrhyncha; Aphidomorpha;
OC   Aphidoidea; Aphididae; Macrosiphini; Acyrthosiphon.
XX
RN   [1]
RP   1-598
RA   Chang C.-C., Huang T.-Y., Shih C.-L., Lin G.-W., Cook C.E., Chang W.-C.,
RA   Chen R.P.Y.;
RT   "Developmental expression of Apnanos during oogenesis and embryogenesis in
RT   the parthenogenetic pea aphid Acyrthosiphon pisum";
RL   Int. J. Dev. Biol. 0:0(2008).
XX
RN   [2]
RP   1-598
RA   Huang T.-Y., Chang C.-C.;
RT   ;
RL   Submitted (17-DEC-2007) to the INSDC.
RL   Department of Entomology, National Taiwan University, 27, Lane 113,
RL   Roosevelt Road, Sec. 4, Taipei 106, Taiwan
XX
DR   MD5; 43e3e25680fc06463ee3684dde52d81b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..598
FT                   /organism="Acyrthosiphon pisum"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:7029"
FT   CDS_pept        <1..>598
FT                   /codon_start=2
FT                   /product="actin"
FT                   /note="ApActin; similar to actin from Drosophila;
FT                   cytoskeleton protein"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniProtKB/TrEMBL:B6RS47"
FT                   /protein_id="ACA50155.1"
FT                   /translation="KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFN
FT                   TPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD
FT                   YLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQ
FT                   VITIGNERFRCPEALFQPSFLGMESCGIHETVYNSI"
XX
SQ   Sequence 598 BP; 156 A; 169 C; 124 G; 149 T; 0 other;
     aaaaatctgg catcacactt tctacaacga attgcgtgtt gccccagaag agcacccaat        60
     cctgttgacc gaagccccat tgaacccaaa ggccaatcgt gaaaagatga cccaaatcat       120
     gtttgaaacc ttcaacacac ccgccatgta tgttgccatc caagccgtac tctccttgta       180
     cgcttccggt cgtactactg gtatcgtttt ggactctggt gacggtgtct cacacacagt       240
     acccatctat gaaggttatg cattgcccca tgccatcctc cgtttggact tggctggtcg       300
     tgacttgacc gactacttga tgaagatctt aaccgagaga ggttacagct tcaccaccac       360
     cgctgagcga gaaatcgtcc gtgacattaa ggaaaaattg tgctatgtcg ctttggactt       420
     cgaacaggaa atggctaccg ccgccgcttc cacctcattg gagaaatcct atgaattacc       480
     tgacggacag gtcatcacca tcggaaacga acgtttccgt tgcccagaag ccttgttcca       540
     accttcattc ttgggaatgg aatcttgcgg tatccacgaa accgtataca actccatc         598
//

If you have problems or comments...

PBIL Back to PBIL home page